NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|220907520|ref|YP_002482831|]
View 

serine/threonine phosphoprotein phosphatase [Cyanothece sp. PCC 7425]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
12-237 4.26e-65

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


:

Pssm-ID: 257978  Cd Length: 210  Bit Score: 204.85  E-value: 4.26e-65
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 220907520   12 TGTSHYANNLPCQDRTVSKTIVDGSgqeifLAAVADGAGSAYRSEYGAEIATKLILSKIEDYFRQGEV--LANLSREIVG 89
Cdd:pfam13672   1 RGTSHIRRGLPCQDAFAYRVLSDGW-----LIAVADGAGSAKYSDVGARLAVEAAVEALRELLDSGELpeLEALVRQILN 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 220907520   90 NWIEQISDQicelANDEGLGLREYACTLLAAVVKPTDGVFFQIGDGAIV-IGTDEDYFPVFWPVTGEYVNSTYFITDKIS 168
Cdd:pfam13672  76 DILALVRQE----AAAQGLEPRDYATTLLLAVITPGGIVFFQIGDGAIVvRDRDGELQLLSEPDSGEYANETTFLTSPDA 151
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 220907520  169 LKELQFKSINNQLIEDIALMSDGLQglaLQFATKTAHSPFFKPMFARLAEESnpglsevLNASLKNFLD 237
Cdd:pfam13672 152 LEEFRIRRLTLEPGDALALMTDGLS---DSLVTEEPFFPFFAPLLETLEEEG-------ASEQLAEFLE 210
 
Name Accession Description Interval E-value
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
12-237 4.26e-65

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 204.85  E-value: 4.26e-65
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 220907520   12 TGTSHYANNLPCQDRTVSKTIVDGSgqeifLAAVADGAGSAYRSEYGAEIATKLILSKIEDYFRQGEV--LANLSREIVG 89
Cdd:pfam13672   1 RGTSHIRRGLPCQDAFAYRVLSDGW-----LIAVADGAGSAKYSDVGARLAVEAAVEALRELLDSGELpeLEALVRQILN 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 220907520   90 NWIEQISDQicelANDEGLGLREYACTLLAAVVKPTDGVFFQIGDGAIV-IGTDEDYFPVFWPVTGEYVNSTYFITDKIS 168
Cdd:pfam13672  76 DILALVRQE----AAAQGLEPRDYATTLLLAVITPGGIVFFQIGDGAIVvRDRDGELQLLSEPDSGEYANETTFLTSPDA 151
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 220907520  169 LKELQFKSINNQLIEDIALMSDGLQglaLQFATKTAHSPFFKPMFARLAEESnpglsevLNASLKNFLD 237
Cdd:pfam13672 152 LEEFRIRRLTLEPGDALALMTDGLS---DSLVTEEPFFPFFAPLLETLEEEG-------ASEQLAEFLE 210
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
19-148 1.27e-04

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 41.16  E-value: 1.27e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 220907520  19 NNLPCQDRTVSKTivDGSGQEIFLAAVADGAGSAYRSEYGAEIATKLILSKIEDYFrqgevlaNLSREIVGNWIE----Q 94
Cdd:cd00143   11 DRKTNEDAVVIKP--NLNNEDGGLFGVFDGHGGHAAGEFASKLLVEELLEELEETL-------TLSEEDIEEALRkaflR 81
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 220907520  95 ISDQICELANDEGLGLREyACTLLAAVVKPTDGVFFQIGDGAIVIGTDEDYFPV 148
Cdd:cd00143   82 ADEEILEEAQDEPDDARS-GTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQL 134
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
19-144 4.24e-03

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 36.58  E-value: 4.24e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 220907520    19 NNLPCQDRTVsktIVDGSGQEIFLAAVADGAGSAYRSEYGAeiatKLILSKIEDYFRQGEVLANLSREIVGNWIEQISDQ 98
Cdd:smart00332  19 VRKPMEDAHV---ITPDLSDSGGFFGVFDGHGGSEAAKFLS----KNLPEILAEELIKEKDELEDVEEALRKAFLSTDEE 91
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*.
gi 220907520    99 ICElANDEGLGlreyaCTLLAAVVKPTDGVFFQIGDGAIVIGTDED 144
Cdd:smart00332  92 ILE-ELEALSG-----STAVVALISGNKLYVANVGDSRAVLCRNGK 131
 
Name Accession Description Interval E-value
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
12-237 4.26e-65

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 204.85  E-value: 4.26e-65
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 220907520   12 TGTSHYANNLPCQDRTVSKTIVDGSgqeifLAAVADGAGSAYRSEYGAEIATKLILSKIEDYFRQGEV--LANLSREIVG 89
Cdd:pfam13672   1 RGTSHIRRGLPCQDAFAYRVLSDGW-----LIAVADGAGSAKYSDVGARLAVEAAVEALRELLDSGELpeLEALVRQILN 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 220907520   90 NWIEQISDQicelANDEGLGLREYACTLLAAVVKPTDGVFFQIGDGAIV-IGTDEDYFPVFWPVTGEYVNSTYFITDKIS 168
Cdd:pfam13672  76 DILALVRQE----AAAQGLEPRDYATTLLLAVITPGGIVFFQIGDGAIVvRDRDGELQLLSEPDSGEYANETTFLTSPDA 151
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 220907520  169 LKELQFKSINNQLIEDIALMSDGLQglaLQFATKTAHSPFFKPMFARLAEESnpglsevLNASLKNFLD 237
Cdd:pfam13672 152 LEEFRIRRLTLEPGDALALMTDGLS---DSLVTEEPFFPFFAPLLETLEEEG-------ASEQLAEFLE 210
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
19-148 1.27e-04

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 41.16  E-value: 1.27e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 220907520  19 NNLPCQDRTVSKTivDGSGQEIFLAAVADGAGSAYRSEYGAEIATKLILSKIEDYFrqgevlaNLSREIVGNWIE----Q 94
Cdd:cd00143   11 DRKTNEDAVVIKP--NLNNEDGGLFGVFDGHGGHAAGEFASKLLVEELLEELEETL-------TLSEEDIEEALRkaflR 81
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 220907520  95 ISDQICELANDEGLGLREyACTLLAAVVKPTDGVFFQIGDGAIVIGTDEDYFPV 148
Cdd:cd00143   82 ADEEILEEAQDEPDDARS-GTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQL 134
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
19-144 4.24e-03

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 36.58  E-value: 4.24e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 220907520    19 NNLPCQDRTVsktIVDGSGQEIFLAAVADGAGSAYRSEYGAeiatKLILSKIEDYFRQGEVLANLSREIVGNWIEQISDQ 98
Cdd:smart00332  19 VRKPMEDAHV---ITPDLSDSGGFFGVFDGHGGSEAAKFLS----KNLPEILAEELIKEKDELEDVEEALRKAFLSTDEE 91
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*.
gi 220907520    99 ICElANDEGLGlreyaCTLLAAVVKPTDGVFFQIGDGAIVIGTDED 144
Cdd:smart00332  92 ILE-ELEALSG-----STAVVALISGNKLYVANVGDSRAVLCRNGK 131
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH