NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|22094987|ref|NP_065812|]
View 

regulatory-associated protein of mTOR isoform 1 [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Raptor_N pfam14538
Raptor N-terminal CASPase like domain; This domain is found at the N-terminus of the Raptor ...
54-207 1.08e-96

Raptor N-terminal CASPase like domain; This domain is found at the N-terminus of the Raptor protein. It has been identified to have a CASPase like structure. It conserves the characteristic cys/his dyad of the caspases suggesting it may have a peptidase activity.


:

Pssm-ID: 258678  Cd Length: 154  Bit Score: 306.89  E-value: 1.08e-96
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987     54 RMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKL 133
Cdd:pfam14538    1 RMKTVSVALVLCLNIGVDPPDVRKTNPCARLECWIDPSVLPPSKALETIGKALQSQYERWQPKARYKQSVDPTVEDVKRL 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 22094987    134 CTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFK 207
Cdd:pfam14538   81 CQSLRRNAKDERVLFHYNGHGVPRPTENGEIWVFNKNYTQYIPLSIYELQSWLGSPSIYIFDCSNAGSLLNAFK 154
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
1027-1322 1.94e-23

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


:

Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 102.41  E-value: 1.94e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1027 SVVKFHPFTPCIAVADKDSICF-WDWEKGEKLDYF--HNGNPRYTRVTAmeylngqDCSLLLTATDDGAIRVWknfaDLE 1103
Cdd:cd00200   13 TCVAFSPDGKLLATGSGDGTIKvWDLETGELLRTLkgHTGPVRDVAASA-------DGTYLASGSSDKTIRLW----DLE 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1104 KNpEMVTAWQGLSDMLpttrgagMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIpTGADSCVTSLSCDSHRSLIVA 1183
Cdd:cd00200   82 TG-ECVRTLTGHTSYV-------SSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTL-RGHTDWVNSVAFSPDGTFVAS 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1184 GLGDGSIRVYDrrMALSECrVMTYREHTAWVvkASLQKRPDG-HIVSVSVNGDVRIFDPRMPESVNVLQI-VKGLTALDI 1261
Cdd:cd00200  153 SSQDGTIKLWD--LRTGKC-VATLTGHTGEV--NSVAFSPDGeKLLSSSSDGTIKLWDLSTGKCLGTLRGhENGVNSVAF 227
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 22094987 1262 HPQADLIACGSVNqftaiynssgeliNNIKYYDGFMGQRV-------GAISCLAFHPHWPHLAVGSND 1322
Cdd:cd00200  228 SPDGYLLASGSED-------------GTIRVWDLRTGECVqtlsghtNSVTSLAWSPDGKRLASGSAD 282
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
1019-1332 5.92e-24

FOG: WD40 repeat [General function prediction only]


:

Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 105.56  E-value: 5.92e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1019 LNRNPGVPSVVKFHPFTPCIAVA--DKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNgqdcSLLLTATDDGAIRVW 1096
Cdd:COG2319  151 LEGHSESVTSLAFSPDGKLLASGssLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGG----LLIASGSSDGTIRLW 226
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1097 knfaDLEKNPEMVTAWQGLSDMLpttrgagmVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDS 1176
Cdd:COG2319  227 ----DLSTGKLLRSTLSGHSDSV--------VSSFSPDGSLLASGSSDGTIRLWDLRSSSSLLRTLSGHSSSVLSVAFSP 294
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1177 HRSLIVAGLGDGSIRVYDRRMaLSECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGL 1256
Cdd:COG2319  295 DGKLLASGSSDGTVRLWDLET-GKLLSSLTLKGHEGPVSSLSFSPDGSLLVSGGSDDGTIRLWDLRTGKPLKTLEGHSNV 373
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 22094987 1257 TALDIHPQADLIACGSVNQFTAIYNSSGELInnikyyDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEK 1332
Cdd:COG2319  374 LSVSFSPDGRVVSSGSTDGTVRLWDLSTGSL------LRNLDGHTSRVTSLDFSPDGKSLASGSSDNTIRLWDLKT 443
HEAT_2 pfam13646
HEAT repeats; This family includes multiple HEAT repeats.
566-668 1.14e-05

HEAT repeats; This family includes multiple HEAT repeats.


:

Pssm-ID: 257956 [Multi-domain]  Cd Length: 88  Bit Score: 45.02  E-value: 1.14e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987    566 LNDPHPLLRQWVAICLGRIWQnfdsarwcgvrDSAHEKLYSLLSDPIPEVRCAAVFALGtfvgnsaeRTDHSTTIDHnva 645
Cdd:pfam13646    9 LSDPDPEVRAAAARALGELGD-----------PEALPALLELLKDPDPEVRRAAAEALG--------KLGDPEALPA--- 66
                           90       100
                   ....*....|....*....|...
gi 22094987    646 mMLAQLVSDGSPMVRKELVVALS 668
Cdd:pfam13646   67 -LLELLQDDEDAVVRAAAASALA 88
 
Name Accession Description Interval E-value
Raptor_N pfam14538
Raptor N-terminal CASPase like domain; This domain is found at the N-terminus of the Raptor ...
54-207 1.08e-96

Raptor N-terminal CASPase like domain; This domain is found at the N-terminus of the Raptor protein. It has been identified to have a CASPase like structure. It conserves the characteristic cys/his dyad of the caspases suggesting it may have a peptidase activity.


Pssm-ID: 258678  Cd Length: 154  Bit Score: 306.89  E-value: 1.08e-96
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987     54 RMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKL 133
Cdd:pfam14538    1 RMKTVSVALVLCLNIGVDPPDVRKTNPCARLECWIDPSVLPPSKALETIGKALQSQYERWQPKARYKQSVDPTVEDVKRL 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 22094987    134 CTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFK 207
Cdd:pfam14538   81 CQSLRRNAKDERVLFHYNGHGVPRPTENGEIWVFNKNYTQYIPLSIYELQSWLGSPSIYIFDCSNAGSLLNAFK 154
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
1027-1322 1.94e-23

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 102.41  E-value: 1.94e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1027 SVVKFHPFTPCIAVADKDSICF-WDWEKGEKLDYF--HNGNPRYTRVTAmeylngqDCSLLLTATDDGAIRVWknfaDLE 1103
Cdd:cd00200   13 TCVAFSPDGKLLATGSGDGTIKvWDLETGELLRTLkgHTGPVRDVAASA-------DGTYLASGSSDKTIRLW----DLE 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1104 KNpEMVTAWQGLSDMLpttrgagMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIpTGADSCVTSLSCDSHRSLIVA 1183
Cdd:cd00200   82 TG-ECVRTLTGHTSYV-------SSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTL-RGHTDWVNSVAFSPDGTFVAS 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1184 GLGDGSIRVYDrrMALSECrVMTYREHTAWVvkASLQKRPDG-HIVSVSVNGDVRIFDPRMPESVNVLQI-VKGLTALDI 1261
Cdd:cd00200  153 SSQDGTIKLWD--LRTGKC-VATLTGHTGEV--NSVAFSPDGeKLLSSSSDGTIKLWDLSTGKCLGTLRGhENGVNSVAF 227
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 22094987 1262 HPQADLIACGSVNqftaiynssgeliNNIKYYDGFMGQRV-------GAISCLAFHPHWPHLAVGSND 1322
Cdd:cd00200  228 SPDGYLLASGSED-------------GTIRVWDLRTGECVqtlsghtNSVTSLAWSPDGKRLASGSAD 282
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
1019-1332 5.92e-24

FOG: WD40 repeat [General function prediction only]


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 105.56  E-value: 5.92e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1019 LNRNPGVPSVVKFHPFTPCIAVA--DKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNgqdcSLLLTATDDGAIRVW 1096
Cdd:COG2319  151 LEGHSESVTSLAFSPDGKLLASGssLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGG----LLIASGSSDGTIRLW 226
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1097 knfaDLEKNPEMVTAWQGLSDMLpttrgagmVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDS 1176
Cdd:COG2319  227 ----DLSTGKLLRSTLSGHSDSV--------VSSFSPDGSLLASGSSDGTIRLWDLRSSSSLLRTLSGHSSSVLSVAFSP 294
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1177 HRSLIVAGLGDGSIRVYDRRMaLSECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGL 1256
Cdd:COG2319  295 DGKLLASGSSDGTVRLWDLET-GKLLSSLTLKGHEGPVSSLSFSPDGSLLVSGGSDDGTIRLWDLRTGKPLKTLEGHSNV 373
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 22094987 1257 TALDIHPQADLIACGSVNQFTAIYNSSGELInnikyyDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEK 1332
Cdd:COG2319  374 LSVSFSPDGRVVSSGSTDGTVRLWDLSTGSL------LRNLDGHTSRVTSLDFSPDGKSLASGSSDNTIRLWDLKT 443
HEAT_2 pfam13646
HEAT repeats; This family includes multiple HEAT repeats.
566-668 1.14e-05

HEAT repeats; This family includes multiple HEAT repeats.


Pssm-ID: 257956 [Multi-domain]  Cd Length: 88  Bit Score: 45.02  E-value: 1.14e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987    566 LNDPHPLLRQWVAICLGRIWQnfdsarwcgvrDSAHEKLYSLLSDPIPEVRCAAVFALGtfvgnsaeRTDHSTTIDHnva 645
Cdd:pfam13646    9 LSDPDPEVRAAAARALGELGD-----------PEALPALLELLKDPDPEVRRAAAEALG--------KLGDPEALPA--- 66
                           90       100
                   ....*....|....*....|...
gi 22094987    646 mMLAQLVSDGSPMVRKELVVALS 668
Cdd:pfam13646   67 -LLELLQDDEDAVVRAAAASALA 88
COG5096 COG5096
Vesicle coat complex, various subunits [Intracellular trafficking and secretion]
472-676 7.34e-05

Vesicle coat complex, various subunits [Intracellular trafficking and secretion]


Pssm-ID: 227427 [Multi-domain]  Cd Length: 757  Bit Score: 45.87  E-value: 7.34e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987  472 IFPYVLKLLQSSARELRPLLVFIW---AK------ILAVDSscqadLVKDNGHKyflsvlaDPYMpaehRTMTAFILAVI 542
Cdd:COG5096   56 LFPDVIKNVATRDVELKRLLYLYLeryAKlkpelaLLAVNT-----IQKDLQDP-------NEEI----RGFALRTLSLL 119
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987  543 vnsyhtgQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQnFDSARWCGVRDSAHEKLysLLSDPIPEVRCAAVFA 622
Cdd:COG5096  120 -------RVKELLGNIIDPIKKLLTDPHAYVRKTAALAVAKLYR-LDKDLYHELGLIDILKE--LVADSDPIVIANALAS 189
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....
gi 22094987  623 LGTFVGNSAErtDHSTTIDHNVAMMLAQLVSDGSPMVRKELVVALSHLVVQYES 676
Cdd:COG5096  190 LAEIDPELAH--GYSLEVILRIPQLDLLSLSVSTEWLLLIILEVLTERVPTTPD 241
 
Name Accession Description Interval E-value
Raptor_N pfam14538
Raptor N-terminal CASPase like domain; This domain is found at the N-terminus of the Raptor ...
54-207 1.08e-96

Raptor N-terminal CASPase like domain; This domain is found at the N-terminus of the Raptor protein. It has been identified to have a CASPase like structure. It conserves the characteristic cys/his dyad of the caspases suggesting it may have a peptidase activity.


Pssm-ID: 258678  Cd Length: 154  Bit Score: 306.89  E-value: 1.08e-96
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987     54 RMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKL 133
Cdd:pfam14538    1 RMKTVSVALVLCLNIGVDPPDVRKTNPCARLECWIDPSVLPPSKALETIGKALQSQYERWQPKARYKQSVDPTVEDVKRL 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 22094987    134 CTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFK 207
Cdd:pfam14538   81 CQSLRRNAKDERVLFHYNGHGVPRPTENGEIWVFNKNYTQYIPLSIYELQSWLGSPSIYIFDCSNAGSLLNAFK 154
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
1027-1322 1.94e-23

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 102.41  E-value: 1.94e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1027 SVVKFHPFTPCIAVADKDSICF-WDWEKGEKLDYF--HNGNPRYTRVTAmeylngqDCSLLLTATDDGAIRVWknfaDLE 1103
Cdd:cd00200   13 TCVAFSPDGKLLATGSGDGTIKvWDLETGELLRTLkgHTGPVRDVAASA-------DGTYLASGSSDKTIRLW----DLE 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1104 KNpEMVTAWQGLSDMLpttrgagMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIpTGADSCVTSLSCDSHRSLIVA 1183
Cdd:cd00200   82 TG-ECVRTLTGHTSYV-------SSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTL-RGHTDWVNSVAFSPDGTFVAS 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1184 GLGDGSIRVYDrrMALSECrVMTYREHTAWVvkASLQKRPDG-HIVSVSVNGDVRIFDPRMPESVNVLQI-VKGLTALDI 1261
Cdd:cd00200  153 SSQDGTIKLWD--LRTGKC-VATLTGHTGEV--NSVAFSPDGeKLLSSSSDGTIKLWDLSTGKCLGTLRGhENGVNSVAF 227
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 22094987 1262 HPQADLIACGSVNqftaiynssgeliNNIKYYDGFMGQRV-------GAISCLAFHPHWPHLAVGSND 1322
Cdd:cd00200  228 SPDGYLLASGSED-------------GTIRVWDLRTGECVqtlsghtNSVTSLAWSPDGKRLASGSAD 282
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
1069-1334 6.49e-20

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 91.24  E-value: 6.49e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1069 RVTAMEYLNGQDcsLLLTATDDGAIRVWknfaDLEKNpEMVTAWQGLSdmlpttrGAGMVVDWEQETGLLMSSGDVRIVR 1148
Cdd:cd00200   11 GVTCVAFSPDGK--LLATGSGDGTIKVW----DLETG-ELLRTLKGHT-------GPVRDVAASADGTYLASGSSDKTIR 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1149 IWDTDREMKVQDIpTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDrrMALSECrVMTYREHTAWVVkaSLQKRPDGHIV 1228
Cdd:cd00200   77 LWDLETGECVRTL-TGHTSYVSSVAFSPDGRILSSSSRDKTIKVWD--VETGKC-LTTLRGHTDWVN--SVAFSPDGTFV 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1229 -SVSVNGDVRIFDPRMPESVNVLQI-VKGLTALDIHPQADLIACGSVNQFTAIYN-SSGELINNIKYYDGFmgqrvgaIS 1305
Cdd:cd00200  151 aSSSQDGTIKLWDLRTGKCVATLTGhTGEVNSVAFSPDGEKLLSSSSDGTIKLWDlSTGKCLGTLRGHENG-------VN 223
                        250       260
                 ....*....|....*....|....*....
gi 22094987 1306 CLAFHPHWPHLAVGSNDYYISVYSVEKRV 1334
Cdd:cd00200  224 SVAFSPDGYLLASGSEDGTIRVWDLRTGE 252
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
1123-1330 4.36e-19

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 88.93  E-value: 4.36e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1123 RGAGMVVDWEQETGLLMSSGDVRIVRIWDTDReMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRmalSEC 1202
Cdd:cd00200    9 TGGVTCVAFSPDGKLLATGSGDGTIKVWDLET-GELLRTLKGHTGPVRDVAASADGTYLASGSSDKTIRLWDLE---TGE 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1203 RVMTYREHTAWVvkASLQKRPDGHIVSVS-VNGDVRIFDPRMPESVNVLQ-IVKGLTALDIHPQADLIACGSVNQFTAIY 1280
Cdd:cd00200   85 CVRTLTGHTSYV--SSVAFSPDGRILSSSsRDKTIKVWDVETGKCLTTLRgHTDWVNSVAFSPDGTFVASSSQDGTIKLW 162
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|.
gi 22094987 1281 N-SSGELINNIKYYDGFmgqrvgaISCLAFHPHWPHLAVGSNDYYISVYSV 1330
Cdd:cd00200  163 DlRTGKCVATLTGHTGE-------VNSVAFSPDGEKLLSSSSDGTIKLWDL 206
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
1029-1240 2.57e-15

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 76.99  E-value: 2.57e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1029 VKFHPFTPCIAVADKDSICF-WDWEKGEKLDYF--HNGNprytrVTAMEYLngQDCSLLLTATDDGAIRVWknfaDLEKN 1105
Cdd:cd00200   57 VAASADGTYLASGSSDKTIRlWDLETGECVRTLtgHTSY-----VSSVAFS--PDGRILSSSSRDKTIKVW----DVETG 125
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1106 pEMVTAWQGLSDmlpttrgAGMVVDWEQETGLLMSSGDVRIVRIWDT--------------------------------- 1152
Cdd:cd00200  126 -KCLTTLRGHTD-------WVNSVAFSPDGTFVASSSQDGTIKLWDLrtgkcvatltghtgevnsvafspdgekllssss 197
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1153 DREMKVQDIPTGADSC--------VTSLSCDSHRSLIVAGLGDGSIRVYDRRMAlsECrVMTYREHTAWVVKASLQkrPD 1224
Cdd:cd00200  198 DGTIKLWDLSTGKCLGtlrghengVNSVAFSPDGYLLASGSEDGTIRVWDLRTG--EC-VQTLSGHTNSVTSLAWS--PD 272
                        250
                 ....*....|....*..
gi 22094987 1225 GH-IVSVSVNGDVRIFD 1240
Cdd:cd00200  273 GKrLASGSADGTIRIWD 289
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
1019-1332 5.92e-24

FOG: WD40 repeat [General function prediction only]


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 105.56  E-value: 5.92e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1019 LNRNPGVPSVVKFHPFTPCIAVA--DKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNgqdcSLLLTATDDGAIRVW 1096
Cdd:COG2319  151 LEGHSESVTSLAFSPDGKLLASGssLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGG----LLIASGSSDGTIRLW 226
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1097 knfaDLEKNPEMVTAWQGLSDMLpttrgagmVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDS 1176
Cdd:COG2319  227 ----DLSTGKLLRSTLSGHSDSV--------VSSFSPDGSLLASGSSDGTIRLWDLRSSSSLLRTLSGHSSSVLSVAFSP 294
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1177 HRSLIVAGLGDGSIRVYDRRMaLSECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGL 1256
Cdd:COG2319  295 DGKLLASGSSDGTVRLWDLET-GKLLSSLTLKGHEGPVSSLSFSPDGSLLVSGGSDDGTIRLWDLRTGKPLKTLEGHSNV 373
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 22094987 1257 TALDIHPQADLIACGSVNQFTAIYNSSGELInnikyyDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEK 1332
Cdd:COG2319  374 LSVSFSPDGRVVSSGSTDGTVRLWDLSTGSL------LRNLDGHTSRVTSLDFSPDGKSLASGSSDNTIRLWDLKT 443
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
1082-1333 1.89e-16

FOG: WD40 repeat [General function prediction only]


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 82.44  E-value: 1.89e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1082 SLLLTATDDGAIRVWknfaDLEKNPEMVTAWQGLSDmLPTTRGAGMVVDweQETGLLMSSGDVRIVRIWDTDREMKVQDI 1161
Cdd:COG2319   78 ELLLSGSSDGTIKLW----DLDNGEKLIKSLEGLHD-SSVSKLALSSPD--GNSILLASSSLDGTVKLWDLSTPGKLIRT 150
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1162 PTGADSCVTSLS-CDSHRSLIVAGLGDGSIRVYDRRmalSECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFD 1240
Cdd:COG2319  151 LEGHSESVTSLAfSPDGKLLASGSSLDGTIKLWDLR---TGKPLSTLAGHTDPVSSLAFSPDGGLLIASGSSDGTIRLWD 227
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1241 PRMPESV-NVLQIVKGLTALDIHPQADLIACGSVNQFTAIYN--SSGELINNIKYYDGfmgqrvgAISCLAFHPHWPHLA 1317
Cdd:COG2319  228 LSTGKLLrSTLSGHSDSVVSSFSPDGSLLASGSSDGTIRLWDlrSSSSLLRTLSGHSS-------SVLSVAFSPDGKLLA 300
                        250
                 ....*....|....*.
gi 22094987 1318 VGSNDYYISVYSVEKR 1333
Cdd:COG2319  301 SGSSDGTVRLWDLETG 316
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
1129-1331 1.27e-10

FOG: WD40 repeat [General function prediction only]


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 63.95  E-value: 1.27e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1129 VDWEQETGLLMSSGDVRIVRIWDTD-REMKVQDIPTGADSCVTSL---SCDSHRSLIVAGLGDGSIRVYDRRMALseCRV 1204
Cdd:COG2319   71 IAFSPDGELLLSGSSDGTIKLWDLDnGEKLIKSLEGLHDSSVSKLalsSPDGNSILLASSSLDGTVKLWDLSTPG--KLI 148
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1205 MTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQI-VKGLTALDIHPQAD-LIACGSVNQFTAIYN- 1281
Cdd:COG2319  149 RTLEGHSESVTSLAFSPDGKLLASGSSLDGTIKLWDLRTGKPLSTLAGhTDPVSSLAFSPDGGlLIASGSSDGTIRLWDl 228
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|
gi 22094987 1282 SSGELINNIkyydgFMGQRVGAISClaFHPHWPHLAVGSNDYYISVYSVE 1331
Cdd:COG2319  229 STGKLLRST-----LSGHSDSVVSS--FSPDGSLLASGSSDGTIRLWDLR 271
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
1163-1332 6.57e-06

FOG: WD40 repeat [General function prediction only]


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 48.93  E-value: 6.57e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1163 TGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMalSECRVMTYREHTAWVVKASLQKRPDGHIV---SVSVNGDVRIF 1239
Cdd:COG2319   62 RGHEDSITSIAFSPDGELLLSGSSDGTIKLWDLDN--GEKLIKSLEGLHDSSVSKLALSSPDGNSIllaSSSLDGTVKLW 139
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987 1240 DPRMP-ESVNVLQIVKG-LTALDIHPQADLIAcgsvnqftaiynSSGELINNIKYYDGFMGQRV-------GAISCLAFH 1310
Cdd:COG2319  140 DLSTPgKLIRTLEGHSEsVTSLAFSPDGKLLA------------SGSSLDGTIKLWDLRTGKPLstlaghtDPVSSLAFS 207
                        170       180
                 ....*....|....*....|...
gi 22094987 1311 PHWPHLAVG-SNDYYISVYSVEK 1332
Cdd:COG2319  208 PDGGLLIASgSSDGTIRLWDLST 230
HEAT_2 pfam13646
HEAT repeats; This family includes multiple HEAT repeats.
566-668 1.14e-05

HEAT repeats; This family includes multiple HEAT repeats.


Pssm-ID: 257956 [Multi-domain]  Cd Length: 88  Bit Score: 45.02  E-value: 1.14e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987    566 LNDPHPLLRQWVAICLGRIWQnfdsarwcgvrDSAHEKLYSLLSDPIPEVRCAAVFALGtfvgnsaeRTDHSTTIDHnva 645
Cdd:pfam13646    9 LSDPDPEVRAAAARALGELGD-----------PEALPALLELLKDPDPEVRRAAAEALG--------KLGDPEALPA--- 66
                           90       100
                   ....*....|....*....|...
gi 22094987    646 mMLAQLVSDGSPMVRKELVVALS 668
Cdd:pfam13646   67 -LLELLQDDEDAVVRAAAASALA 88
COG5096 COG5096
Vesicle coat complex, various subunits [Intracellular trafficking and secretion]
472-676 7.34e-05

Vesicle coat complex, various subunits [Intracellular trafficking and secretion]


Pssm-ID: 227427 [Multi-domain]  Cd Length: 757  Bit Score: 45.87  E-value: 7.34e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987  472 IFPYVLKLLQSSARELRPLLVFIW---AK------ILAVDSscqadLVKDNGHKyflsvlaDPYMpaehRTMTAFILAVI 542
Cdd:COG5096   56 LFPDVIKNVATRDVELKRLLYLYLeryAKlkpelaLLAVNT-----IQKDLQDP-------NEEI----RGFALRTLSLL 119
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987  543 vnsyhtgQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQnFDSARWCGVRDSAHEKLysLLSDPIPEVRCAAVFA 622
Cdd:COG5096  120 -------RVKELLGNIIDPIKKLLTDPHAYVRKTAALAVAKLYR-LDKDLYHELGLIDILKE--LVADSDPIVIANALAS 189
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....
gi 22094987  623 LGTFVGNSAErtDHSTTIDHNVAMMLAQLVSDGSPMVRKELVVALSHLVVQYES 676
Cdd:COG5096  190 LAEIDPELAH--GYSLEVILRIPQLDLLSLSVSTEWLLLIILEVLTERVPTTPD 241
HEAT_2 pfam13646
HEAT repeats; This family includes multiple HEAT repeats.
559-624 2.12e-04

HEAT repeats; This family includes multiple HEAT repeats.


Pssm-ID: 257956 [Multi-domain]  Cd Length: 88  Bit Score: 41.17  E-value: 2.12e-04
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 22094987    559 IAICLEQLNDPHPLLRQWVAICLGRIwqnfdsarwcGVRDSAHEKLYSLLSDPIPEVRCAAVFALG 624
Cdd:pfam13646   33 LPALLELLKDPDPEVRRAAAEALGKL----------GDPEALPALLELLQDDEDAVVRAAAASALA 88
HEAT_2 pfam13646
HEAT repeats; This family includes multiple HEAT repeats.
607-670 6.53e-04

HEAT repeats; This family includes multiple HEAT repeats.


Pssm-ID: 257956 [Multi-domain]  Cd Length: 88  Bit Score: 39.63  E-value: 6.53e-04
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 22094987    607 LLSDPIPEVRCAAVFALGTFVGNSAERTdhsttidhnvammLAQLVSDGSPMVRKELVVALSHL 670
Cdd:pfam13646    8 LLSDPDPEVRAAAARALGELGDPEALPA-------------LLELLKDPDPEVRRAAAEALGKL 58
COG1413 COG1413
FOG: HEAT repeat [Energy production and conversion]
557-624 7.49e-04

FOG: HEAT repeat [Energy production and conversion]


Pssm-ID: 224331 [Multi-domain]  Cd Length: 335  Bit Score: 41.83  E-value: 7.49e-04
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 22094987  557 NLIAICLEQLNDPHPLLRQWVAICLGRIwqnFDSARWcgvrdsAHEKLYSLLSDPIPEVRCAAVFALG 624
Cdd:COG1413  180 EAIPLLIELLEDEDADVRRAAASALGQL---GSENVE------AADLLVKALSDESLEVRKAALLALG 238
COG1413 COG1413
FOG: HEAT repeat [Energy production and conversion]
567-689 1.48e-03

FOG: HEAT repeat [Energy production and conversion]


Pssm-ID: 224331 [Multi-domain]  Cd Length: 335  Bit Score: 41.06  E-value: 1.48e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22094987  567 NDPHPLLRQWVAICLGRI---------------------WQNFDSARWcGVRDSAHEKLYSL------------LSDPIP 613
Cdd:COG1413  116 NDENEGVRAAAARALGKLgderaldpllealqdedsgsaAAALDAALL-DVRAAAAEALGELgdpeaipllielLEDEDA 194
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 22094987  614 EVRCAAVFALGTFVGNSAERTDHsttidhnvammLAQLVSDGSPMVRKELVVALSHLVvqYESNFCTVALQFIEEE 689
Cdd:COG1413  195 DVRRAAASALGQLGSENVEAADL-----------LVKALSDESLEVRKAALLALGEIG--DEEAVDALAKALEDED 257
Cnd1 pfam12717
non-SMC mitotic condensation complex subunit 1; The three non-SMC (structural maintenance of ...
613-673 7.26e-03

non-SMC mitotic condensation complex subunit 1; The three non-SMC (structural maintenance of chromosomes) subunits of the mitotic condensation complex are Cnd1-3. The whole complex is essential for viability and the condensing of chromosomes in mitosis.


Pssm-ID: 257244 [Multi-domain]  Cd Length: 172  Bit Score: 37.55  E-value: 7.26e-03
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 22094987    613 PEVRCAAVFALGTFvgnsAERtdHSTTIDHNVAMMLAQLvSDGSPMVRKELVVALSHLVVQ 673
Cdd:pfam12717    2 PLIRNNAVIALGDL----CIR--YPNLVEPYTPNLYRCL-RDEDPYVRKTALLVLTHLILN 55
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH