NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|221513274|ref|NP_001137988.1|]
View 

presenilin, isoform C [Drosophila melanogaster]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Presenilin pfam01080
Presenilin; Mutations in presenilin-1 are a major cause of early onset Alzheimer's disease. It ...
92-499 0e+00

Presenilin; Mutations in presenilin-1 are a major cause of early onset Alzheimer's disease. It has been found that presenilin-1 binds to beta-catenin in-vivo. This family also contains SPE proteins from C.elegans.


:

Pssm-ID: 250348  Cd Length: 403  Bit Score: 541.34  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274   92 EEEQGLKYGAQHVIKLFVPVSLCMLVVVATINSISFYNSTDVYLLYTPFHEQSPEPSVKFWSALANSLILMSVVVVMTFL 171
Cdd:pfam01080   1 EEESSLKYGAKHVIWLFVPVSLCMLLVVATIKSVSFYEQNNGSLLYTPFHSFTPTTGNKLLDSLINTLIMISVLVVMTFL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274  172 LIVLYKKRCYRIIHGWLILSSFMLLFIFTYLYLEELLRAYNIPMDYPTALLIMWNFGVVGMMSIHWQGPLRLQQGYLIFV 251
Cdd:pfam01080  81 LVVFYKYRFYKIIHGWLILSSLLLLFLFSYIYLQEVFKAYNVPMDYPTVFLLIWNFGVVGMMCIHWKGPLRLQQFYLITN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274  252 AALMALVFIKYLPEWTAWAVLAAISIWDLIAVLSPRGPLRILVETAQERNEQIFPALIYSSTVVYALVNTVTPQQSQATA 331
Cdd:pfam01080 161 SALMALVFIKYLPEWTAWFVLAAISFWDLVAVLTPKGPLRMLVETAQERNEPIFPALIYSSTVVVLTVGSNQEETNEGTP 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274  332 SSSPSSSNSTtttratqNSLASPEAAAASGQRTAEA----------------AGFTQEWSANLSERVARRQIEVQStqsg 395
Cdd:pfam01080 241 STIRRTSKST-------RSAANPDSAPTSHSTLELPeksstpelsddesdssETESQSDSSLAPEEDAAEQPEVQS---- 309
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274  396 NAQRSNEYRTVtapdqnhpdgQEERGIKLGLGDFIFYSVLVGKASSYGDWTTTIACFVAILIGLCLTLLLLAIWRKALPA 475
Cdd:pfam01080 310 NSLPSNEKREE----------EEERGVKLGLGDFIFYSVLVGKASATGDWNTTIACFVAILIGLCLTLLLLAVFKKALPA 379
                         410       420
                  ....*....|....*....|....
gi 221513274  476 LPISITFGLIFCFATSAVVKPFME 499
Cdd:pfam01080 380 LPISITFGLIFYFSTMFFVTPFMD 403
 
Name Accession Description Interval E-value
Presenilin pfam01080
Presenilin; Mutations in presenilin-1 are a major cause of early onset Alzheimer's disease. It ...
92-499 0e+00

Presenilin; Mutations in presenilin-1 are a major cause of early onset Alzheimer's disease. It has been found that presenilin-1 binds to beta-catenin in-vivo. This family also contains SPE proteins from C.elegans.


Pssm-ID: 250348  Cd Length: 403  Bit Score: 541.34  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274   92 EEEQGLKYGAQHVIKLFVPVSLCMLVVVATINSISFYNSTDVYLLYTPFHEQSPEPSVKFWSALANSLILMSVVVVMTFL 171
Cdd:pfam01080   1 EEESSLKYGAKHVIWLFVPVSLCMLLVVATIKSVSFYEQNNGSLLYTPFHSFTPTTGNKLLDSLINTLIMISVLVVMTFL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274  172 LIVLYKKRCYRIIHGWLILSSFMLLFIFTYLYLEELLRAYNIPMDYPTALLIMWNFGVVGMMSIHWQGPLRLQQGYLIFV 251
Cdd:pfam01080  81 LVVFYKYRFYKIIHGWLILSSLLLLFLFSYIYLQEVFKAYNVPMDYPTVFLLIWNFGVVGMMCIHWKGPLRLQQFYLITN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274  252 AALMALVFIKYLPEWTAWAVLAAISIWDLIAVLSPRGPLRILVETAQERNEQIFPALIYSSTVVYALVNTVTPQQSQATA 331
Cdd:pfam01080 161 SALMALVFIKYLPEWTAWFVLAAISFWDLVAVLTPKGPLRMLVETAQERNEPIFPALIYSSTVVVLTVGSNQEETNEGTP 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274  332 SSSPSSSNSTtttratqNSLASPEAAAASGQRTAEA----------------AGFTQEWSANLSERVARRQIEVQStqsg 395
Cdd:pfam01080 241 STIRRTSKST-------RSAANPDSAPTSHSTLELPeksstpelsddesdssETESQSDSSLAPEEDAAEQPEVQS---- 309
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274  396 NAQRSNEYRTVtapdqnhpdgQEERGIKLGLGDFIFYSVLVGKASSYGDWTTTIACFVAILIGLCLTLLLLAIWRKALPA 475
Cdd:pfam01080 310 NSLPSNEKREE----------EEERGVKLGLGDFIFYSVLVGKASATGDWNTTIACFVAILIGLCLTLLLLAVFKKALPA 379
                         410       420
                  ....*....|....*....|....
gi 221513274  476 LPISITFGLIFCFATSAVVKPFME 499
Cdd:pfam01080 380 LPISITFGLIFYFSTMFFVTPFMD 403
PSN smart00730
Presenilin, signal peptide peptidase, family; Presenilin 1 and presenilin 2 are polytopic ...
152-494 2.18e-62

Presenilin, signal peptide peptidase, family; Presenilin 1 and presenilin 2 are polytopic membrane proteins, whose genes are mutated in some individuals with Alzheimer's disease. Distant homologues, present in eukaryotes and archaea, also contain conserved aspartic acid residues which are predicted to contribute to catalysis. At least one member of this family has been shown to possess signal peptide peptidase activity.


Pssm-ID: 214793  Cd Length: 249  Bit Score: 205.95  E-value: 2.18e-62
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274   152 WSALANSLILMSVVVVMTFLLIVLYKKRCYRIIHGWLILSSFMLLFIFTYLYLEELLRaynipMDYPTALLIMWNFGVVG 231
Cdd:smart00730   1 EYSLLNSLVAIVFPIVATFVLVLLYKFFKYLVIVLVIYFSSLGVLFLYSLLYPLEVFR-----VDYPTLLILLLNFAVVG 75
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274   232 MMSIHWQgpLRLQQGYLIFVAALMALVFIKYLP-EWTAWAVLAAISIWDLIAVLSPRGPLRILVETAQERNEQI--FPAL 308
Cdd:smart00730  76 FWCIHRK--GAWIQQDLIGISLCMAILFILRLPsEWTAWILLGALFIYDIFAVFGTPGPLRVMVEVATGRDEPIkvFPAL 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274   309 IYSSTVVyalvntvtpqqsqatassspsssnsttttratqnslaspeaaaasgqrtaeaagftqewsanlservarrqie 388
Cdd:smart00730 154 LYVPRLV------------------------------------------------------------------------- 160
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274   389 vqstqsgnaqrsneyrtvtapdQNHPDGQEERGIKLGLGDFIFYSVLVGKASSYG-----DWTTTIACFVAILIGLCLTL 463
Cdd:smart00730 161 ----------------------VSFEDDEEERFSMLGLGDIVFPGILVASAARFDvsvrsDSNYFLACFVAYGIGLILTL 218
                          330       340       350
                   ....*....|....*....|....*....|.
gi 221513274   464 LLLAIWRKALPALPISITFGLIFCFATSAVV 494
Cdd:smart00730 219 VLLALFKKAQPALPYLVPFTLVFYLLTALLR 249
 
Name Accession Description Interval E-value
Presenilin pfam01080
Presenilin; Mutations in presenilin-1 are a major cause of early onset Alzheimer's disease. It ...
92-499 0e+00

Presenilin; Mutations in presenilin-1 are a major cause of early onset Alzheimer's disease. It has been found that presenilin-1 binds to beta-catenin in-vivo. This family also contains SPE proteins from C.elegans.


Pssm-ID: 250348  Cd Length: 403  Bit Score: 541.34  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274   92 EEEQGLKYGAQHVIKLFVPVSLCMLVVVATINSISFYNSTDVYLLYTPFHEQSPEPSVKFWSALANSLILMSVVVVMTFL 171
Cdd:pfam01080   1 EEESSLKYGAKHVIWLFVPVSLCMLLVVATIKSVSFYEQNNGSLLYTPFHSFTPTTGNKLLDSLINTLIMISVLVVMTFL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274  172 LIVLYKKRCYRIIHGWLILSSFMLLFIFTYLYLEELLRAYNIPMDYPTALLIMWNFGVVGMMSIHWQGPLRLQQGYLIFV 251
Cdd:pfam01080  81 LVVFYKYRFYKIIHGWLILSSLLLLFLFSYIYLQEVFKAYNVPMDYPTVFLLIWNFGVVGMMCIHWKGPLRLQQFYLITN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274  252 AALMALVFIKYLPEWTAWAVLAAISIWDLIAVLSPRGPLRILVETAQERNEQIFPALIYSSTVVYALVNTVTPQQSQATA 331
Cdd:pfam01080 161 SALMALVFIKYLPEWTAWFVLAAISFWDLVAVLTPKGPLRMLVETAQERNEPIFPALIYSSTVVVLTVGSNQEETNEGTP 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274  332 SSSPSSSNSTtttratqNSLASPEAAAASGQRTAEA----------------AGFTQEWSANLSERVARRQIEVQStqsg 395
Cdd:pfam01080 241 STIRRTSKST-------RSAANPDSAPTSHSTLELPeksstpelsddesdssETESQSDSSLAPEEDAAEQPEVQS---- 309
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274  396 NAQRSNEYRTVtapdqnhpdgQEERGIKLGLGDFIFYSVLVGKASSYGDWTTTIACFVAILIGLCLTLLLLAIWRKALPA 475
Cdd:pfam01080 310 NSLPSNEKREE----------EEERGVKLGLGDFIFYSVLVGKASATGDWNTTIACFVAILIGLCLTLLLLAVFKKALPA 379
                         410       420
                  ....*....|....*....|....
gi 221513274  476 LPISITFGLIFCFATSAVVKPFME 499
Cdd:pfam01080 380 LPISITFGLIFYFSTMFFVTPFMD 403
PSN smart00730
Presenilin, signal peptide peptidase, family; Presenilin 1 and presenilin 2 are polytopic ...
152-494 2.18e-62

Presenilin, signal peptide peptidase, family; Presenilin 1 and presenilin 2 are polytopic membrane proteins, whose genes are mutated in some individuals with Alzheimer's disease. Distant homologues, present in eukaryotes and archaea, also contain conserved aspartic acid residues which are predicted to contribute to catalysis. At least one member of this family has been shown to possess signal peptide peptidase activity.


Pssm-ID: 214793  Cd Length: 249  Bit Score: 205.95  E-value: 2.18e-62
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274   152 WSALANSLILMSVVVVMTFLLIVLYKKRCYRIIHGWLILSSFMLLFIFTYLYLEELLRaynipMDYPTALLIMWNFGVVG 231
Cdd:smart00730   1 EYSLLNSLVAIVFPIVATFVLVLLYKFFKYLVIVLVIYFSSLGVLFLYSLLYPLEVFR-----VDYPTLLILLLNFAVVG 75
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274   232 MMSIHWQgpLRLQQGYLIFVAALMALVFIKYLP-EWTAWAVLAAISIWDLIAVLSPRGPLRILVETAQERNEQI--FPAL 308
Cdd:smart00730  76 FWCIHRK--GAWIQQDLIGISLCMAILFILRLPsEWTAWILLGALFIYDIFAVFGTPGPLRVMVEVATGRDEPIkvFPAL 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274   309 IYSSTVVyalvntvtpqqsqatassspsssnsttttratqnslaspeaaaasgqrtaeaagftqewsanlservarrqie 388
Cdd:smart00730 154 LYVPRLV------------------------------------------------------------------------- 160
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221513274   389 vqstqsgnaqrsneyrtvtapdQNHPDGQEERGIKLGLGDFIFYSVLVGKASSYG-----DWTTTIACFVAILIGLCLTL 463
Cdd:smart00730 161 ----------------------VSFEDDEEERFSMLGLGDIVFPGILVASAARFDvsvrsDSNYFLACFVAYGIGLILTL 218
                          330       340       350
                   ....*....|....*....|....*....|.
gi 221513274   464 LLLAIWRKALPALPISITFGLIFCFATSAVV 494
Cdd:smart00730 219 VLLALFKKAQPALPYLVPFTLVFYLLTALLR 249
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH