NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|218437596|ref|YP_002375925|]
View 

PAS/PAC sensor-containing diguanylate cyclase/phosphodiesterase [Cyanothece sp. PCC 7424]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
EAL cd01948
EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL ...
1221-1460 5.91e-111

EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.


:

Pssm-ID: 238923  Cd Length: 240  Bit Score: 351.46  E-value: 5.91e-111
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1221 TNLRLALEREELIVHYQPIVSLTTGKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGEWVLLESCRQMKAWQKe 1300
Cdd:cd01948     1 ADLRRALERGEFELYYQPIVDLRTGRIVGYEALLRWRHPEGGLISPAEFIPLAEETGLIVELGRWVLEEACRQLARWQA- 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1301 fsGLDKIRVSVNLSGKQLEYPHLINCLESILKQTGLEGKNLKLEITESMLMNNKEVVSDLLLQIKGKNIQISIDDFGTGY 1380
Cdd:cd01948    80 --GGPDLRLSVNLSARQLRDPDFLDRLLELLAETGLPPRRLVLEITESALIDDLEEALATLRRLRALGVRIALDDFGTGY 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1381 SSLSYLHYLPVDTLKIDRSFVNRMTQLGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQLGCESGQGYFFSKPLD 1460
Cdd:cd01948   158 SSLSYLKRLPVDYLKIDRSFVRDIETDPEDRAIVRAIIALAHSLGLKVVAEGVETEEQLELLRELGCDYVQGYLFSRPLP 237
GGDEF cd01949
Diguanylate-cyclase (DGC) or GGDEF domain; Diguanylate-cyclase (DGC) or GGDEF domain: ...
1045-1202 1.14e-59

Diguanylate-cyclase (DGC) or GGDEF domain; Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.


:

Pssm-ID: 143635  Cd Length: 158  Bit Score: 203.56  E-value: 1.14e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1045 HDQLTGLPNRILLLDRIEQAIKRTQQEEKYlFALLFIDLDRFKVVNDSLGHWVGDQLLGAIADKLKACVRPMDTVARFGG 1124
Cdd:cd01949     2 TDPLTGLPNRRAFEERLERLLARARRSGRP-LALLLIDIDHFKQINDTYGHAAGDEVLKEVAERLRSSLRESDLVARLGG 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 218437596 1125 DEFVILLENlTSRTEATKMAQQITDELRSSFCLQGQDFFISVSIGITFPSSYEESASELLRNADIAMYRAKEKGRARY 1202
Cdd:cd01949    81 DEFAILLPG-TDLEEAEALAERLREAIEEPFFIDGQEIRVTASIGIATYPEDGEDAEELLRRADEALYRAKRSGRNRV 157
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
142-242 8.60e-10

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


:

Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 58.03  E-value: 8.60e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  142 ELICRFRPDGTLTFVNEAYYRYFEKTPEYLLEKIFLPLIPFPDQQQVLDNLKSLNQQKRVITHEHRVIISSGEMRWHQWT 221
Cdd:cd00130     3 DGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEDREELRERLENLLSGGEPVTLEVRLRRKDGSVIWVLVS 82
                          90       100
                  ....*....|....*....|.
gi 218437596  222 NRAIVDRQGKIIEFQAVGRDI 242
Cdd:cd00130    83 LTPIRDEGGEVIGLLGVVRDI 103
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
423-528 1.73e-08

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


:

Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 54.18  E-value: 1.73e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  423 SPLGVIEWDNDYRVKRWSSQAEKIFGWKEEEVVGKGWqeWQFVYEEDLDLIVAKVSEIIKKETSRHFVTnRNYTKTGEII 502
Cdd:cd00130     1 LPDGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSL--LDLIHPEDREELRERLENLLSGGEPVTLEV-RLRRKDGSVI 77
                          90       100
                  ....*....|....*....|....*.
gi 218437596  503 DCKWYNSVQYDQSGEILSILSLVLDV 528
Cdd:cd00130    78 WVLVSLTPIRDEGGEVIGLLGVVRDI 103
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
802-899 1.56e-07

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


:

Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 51.09  E-value: 1.56e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  802 PNPLWVYDVKTLaFLEVNQAAIEHYGYSREEFLGMTLRDIRPSEDV-KILETYIANINPSFNRSGYWQHRKSNGEIIDVE 880
Cdd:cd00130     2 PDGVIVLDLDGR-ILYANPAAEQLLGYSPEELIGKSLLDLIHPEDReELRERLENLLSGGEPVTLEVRLRRKDGSVIWVL 80
                          90
                  ....*....|....*....
gi 218437596  881 ITSHGIEFAGRQARLVLVN 899
Cdd:cd00130    81 VSLTPIRDEGGEVIGLLGV 99
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
925-1029 5.80e-07

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


:

Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 49.55  E-value: 5.80e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  925 APLPILIHAEDGEIIQVNHAWTELTGYTHEDIPTIADWTEKAYGERKEIVRSVIDELykIDGKVEEGEFTITIKTGETRI 1004
Cdd:cd00130     1 LPDGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEDREELRERLENLL--SGGEPVTLEVRLRRKDGSVIW 78
                          90       100
                  ....*....|....*....|....*
gi 218437596 1005 WNFSSAPLGRLADNRRLIMSMALDI 1029
Cdd:cd00130    79 VLVSLTPIRDEGGEVIGLLGVVRDI 103
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
312-399 4.58e-05

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


:

Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 43.39  E-value: 4.58e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  312 LYCSSYVKSILGYSTDE-IDLPWLwiNSIHPEDLPKVKEMIQEFVQ-GKNFEIEYRVKDAQGQWHWIL-DRSIGRQAADQ 388
Cdd:cd00130    15 LYANPAAEQLLGYSPEElIGKSLL--DLIHPEDREELRERLENLLSgGEPVTLEVRLRRKDGSVIWVLvSLTPIRDEGGE 92
                          90
                  ....*....|.
gi 218437596  389 EMMIEGVAIDI 399
Cdd:cd00130    93 VIGLLGVVRDI 103
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
682-777 6.35e-05

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


:

Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 43.01  E-value: 6.35e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  682 IPVMLAYIDPNYNFLWVNEEFERILGWSLEEIKNLNILAQLYPD--PDERQYVMNYIQSAEEKWEDFKTRLRNGTTIDTS 759
Cdd:cd00130     1 LPDGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEdrEELRERLENLLSGGEPVTLEVRLRRKDGSVIWVL 80
                          90       100
                  ....*....|....*....|...
gi 218437596  760 WANVKLSNGA-----IIGIGQDI 777
Cdd:cd00130    81 VSLTPIRDEGgevigLLGVVRDI 103
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
552-658 8.72e-05

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


:

Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 42.62  E-value: 8.72e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  552 SGDSIWEWNLQTGEIYCDQSWWQKLGYEPD--HETMSYEWwrsqVAPEFLPIHEASLQDYLAGKTEYlTLEYKIQSSSGD 629
Cdd:cd00130     1 LPDGVIVLDLDGRILYANPAAEQLLGYSPEelIGKSLLDL----IHPEDREELRERLENLLSGGEPV-TLEVRLRRKDGS 75
                          90       100
                  ....*....|....*....|....*....
gi 218437596  630 WVWMSARGKSVAnDEEGNPLKIVGTHRDI 658
Cdd:cd00130    76 VIWVLVSLTPIR-DEGGEVIGLLGVVRDI 103
ApoLp-III_like super family cl19113
Apolipophorin-III and similar insect proteins; Exchangeable apolipoproteins play vital roles ...
227-298 1.07e-03

Apolipophorin-III and similar insect proteins; Exchangeable apolipoproteins play vital roles in the transport of lipids and lipoprotein metabolism. Apolipophorin III (apoLp-III) assists in the loading of diacylglycerol, generated from triacylglycerol stores in the fat body through the action of adipokinetic hormone, into lipophorin, the hemolymph lipoprotein. ApoLp-III increases the lipid carrying capacity of lipophorin by covering the expanding hydrophobic surface resulting from diacylglycerol uptake. It plays a critical role in the transport of lipids during insect flight, and may also play a role in defense mechanisms and innate immunity.


The actual alignment was detected with superfamily member pfam06810:

Pssm-ID: 267466  Cd Length: 156  Bit Score: 40.02  E-value: 1.07e-03
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 218437596   227 DRQGKIIEFQAVGRDITELKQietalrELnEELEQRVEQRTLQLEAQIQERQ---AVEKALMESEAKYERLVERL 298
Cdd:pfam06810   38 NRDKQIEDLKKKVKDNEELQK------KI-EKLKQQNKTAKEEYEAKLADTKlnnAIELALKKAKARNAKAVKAL 105
PRK11359 PRK11359
cyclic-di-GMP phosphodiesterase; Provisional
689-1469 7.96e-100

cyclic-di-GMP phosphodiesterase; Provisional


:

Pssm-ID: 183097 [Multi-domain]  Cd Length: 799  Bit Score: 339.44  E-value: 7.96e-100
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  689 IDPNYNFLWVNEEFERILGWSLEEIKNLNIlAQLYPdPDERQYVMNYIQS--------AEEKWEDFKTRLRNGTTIDTSW 760
Cdd:PRK11359   28 INENDEVLFFNPAAEKLWGYKREEVIGNNI-DMLIP-RDLRPAHPEYIRHnreggkarVEGMSRELQLEKKDGSKIWTRF 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  761 ANVKLS-NGAI--IGIGQDITVrkhiEEALRESEqkyRLLFYANPN---PLWVYDVKTlAFLEVNQAAIEHYGYSREEFL 834
Cdd:PRK11359  106 ALSKVSaEGKVyyLALVRDASV----EMAQKEQT---RQLIIAVDHldrPVIVLDPER-RIVQCNRAFTEMFGYCISEAS 177
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  835 GMTLRDIRPSEDvkiletyianiNPSFNR----SGYWQHRKSNGEIIDVeiTSHGIEFAGR------------QARLVLV 898
Cdd:PRK11359  178 GMQPDTLLNIPE-----------FPADNRirlqQLLWKTARDQDEFLLL--TRTGEKIWIKasispvydvlahLQNLVMT 244
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  899 -NDITEQLKAQQklqesenrFRRAVIDAPLPILIHAEDGEIIQVNhaWTELTGYTHEDIPTIAD-----WT----EKAYG 968
Cdd:PRK11359  245 fSDITEERQIRQ--------LEGNILAAMCSSPPFHEMGEIICRN--IESVLNESHVSLFALRNgmpihWAssshGAEYQ 314
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  969 ERKEIVRSVidelYKIDGKVEeGEFTI-TIKTGETriwnfsSAPLGRLADNRRLIMSMALditERKQAEEQLRHAAVHDQ 1047
Cdd:PRK11359  315 NAQSWSATI----RQRDGAPA-GTLQIkTSSGAET------SAFIERVADISQHLAALAL---EQEKSRQHIEQLIQFDP 380
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1048 LTGLPNRILLLDRIEQAIKRTQQeekylFALLFIDLDRFKVVNDSLGHWVGDQLLGAIADKLKACVRPMDTVARFGGDEF 1127
Cdd:PRK11359  381 LTGLPNRNNLHNYLDDLVDKAVS-----PVVYLIGVDHFQDVIDSLGYAWADQALLEVVNRFREKLKPDQYLCRIEGTQF 455
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1128 VIL-LENLTSRteATKMAQQITDELRSSFCLQGQDFFISVSIGItfpsSYEESASE--LLRNADIAMYRAKEKGRARYTI 1204
Cdd:PRK11359  456 VLVsLENDVSN--ITQIADELRNVVSKPIMIDDKPFPLTLSIGI----SYDVGKNRdyLLSTAHNAMDYIRKNGGNGWQF 529
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1205 FDSKMHIQATRLLELETNLRLALEREELIVHYQPIVSLTTGKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGE 1284
Cdd:PRK11359  530 FSPAMNEMVKERLVLGAALKEAISNNQLKLVYQPQIFAETGELYGIEALARWHDPLHGHVPPSRFIPLAEEIGEIENIGR 609
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1285 WVLLESCRQMKAWQKEfsGLDKIRVSVNLSGKQLEYPHLINCLESILKQTGLEGKNLKLEITESMLMNNKEVVSDLLLQI 1364
Cdd:PRK11359  610 WVIAEACRQLAEWRSQ--NIHIPALSVNLSALHFRSNQLPNQVSDAMQAWGIDGHQLTVEITESMMMEHDTEIFKRIQIL 687
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1365 KGKNIQISIDDFGTGYSSLSYLHYLPVDTLKIDRSFVNRMTQLGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQ 1444
Cdd:PRK11359  688 RDMGVGLSVDDFGTGFSGLSRLVSLPVTEIKIDKSFVDRCLTEKRILALLEAITSIGQSLNLTVVAEGVETKEQFEMLRK 767
                         810       820
                  ....*....|....*....|....*
gi 218437596 1445 LGCESGQGYFFSKPLDSQKVTSWFE 1469
Cdd:PRK11359  768 IHCRVIQGYFFSRPLPAEEIPGWMS 792
AtoS COG2202
FOG: PAS/PAC domain [Signal transduction mechanisms]
312-535 1.64e-17

FOG: PAS/PAC domain [Signal transduction mechanisms]


:

Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 83.36  E-value: 1.64e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  312 LYCSSYVKSILGYSTDEIdlpWLWINSIHPEDLPKVKEMIQEFVQGKN-FEIEYRVKDAQGQWHWILDRSIGRQAADQEM 390
Cdd:COG2202    12 IYANEAAEELLGYSAEEL---LGLLLALHPEDRDRLRELLRRLLAGEElLSEELRLVRKDGEERWVELSAAPLRDGEGRV 88
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  391 MIEGVAIDITETKKTQMALQQAHQCLTFHVDNSPLGVIEWDNDYRVKRWSSQAEKIFGWKEEEVVGKGWQEWQFVYEEDL 470
Cdd:COG2202    89 LGLLGLRDITERKRAEEALRESEERLRALLEASPDGIWVLDEDGRILYANPAAEELLGYSPEEELGRGLSDLIHPEDEER 168
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 218437596  471 DLIVAKVSEIIKKETSRHFVTnRNYTKTGEIIDCKWYNSVQYDQSGEILSILSLVLDVSEQKRAE 535
Cdd:COG2202   169 RELELARALAEGRGGPLEIEY-RVRRKDGERVRWILSRISPVRDDGEIVGVVGIARDITERKQAE 232
PAS_3 pfam08447
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
566-655 2.56e-15

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


:

Pssm-ID: 254805 [Multi-domain]  Cd Length: 90  Bit Score: 73.95  E-value: 2.56e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   566 IYCDQSWWQKLGYEPDHETMSYEWWRSQVAPEFLPIHEASLQDYLAGKTEYLTLEYKIQSSSGDWVWMSARGKSVAnDEE 645
Cdd:pfam08447    2 IYWSPRFEEILGYTPEELKSSYEGWLDLVHPEDRERVRRALQELLLKKGEPYSGEYRIRRKDGSYRWVEARGRPIR-DEN 80
                           90
                   ....*....|
gi 218437596   646 GNPLKIVGTH 655
Cdd:pfam08447   81 GKPVRVIGVA 90
AtoS COG2202
FOG: PAS/PAC domain [Signal transduction mechanisms]
143-406 5.82e-12

FOG: PAS/PAC domain [Signal transduction mechanisms]


:

Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 66.03  E-value: 5.82e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  143 LICRFRPDGTLTFVNEAYYRYFEKTPEYLLekIFLPLIPFPDQQQVLDNLKSLNQQKRVITHEHRVIISSGEMRWHQWTN 222
Cdd:COG2202     1 LILVLDRDGRIIYANEAAEELLGYSAEELL--GLLLALHPEDRDRLRELLRRLLAGEELLSEELRLVRKDGEERWVELSA 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  223 RAIVDRQGKIIEFQAvgrditelkqietalrelneeleqrveqrtlqlEAQIQERQAVEKALMESEAKYERLVERLPAVI 302
Cdd:COG2202    79 APLRDGEGRVLGLLG---------------------------------LRDITERKRAEEALRESEERLRALLEASPDGI 125
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  303 YQFSPTKGKLYCSSYVKSILGYSTDEIDLPWLWINSIHPEDLPKVKEMIQEFV--QGKNFEIEYRVKDAQGQ-WHWILDR 379
Cdd:COG2202   126 WVLDEDGRILYANPAAEELLGYSPEEELGRGLSDLIHPEDEERRELELARALAegRGGPLEIEYRVRRKDGErVRWILSR 205
                         250       260
                  ....*....|....*....|....*..
gi 218437596  380 SIGRQAADQEMMIEGVAIDITETKKTQ 406
Cdd:COG2202   206 ISPVRDDGEIVGVVGIARDITERKQAE 232
 
Name Accession Description Interval E-value
EAL cd01948
EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL ...
1221-1460 5.91e-111

EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.


Pssm-ID: 238923  Cd Length: 240  Bit Score: 351.46  E-value: 5.91e-111
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1221 TNLRLALEREELIVHYQPIVSLTTGKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGEWVLLESCRQMKAWQKe 1300
Cdd:cd01948     1 ADLRRALERGEFELYYQPIVDLRTGRIVGYEALLRWRHPEGGLISPAEFIPLAEETGLIVELGRWVLEEACRQLARWQA- 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1301 fsGLDKIRVSVNLSGKQLEYPHLINCLESILKQTGLEGKNLKLEITESMLMNNKEVVSDLLLQIKGKNIQISIDDFGTGY 1380
Cdd:cd01948    80 --GGPDLRLSVNLSARQLRDPDFLDRLLELLAETGLPPRRLVLEITESALIDDLEEALATLRRLRALGVRIALDDFGTGY 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1381 SSLSYLHYLPVDTLKIDRSFVNRMTQLGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQLGCESGQGYFFSKPLD 1460
Cdd:cd01948   158 SSLSYLKRLPVDYLKIDRSFVRDIETDPEDRAIVRAIIALAHSLGLKVVAEGVETEEQLELLRELGCDYVQGYLFSRPLP 237
GGDEF cd01949
Diguanylate-cyclase (DGC) or GGDEF domain; Diguanylate-cyclase (DGC) or GGDEF domain: ...
1045-1202 1.14e-59

Diguanylate-cyclase (DGC) or GGDEF domain; Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.


Pssm-ID: 143635  Cd Length: 158  Bit Score: 203.56  E-value: 1.14e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1045 HDQLTGLPNRILLLDRIEQAIKRTQQEEKYlFALLFIDLDRFKVVNDSLGHWVGDQLLGAIADKLKACVRPMDTVARFGG 1124
Cdd:cd01949     2 TDPLTGLPNRRAFEERLERLLARARRSGRP-LALLLIDIDHFKQINDTYGHAAGDEVLKEVAERLRSSLRESDLVARLGG 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 218437596 1125 DEFVILLENlTSRTEATKMAQQITDELRSSFCLQGQDFFISVSIGITFPSSYEESASELLRNADIAMYRAKEKGRARY 1202
Cdd:cd01949    81 DEFAILLPG-TDLEEAEALAERLREAIEEPFFIDGQEIRVTASIGIATYPEDGEDAEELLRRADEALYRAKRSGRNRV 157
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
142-242 8.60e-10

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 58.03  E-value: 8.60e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  142 ELICRFRPDGTLTFVNEAYYRYFEKTPEYLLEKIFLPLIPFPDQQQVLDNLKSLNQQKRVITHEHRVIISSGEMRWHQWT 221
Cdd:cd00130     3 DGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEDREELRERLENLLSGGEPVTLEVRLRRKDGSVIWVLVS 82
                          90       100
                  ....*....|....*....|.
gi 218437596  222 NRAIVDRQGKIIEFQAVGRDI 242
Cdd:cd00130    83 LTPIRDEGGEVIGLLGVVRDI 103
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
423-528 1.73e-08

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 54.18  E-value: 1.73e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  423 SPLGVIEWDNDYRVKRWSSQAEKIFGWKEEEVVGKGWqeWQFVYEEDLDLIVAKVSEIIKKETSRHFVTnRNYTKTGEII 502
Cdd:cd00130     1 LPDGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSL--LDLIHPEDREELRERLENLLSGGEPVTLEV-RLRRKDGSVI 77
                          90       100
                  ....*....|....*....|....*.
gi 218437596  503 DCKWYNSVQYDQSGEILSILSLVLDV 528
Cdd:cd00130    78 WVLVSLTPIRDEGGEVIGLLGVVRDI 103
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
802-899 1.56e-07

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 51.09  E-value: 1.56e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  802 PNPLWVYDVKTLaFLEVNQAAIEHYGYSREEFLGMTLRDIRPSEDV-KILETYIANINPSFNRSGYWQHRKSNGEIIDVE 880
Cdd:cd00130     2 PDGVIVLDLDGR-ILYANPAAEQLLGYSPEELIGKSLLDLIHPEDReELRERLENLLSGGEPVTLEVRLRRKDGSVIWVL 80
                          90
                  ....*....|....*....
gi 218437596  881 ITSHGIEFAGRQARLVLVN 899
Cdd:cd00130    81 VSLTPIRDEGGEVIGLLGV 99
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
925-1029 5.80e-07

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 49.55  E-value: 5.80e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  925 APLPILIHAEDGEIIQVNHAWTELTGYTHEDIPTIADWTEKAYGERKEIVRSVIDELykIDGKVEEGEFTITIKTGETRI 1004
Cdd:cd00130     1 LPDGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEDREELRERLENLL--SGGEPVTLEVRLRRKDGSVIW 78
                          90       100
                  ....*....|....*....|....*
gi 218437596 1005 WNFSSAPLGRLADNRRLIMSMALDI 1029
Cdd:cd00130    79 VLVSLTPIRDEGGEVIGLLGVVRDI 103
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
312-399 4.58e-05

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 43.39  E-value: 4.58e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  312 LYCSSYVKSILGYSTDE-IDLPWLwiNSIHPEDLPKVKEMIQEFVQ-GKNFEIEYRVKDAQGQWHWIL-DRSIGRQAADQ 388
Cdd:cd00130    15 LYANPAAEQLLGYSPEElIGKSLL--DLIHPEDREELRERLENLLSgGEPVTLEVRLRRKDGSVIWVLvSLTPIRDEGGE 92
                          90
                  ....*....|.
gi 218437596  389 EMMIEGVAIDI 399
Cdd:cd00130    93 VIGLLGVVRDI 103
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
682-777 6.35e-05

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 43.01  E-value: 6.35e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  682 IPVMLAYIDPNYNFLWVNEEFERILGWSLEEIKNLNILAQLYPD--PDERQYVMNYIQSAEEKWEDFKTRLRNGTTIDTS 759
Cdd:cd00130     1 LPDGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEdrEELRERLENLLSGGEPVTLEVRLRRKDGSVIWVL 80
                          90       100
                  ....*....|....*....|...
gi 218437596  760 WANVKLSNGA-----IIGIGQDI 777
Cdd:cd00130    81 VSLTPIRDEGgevigLLGVVRDI 103
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
552-658 8.72e-05

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 42.62  E-value: 8.72e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  552 SGDSIWEWNLQTGEIYCDQSWWQKLGYEPD--HETMSYEWwrsqVAPEFLPIHEASLQDYLAGKTEYlTLEYKIQSSSGD 629
Cdd:cd00130     1 LPDGVIVLDLDGRILYANPAAEQLLGYSPEelIGKSLLDL----IHPEDREELRERLENLLSGGEPV-TLEVRLRRKDGS 75
                          90       100
                  ....*....|....*....|....*....
gi 218437596  630 WVWMSARGKSVAnDEEGNPLKIVGTHRDI 658
Cdd:cd00130    76 VIWVLVSLTPIR-DEGGEVIGLLGVVRDI 103
Rtn COG2200
c-di-GMP phosphodiesterase class I (EAL domain) [Signal transduction mechanisms]
1217-1470 2.09e-102

c-di-GMP phosphodiesterase class I (EAL domain) [Signal transduction mechanisms]


Pssm-ID: 225110  Cd Length: 256  Bit Score: 327.71  E-value: 2.09e-102
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1217 LELETNLRLALEREELIVHYQPIVSLTTGKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGEWVLLESCRQMKA 1296
Cdd:COG2200     2 LQLERDLRQALENGEFSLYYQPIVDLATGRIVGYEALLRWRHPDGGLISPGEFIPLAEETGLIVELGRWVLEEACRQLRT 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1297 WQKEFSgldkIRVSVNLSGKQLEYPHLINCLESILKQTGLEGKNLKLEITESMLMNNKEVVSDLLLQIKGKNIQISIDDF 1376
Cdd:COG2200    82 WPRAGP----LRLAVNLSPVQLRSPGLVDLLLRLLARLGLPPHRLVLEITESALIDDLDTALALLRQLRELGVRIALDDF 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1377 GTGYSSLSYLHYLPVDTLKIDRSFVNRMTQLGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQLGCESGQGYFFS 1456
Cdd:COG2200   158 GTGYSSLSYLKRLPPDILKIDRSFVRDLETDARDQAIVRAIVALAHKLGLTVVAEGVETEEQLDLLRELGCDYLQGYLFS 237
                         250
                  ....*....|....
gi 218437596 1457 KPLDSQKVTSWFEK 1470
Cdd:COG2200   238 RPLPADALDALLSS 251
EAL smart00052
Putative diguanylate phosphodiesterase; Putative diguanylate phosphodiesterase, present in a ...
1220-1459 3.23e-99

Putative diguanylate phosphodiesterase; Putative diguanylate phosphodiesterase, present in a variety of bacteria.


Pssm-ID: 214491  Cd Length: 242  Bit Score: 318.39  E-value: 3.23e-99
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   1220 ETNLRLALEREELIVHYQPIVSLTTGKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGEWVLLESCRQMKAWQK 1299
Cdd:smart00052    1 ERELRQALENGQFLLYYQPIVSLRTGRLVGVEALIRWQHPEGGIISPDEFIPLAEETGLIVPLGRWVLEQACQQLAEWQA 80
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   1300 efSGLDKIRVSVNLSGKQLEYPHLINCLESILKQTGLEGKNLKLEITESMLMNNKEVVSDLLLQIKGKNIQISIDDFGTG 1379
Cdd:smart00052   81 --QGPPPLLISINLSARQLISPDLVPRVLELLEETGLPPQRLELEITESVLLDDDESAVATLQRLRELGVRIALDDFGTG 158
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   1380 YSSLSYLHYLPVDTLKIDRSFVNRMTQLGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQLGCESGQGYFFSKPL 1459
Cdd:smart00052  159 YSSLSYLKRLPVDLLKIDKSFVRDLQTDPEDEAIVQSIIELAQKLGLQVVAEGVETPEQLDLLRSLGCDYGQGYLFSRPL 238
EAL pfam00563
EAL domain; This domain is found in diverse bacterial signaling proteins. It is called EAL ...
1222-1458 3.98e-69

EAL domain; This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues. The EAL domain is a good candidate for a diguanylate phosphodiesterase function. The domain contains many conserved acidic residues that could participate in metal binding and might form the phosphodiesterase active site.


Pssm-ID: 249961  Cd Length: 231  Bit Score: 233.43  E-value: 3.98e-69
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  1222 NLRLALEREELIVHYQPIVSLTTGKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGEWVLLESCRQMKAWQKEf 1301
Cdd:pfam00563    3 ALREALENGEFSLYFQPIVDLRTGKVLGYEALLRWQHPDGGLISPDEFLPLAERLGLIAELDRWVLEKALAQLAEWLNP- 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  1302 sgldKIRVSVNLSGKQLEYPHLINCLESiLKQTGLEGKNLKLEITESmLMNNKEVVSDLLLQIKGKNIQISIDDFGTGYS 1381
Cdd:pfam00563   82 ----DLPLSVNLSPASLLDPSFLEALLA-LKQGGLPPSRLVLEITES-ALDEDLRLLEALARLRSLGFRLALDDFGTGYS 155
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 218437596  1382 SLSYLHYLPVDTLKIDRSFVNRMTQlGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQLGCESGQGYFFSKP 1458
Cdd:pfam00563  156 SLSLLSRLPPDYIKIDRSFIKDLSD-PESRALLRALIALARSLGIKVVAEGVETEEQLELLKELGIDYVQGYLFSKP 231
COG2199 COG2199
c-di-GMP synthetase (diguanylate cyclase, GGDEF domain) [Signal transduction mechanisms]
1025-1205 7.65e-59

c-di-GMP synthetase (diguanylate cyclase, GGDEF domain) [Signal transduction mechanisms]


Pssm-ID: 225109  Cd Length: 181  Bit Score: 202.29  E-value: 7.65e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1025 MALDITERKQAEEQLRHAAVHDQLTGLPNRILLLDRIEQAIKRTQQEEKYlFALLFIDLDRFKVVNDSLGHWVGDQLLGA 1104
Cdd:COG2199     2 LLRLLTRLRKAEERLERLALHDPLTGLPNRRAFEERLERALARARRHGEP-LALLLLDLDHFKQINDTYGHAAGDEVLRE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1105 IADKLKACVRPMDTVARFGGDEFVILLENlTSRTEATKMAQQITDELRSSFCLQGQDFFISVSIGIT-FPSSYEESASEL 1183
Cdd:COG2199    81 VARRLRSNLREGDLVARLGGDEFAVLLPG-TSLEEAARLAERIRAALEEPFFLGGEELRVTVSIGVAlYPEDGSDDAELL 159
                         170       180
                  ....*....|....*....|..
gi 218437596 1184 LRNADIAMYRAKEKGRARYTIF 1205
Cdd:COG2199   160 LRRADLALYRAKRAGRNRVVVF 181
GGDEF pfam00990
GGDEF domain; This domain is found linked to a wide range of non-homologous domains in a ...
1043-1199 7.50e-54

GGDEF domain; This domain is found linked to a wide range of non-homologous domains in a variety of bacteria. It has been shown to be homologous to the adenylyl cyclase catalytic domain and has diguanylate cyclase activity. This observation correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate.


Pssm-ID: 250276  Cd Length: 159  Bit Score: 187.06  E-value: 7.50e-54
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  1043 AVHDQLTGLPNRILLLDRIEQAIKRtQQEEKYLFALLFIDLDRFKVVNDSLGHWVGDQLLGAIADKLKACVRPMDTVARF 1122
Cdd:pfam00990    1 AAHDPLTGLPNRRYFEEELEQELQR-ARRQQSPLALLLIDLDNFKRINDTYGHAVGDEVLQEVAQRLSSSLRRSDLVARL 79
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 218437596  1123 GGDEFVILLENLTSRT--EATKMAQQITDELRSSFCLQGQDFFISVSIGITFPSSYEESASELLRNADIAMYRAKEKGR 1199
Cdd:pfam00990   80 GGEEFAILLPDTSLEGaqELAERIRRLLAALAIPHTLSGLPLYVTISIGIAAYPNDGEDPEDLLKRADQALYQAKQQGR 158
GGDEF smart00267
diguanylate cyclase; Diguanylate cyclase, present in a variety of bacteria.
1041-1205 6.18e-52

diguanylate cyclase; Diguanylate cyclase, present in a variety of bacteria.


Pssm-ID: 128563  Cd Length: 163  Bit Score: 181.68  E-value: 6.18e-52
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   1041 HAAVHDQLTGLPNRILLLDRIEQAIKRtQQEEKYLFALLFIDLDRFKVVNDSLGHWVGDQLLGAIADKLKACVRPMDTVA 1120
Cdd:smart00267    1 RLAFRDPLTGLPNRRYFEEELEQELQR-AQRQGSPFALLLIDLDNFKDINDTYGHAVGDELLQEVAQRLSSCLRPGDLLA 79
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   1121 RFGGDEFVILLENlTSRTEATKMAQQITDELRSSFCLQGQDFFISVSIGITFPSSYEESASELLRNADIAMYRAKEKGRA 1200
Cdd:smart00267   80 RLGGDEFALLLPE-TSLEEAIALAERILQQLREPIIIHGIPLYLTISIGVAAYPNPGEDAEDLLKRADTALYQAKKAGRN 158

                    ....*
gi 218437596   1201 RYTIF 1205
Cdd:smart00267  159 QVAVY 163
GGDEF TIGR00254
diguanylate cyclase (GGDEF) domain; The GGDEF domain is named for the motif GG[DE]EF shared by ...
1043-1206 1.75e-39

diguanylate cyclase (GGDEF) domain; The GGDEF domain is named for the motif GG[DE]EF shared by many proteins carrying the domain. There is evidence that the domain has diguanylate cyclase activity. Several proteins carrying this domain also carry domains with functions relating to environmental sensing. These include PleD, a response regulator protein involved in the swarmer-to-stalked cell transition in Caulobacter crescentus, and FixL, a heme-containing oxygen sensor protein [Regulatory functions, Small molecule interactions, Signal transduction, Other].


Pssm-ID: 232895  Cd Length: 165  Bit Score: 146.33  E-value: 1.75e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  1043 AVHDQLTGLPNRILLLDRIEQAIKRTQQEEkYLFALLFIDLDRFKVVNDSLGHWVGDQLLGAIADKLKACVRPMDTVARF 1122
Cdd:TIGR00254    2 AVRDPLTGLYNRRYLEEMLDSELKRARRFQ-RSFSVLMIDIDNFKKINDTLGHDVGDEVLREVARILQSSVRGSDVVGRY 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  1123 GGDEFVILLENlTSRTEATKMAQQITDELRSSFCL--QGQDFFISVSIGItfpSSYEESAS---ELLRNADIAMYRAKEK 1197
Cdd:TIGR00254   81 GGEEFVVILPG-TPLEDALSKAERLRDAINSKPIEvaGSETLTVTVSIGV---ACYPGHGLtleELLKRADEALYQAKKA 156

                   ....*....
gi 218437596  1198 GRARYTIFD 1206
Cdd:TIGR00254  157 GRNRVVVAD 165
PRK11596 PRK11596
cyclic-di-GMP phosphodiesterase; Provisional
1235-1459 1.29e-13

cyclic-di-GMP phosphodiesterase; Provisional


Pssm-ID: 183222  Cd Length: 255  Bit Score: 71.57  E-value: 1.29e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1235 HYQPIVSlTTGKLLGFEALVRWEHPKkgliSPGEFI-PIAEETGLIIPLGEWVLLESCRQMKAWQKEFsGLDKIRVSVNL 1313
Cdd:PRK11596   33 TFQPIYR-TSGRLMAIELLTAVTHPS----NPSQRLsPERYFAEITVSHRLDVVKEQLDLLAQWADFF-VRHGLLASVNI 106
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1314 SGKQLeyphlinclesILKQTGLEGKNL-------KLEITESMLMNNKEVVSdlllQIKGKNiQISIDDFGTG---YSSL 1383
Cdd:PRK11596  107 DGPTL-----------IALRQQPAILRLierlpwlRFELVEHIRLPKDSPFA----SMCEFG-PLWLDDFGTGmanFSAL 170
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 218437596 1384 SYLHYlpvDTLKIDRSFVNRMTQLGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQLGCESGQGYFFSKPL 1459
Cdd:PRK11596  171 SEVRY---DYIKVARELFIMLRQSEEGRNLFSQLLHLMNRYCRGVIVEGVETPEEWRDVQRSPAFAAQGYFLSRPA 243
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
673-741 5.19e-07

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 48.93  E-value: 5.19e-07
                            10        20        30        40        50        60
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 218437596    673 ELLQTIVDYIPVMLAYIDPNYNFLWVNEEFERILGWSLEEIKNLNILaQLYPdPDERQYVMNYIQSAEE 741
Cdd:smart00091    1 ERLRAILESLPDGIFVLDLDGRILYANPAAEELLGYSPEELIGKSLL-ELIH-PEDRERVQEALQRLLS 67
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
416-482 1.73e-06

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 47.39  E-value: 1.73e-06
                            10        20        30        40        50        60
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 218437596    416 LTFHVDNSPLGVIEWDNDYRVKRWSSQAEKIFGWKEEEVVGKGWqeWQFVYEEDLDLIVAKVSEIIK 482
Cdd:smart00091    3 LRAILESLPDGIFVLDLDGRILYANPAAEELLGYSPEELIGKSL--LELIHPEDRERVQEALQRLLS 67
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
792-856 9.34e-06

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 45.08  E-value: 9.34e-06
                            10        20        30        40        50        60
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 218437596    792 QKYRLLFYANPNPLWVYDVKTlAFLEVNQAAIEHYGYSREEFLGMTLRDIRPSEDVKILETYIAN 856
Cdd:smart00091    1 ERLRAILESLPDGIFVLDLDG-RILYANPAAEELLGYSPEELIGKSLLELIHPEDRERVQEALQR 64
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
131-195 3.76e-05

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 43.54  E-value: 3.76e-05
                            10        20        30        40        50        60
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 218437596    131 SRYRAIVEEQTELICRFRPDGTLTFVNEAYYRYFEKTPEYLLEKIFLPLIPFPDQQQVLDNLKSL 195
Cdd:smart00091    1 ERLRAILESLPDGIFVLDLDGRILYANPAAEELLGYSPEELIGKSLLELIHPEDRERVQEALQRL 65
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
917-956 2.48e-04

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 40.85  E-value: 2.48e-04
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|
gi 218437596    917 RFRRAVIDAPLPILIHAEDGEIIQVNHAWTELTGYTHEDI 956
Cdd:smart00091    2 RLRAILESLPDGIFVLDLDGRILYANPAAEELLGYSPEEL 41
Phage_GP20 pfam06810
Phage minor structural protein GP20; This family consists of several phage minor structural ...
227-298 1.07e-03

Phage minor structural protein GP20; This family consists of several phage minor structural protein GP20 sequences of around 180 residues in length. The function of this family is unknown.


Pssm-ID: 253923  Cd Length: 156  Bit Score: 40.02  E-value: 1.07e-03
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 218437596   227 DRQGKIIEFQAVGRDITELKQietalrELnEELEQRVEQRTLQLEAQIQERQ---AVEKALMESEAKYERLVERL 298
Cdd:pfam06810   38 NRDKQIEDLKKKVKDNEELQK------KI-EKLKQQNKTAKEEYEAKLADTKlnnAIELALKKAKARNAKAVKAL 105
PAS_8 pfam13188
PAS domain;
673-737 1.11e-03

PAS domain;


Pssm-ID: 257556  Cd Length: 66  Bit Score: 39.13  E-value: 1.11e-03
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 218437596   673 ELLQTIVDYIPVMLAYIDPNYNFLWVNEEFERILGW-SLEEIKNLNILAQLYPDPDERQYVMNYIQ 737
Cdd:pfam13188    1 ERLRALFENAPDGILVLDRGGRILYANPAALELLGYeELLGELLGELLDDLEALAEEALELLEELE 66
PAC smart00086
Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain); PAC motif ...
618-660 2.77e-03

Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain); PAC motif occurs C-terminal to a subset of all known PAS motifs. It is proposed to contribute to the PAS domain fold.


Pssm-ID: 197509  Cd Length: 43  Bit Score: 37.55  E-value: 2.77e-03
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|...
gi 218437596    618 TLEYKIQSSSGDWVWMSARGKSVaNDEEGNPLKIVGTHRDITE 660
Cdd:smart00086    1 TVEYRLRRKDGSYIWVLVSASPI-RDEDGEVEGILGVVRDITE 42
PRK11359 PRK11359
cyclic-di-GMP phosphodiesterase; Provisional
689-1469 7.96e-100

cyclic-di-GMP phosphodiesterase; Provisional


Pssm-ID: 183097 [Multi-domain]  Cd Length: 799  Bit Score: 339.44  E-value: 7.96e-100
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  689 IDPNYNFLWVNEEFERILGWSLEEIKNLNIlAQLYPdPDERQYVMNYIQS--------AEEKWEDFKTRLRNGTTIDTSW 760
Cdd:PRK11359   28 INENDEVLFFNPAAEKLWGYKREEVIGNNI-DMLIP-RDLRPAHPEYIRHnreggkarVEGMSRELQLEKKDGSKIWTRF 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  761 ANVKLS-NGAI--IGIGQDITVrkhiEEALRESEqkyRLLFYANPN---PLWVYDVKTlAFLEVNQAAIEHYGYSREEFL 834
Cdd:PRK11359  106 ALSKVSaEGKVyyLALVRDASV----EMAQKEQT---RQLIIAVDHldrPVIVLDPER-RIVQCNRAFTEMFGYCISEAS 177
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  835 GMTLRDIRPSEDvkiletyianiNPSFNR----SGYWQHRKSNGEIIDVeiTSHGIEFAGR------------QARLVLV 898
Cdd:PRK11359  178 GMQPDTLLNIPE-----------FPADNRirlqQLLWKTARDQDEFLLL--TRTGEKIWIKasispvydvlahLQNLVMT 244
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  899 -NDITEQLKAQQklqesenrFRRAVIDAPLPILIHAEDGEIIQVNhaWTELTGYTHEDIPTIAD-----WT----EKAYG 968
Cdd:PRK11359  245 fSDITEERQIRQ--------LEGNILAAMCSSPPFHEMGEIICRN--IESVLNESHVSLFALRNgmpihWAssshGAEYQ 314
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  969 ERKEIVRSVidelYKIDGKVEeGEFTI-TIKTGETriwnfsSAPLGRLADNRRLIMSMALditERKQAEEQLRHAAVHDQ 1047
Cdd:PRK11359  315 NAQSWSATI----RQRDGAPA-GTLQIkTSSGAET------SAFIERVADISQHLAALAL---EQEKSRQHIEQLIQFDP 380
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1048 LTGLPNRILLLDRIEQAIKRTQQeekylFALLFIDLDRFKVVNDSLGHWVGDQLLGAIADKLKACVRPMDTVARFGGDEF 1127
Cdd:PRK11359  381 LTGLPNRNNLHNYLDDLVDKAVS-----PVVYLIGVDHFQDVIDSLGYAWADQALLEVVNRFREKLKPDQYLCRIEGTQF 455
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1128 VIL-LENLTSRteATKMAQQITDELRSSFCLQGQDFFISVSIGItfpsSYEESASE--LLRNADIAMYRAKEKGRARYTI 1204
Cdd:PRK11359  456 VLVsLENDVSN--ITQIADELRNVVSKPIMIDDKPFPLTLSIGI----SYDVGKNRdyLLSTAHNAMDYIRKNGGNGWQF 529
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1205 FDSKMHIQATRLLELETNLRLALEREELIVHYQPIVSLTTGKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGE 1284
Cdd:PRK11359  530 FSPAMNEMVKERLVLGAALKEAISNNQLKLVYQPQIFAETGELYGIEALARWHDPLHGHVPPSRFIPLAEEIGEIENIGR 609
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1285 WVLLESCRQMKAWQKEfsGLDKIRVSVNLSGKQLEYPHLINCLESILKQTGLEGKNLKLEITESMLMNNKEVVSDLLLQI 1364
Cdd:PRK11359  610 WVIAEACRQLAEWRSQ--NIHIPALSVNLSALHFRSNQLPNQVSDAMQAWGIDGHQLTVEITESMMMEHDTEIFKRIQIL 687
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1365 KGKNIQISIDDFGTGYSSLSYLHYLPVDTLKIDRSFVNRMTQLGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQ 1444
Cdd:PRK11359  688 RDMGVGLSVDDFGTGFSGLSRLVSLPVTEIKIDKSFVDRCLTEKRILALLEAITSIGQSLNLTVVAEGVETKEQFEMLRK 767
                         810       820
                  ....*....|....*....|....*
gi 218437596 1445 LGCESGQGYFFSKPLDSQKVTSWFE 1469
Cdd:PRK11359  768 IHCRVIQGYFFSRPLPAEEIPGWMS 792
AtoS COG2202
FOG: PAS/PAC domain [Signal transduction mechanisms]
312-535 1.64e-17

FOG: PAS/PAC domain [Signal transduction mechanisms]


Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 83.36  E-value: 1.64e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  312 LYCSSYVKSILGYSTDEIdlpWLWINSIHPEDLPKVKEMIQEFVQGKN-FEIEYRVKDAQGQWHWILDRSIGRQAADQEM 390
Cdd:COG2202    12 IYANEAAEELLGYSAEEL---LGLLLALHPEDRDRLRELLRRLLAGEElLSEELRLVRKDGEERWVELSAAPLRDGEGRV 88
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  391 MIEGVAIDITETKKTQMALQQAHQCLTFHVDNSPLGVIEWDNDYRVKRWSSQAEKIFGWKEEEVVGKGWQEWQFVYEEDL 470
Cdd:COG2202    89 LGLLGLRDITERKRAEEALRESEERLRALLEASPDGIWVLDEDGRILYANPAAEELLGYSPEEELGRGLSDLIHPEDEER 168
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 218437596  471 DLIVAKVSEIIKKETSRHFVTnRNYTKTGEIIDCKWYNSVQYDQSGEILSILSLVLDVSEQKRAE 535
Cdd:COG2202   169 RELELARALAEGRGGPLEIEY-RVRRKDGERVRWILSRISPVRDDGEIVGVVGIARDITERKQAE 232
PAS_3 pfam08447
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
566-655 2.56e-15

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 254805 [Multi-domain]  Cd Length: 90  Bit Score: 73.95  E-value: 2.56e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   566 IYCDQSWWQKLGYEPDHETMSYEWWRSQVAPEFLPIHEASLQDYLAGKTEYLTLEYKIQSSSGDWVWMSARGKSVAnDEE 645
Cdd:pfam08447    2 IYWSPRFEEILGYTPEELKSSYEGWLDLVHPEDRERVRRALQELLLKKGEPYSGEYRIRRKDGSYRWVEARGRPIR-DEN 80
                           90
                   ....*....|
gi 218437596   646 GNPLKIVGTH 655
Cdd:pfam08447   81 GKPVRVIGVA 90
AtoS COG2202
FOG: PAS/PAC domain [Signal transduction mechanisms]
143-406 5.82e-12

FOG: PAS/PAC domain [Signal transduction mechanisms]


Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 66.03  E-value: 5.82e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  143 LICRFRPDGTLTFVNEAYYRYFEKTPEYLLekIFLPLIPFPDQQQVLDNLKSLNQQKRVITHEHRVIISSGEMRWHQWTN 222
Cdd:COG2202     1 LILVLDRDGRIIYANEAAEELLGYSAEELL--GLLLALHPEDRDRLRELLRRLLAGEELLSEELRLVRKDGEERWVELSA 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  223 RAIVDRQGKIIEFQAvgrditelkqietalrelneeleqrveqrtlqlEAQIQERQAVEKALMESEAKYERLVERLPAVI 302
Cdd:COG2202    79 APLRDGEGRVLGLLG---------------------------------LRDITERKRAEEALRESEERLRALLEASPDGI 125
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  303 YQFSPTKGKLYCSSYVKSILGYSTDEIDLPWLWINSIHPEDLPKVKEMIQEFV--QGKNFEIEYRVKDAQGQ-WHWILDR 379
Cdd:COG2202   126 WVLDEDGRILYANPAAEELLGYSPEEELGRGLSDLIHPEDEERRELELARALAegRGGPLEIEYRVRRKDGErVRWILSR 205
                         250       260
                  ....*....|....*....|....*..
gi 218437596  380 SIGRQAADQEMMIEGVAIDITETKKTQ 406
Cdd:COG2202   206 ISPVRDDGEIVGVVGIARDITERKQAE 232
COG5001 COG5001
Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain ...
1006-1462 9.38e-101

Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain [Signal transduction mechanisms]


Pssm-ID: 227334 [Multi-domain]  Cd Length: 663  Bit Score: 338.02  E-value: 9.38e-101
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1006 NFSSAPLGRLADNRRLimsmalDITERKQAEEQLrhAAVHDQLTGLPNRILLLDRIEQAIKRTQQEEKYlFALLFIDLDR 1085
Cdd:COG5001   199 EFSDMVQSQVTLTQRA------EETRRLSDENDR--LANLDSLTGLPNRRRFFAELDARLAAARQSGRR-LVLGVIDLDG 269
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1086 FKVVNDSLGHWVGDQLLGAIADKLKA-CVRPMdTVARFGGDEFVILLENLTSRTEATKMAQQITDELRSSFCLQGQDFFI 1164
Cdd:COG5001   270 FKPVNDAFGHATGDRLLIEVGRRLKAfDGAPI-LAARLGGDEFALIIPALEDDALRVAGARALCESLQAPYDLRGVRVQV 348
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1165 SVSIGITFPSSYEESASELLRNADIAMYRAKEKGRARYTIFDSKMHIQATRLLELETNLRLALEREELIVHYQPIVSLTT 1244
Cdd:COG5001   349 GASIGIAPFPSGADTSEQLFERADYALYHAKQNGKGAAVLFDARHEAAIRDMAVVEQALRSADLEQELSVHFQPIVDIVS 428
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1245 GKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGEWVLLESCRQMKAWQkefsglDKIRVSVNLSGKQLEYPHLI 1324
Cdd:COG5001   429 GKTIALEALARWHSPEIGPVPPDVFIGIAERSGQIVELTRLLLAKALREARAWP------MDVRVSINLSARDLASMENV 502
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1325 NCLESILKQTGLEGKNLKLEITESMLMNNKEVVSDLLLQIKGKNIQISIDDFGTGYSSLSYLHYLPVDTLKIDRSFVNRM 1404
Cdd:COG5001   503 RRLLAIVSESCIAPHRLDFEITETAIVCDFDQARDALAALHELGVRTALDDFGTGYSSLSHLRALPLDKIKIDRSFVSDL 582
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 218437596 1405 TQLGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQLGCESGQGYFFSKPLDSQ 1462
Cdd:COG5001   583 EENPTSEDIVRTVLQLGRNLRMECVVEGVETEAQRDRVAALGATVMQGYHYARPMPAE 640
PRK13560 PRK13560
hypothetical protein; Provisional
277-790 6.34e-16

hypothetical protein; Provisional


Pssm-ID: 106506 [Multi-domain]  Cd Length: 807  Bit Score: 82.03  E-value: 6.34e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  277 RQAVEKALMESEAKYER-LVERLPAVIYQFS----PTKGKLYCSSYVKSILGYSTDEIDLP-WLWINSIHPEDLPKV--- 347
Cdd:PRK13560   55 RAIAEAEAQDCREQCERnLKANIPGGMFLFAldgdGTFSFPSLLDANGELAAIAKHDLMADkGLLAMLIGGDDGDFFfan 134
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  348 ----KEMIQEFVQGKNF-EIEYRVKDAQGQWHWILDRSigRQAADQEMMIEGVAIDITETKKTQMALQQAHQCLTFHVDN 422
Cdd:PRK13560  135 pfrsAETIAMALQSDDWqEEEGHFRCGDGRFIDCCLRF--ERHAHADDQVDGFAEDITERKRAEERIDEALHFLQQLLDN 212
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  423 SPLGVIEWDNDYRVKRWSSQAEKIFGWKEEEVVGKGWQEWQFVY------EEDLDLIVAKVSEIIKKEtsrhFVTNRNYT 496
Cdd:PRK13560  213 IADPAFWKDEDAKVFGCNDAACLACGFRREEIIGMSIHDFAPAQpaddyqEADAAKFDADGSQIIEAE----FQNKDGRT 288
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  497 KTGEIIdckwYNSVQY-DQSGEILSILSLVLDVSEQKRAEAALQVSQERLQ----------LALEGSGDSIWEWN----- 560
Cdd:PRK13560  289 RPVDVI----FNHAEFdDKENHCAGLVGAITDISGRRAAERELLEKEDMLRaiieaapiaaIGLDADGNICFVNNnaaer 364
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  561 ---LQTGEIYCDQSWWQKLGYEPDHETMSYEWWRSQVAPefLPIHEASLQDYLAGKTEYLTLEYKIQSSSGDWVWMSARG 637
Cdd:PRK13560  365 mlgWSAAEVMGKPLPGMDPELNEEFWCGDFQEWYPDGRP--MAFDACPMAKTIKGGKIFDGQEVLIEREDDGPADCSAYA 442
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  638 KSVaNDEEGNPLKIVGTHRDITESKEIEEELKQQgellQTIVDYIPVMLayidpnynFLWVNEEferilGWSLEEIKNlN 717
Cdd:PRK13560  443 EPL-HDADGNIIGAIALLVDITERKQVEEQLLLA----NLIVENSPLVL--------FRWKAEE-----GWPVELVSK-N 503
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  718 ILAQLY-PD--------------PDERQYVMNYI-----QSAEEKWEDFKTRLRNGTT--IDTSWANVKLSNGAII---G 772
Cdd:PRK13560  504 ITQFGYePDefisgkrmfaaiihPADLEQVAAEVaefaaQGVDRFEQEYRILGKGGAVcwIDDQSAAERDEEGQIShfeG 583
                         570
                  ....*....|....*...
gi 218437596  773 IGQDITVRKHIEEALRES 790
Cdd:PRK13560  584 IVIDISERKHAEEKIKAA 601
AtoS COG2202
FOG: PAS/PAC domain [Signal transduction mechanisms]
426-665 8.75e-15

FOG: PAS/PAC domain [Signal transduction mechanisms]


Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 74.89  E-value: 8.75e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  426 GVIEWDNDYRVKRWSSQAEKIFGWKEEEVVGkgwqeWQFVYEEDLDLIVAKVSEIIKKETSRHFVTNRNYTKTGEIIDCK 505
Cdd:COG2202     1 LILVLDRDGRIIYANEAAEELLGYSAEELLG-----LLLALHPEDRDRLRELLRRLLAGEELLSEELRLVRKDGEERWVE 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  506 WYNSVQYDQSGEILSILSLVlDVSEQKRAEAALQVSQERLQLALEGSGDSIWEWNLQTGEIYCDQSWWQKLGYEPDHETM 585
Cdd:COG2202    76 LSAAPLRDGEGRVLGLLGLR-DITERKRAEEALRESEERLRALLEASPDGIWVLDEDGRILYANPAAEELLGYSPEEELG 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  586 SYEWWRSQVAPEFLPIHEAsLQDYLAGKTEYLTLEYKIQSSSGD-WVWMSARGKSVANDeeGNPLKIVGTHRDITESKEI 664
Cdd:COG2202   155 RGLSDLIHPEDEERRELEL-ARALAEGRGGPLEIEYRVRRKDGErVRWILSRISPVRDD--GEIVGVVGIARDITERKQA 231

                  .
gi 218437596  665 E 665
Cdd:COG2202   232 E 232
PAS_3 pfam08447
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
311-379 1.94e-14

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 254805 [Multi-domain]  Cd Length: 90  Bit Score: 71.26  E-value: 1.94e-14
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 218437596   311 KLYCSSYVKSILGYSTDEIDLPW-LWINSIHPEDLPKVKEMIQEFV--QGKNFEIEYRVKDAQGQWHWILDR 379
Cdd:pfam08447    1 IIYWSPRFEEILGYTPEELKSSYeGWLDLVHPEDRERVRRALQELLlkKGEPYSGEYRIRRKDGSYRWVEAR 72
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
914-1039 2.29e-13

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator [Regulatory functions, Small molecule interactions].


Pssm-ID: 232884 [Multi-domain]  Cd Length: 124  Bit Score: 68.85  E-value: 2.29e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   914 SENRFRRAVIDAPLPILIHAEDGEIIQVNHAWTELTGYTHED-----IPTIADwtekayGERKEIVRSVIDELYKIDGKV 988
Cdd:TIGR00229    1 SEERYRAIFESSPDAIIVIDLEGNILYVNPAFEEIFGYSAEEligrnVLELIP------EEDREEVRERIERRLEGEREP 74
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|.
gi 218437596   989 EEGEFTITIKTGETRIWNFSSAPLgRLADNRRLIMSMALDITERKQAEEQL 1039
Cdd:TIGR00229   75 VSEERRVRRKDGSEIWVEVSVSPI-RTNGGELGVVGIVRDITERKQAEEAL 124
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
673-787 5.51e-13

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator [Regulatory functions, Small molecule interactions].


Pssm-ID: 232884 [Multi-domain]  Cd Length: 124  Bit Score: 68.08  E-value: 5.51e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   673 ELLQTIVDYIPVMLAYIDPNYNFLWVNEEFERILGWSLEEIKNLNILaQLYPDPDE---RQYVMNYIQSAEE-KWEDFKT 748
Cdd:TIGR00229    3 ERYRAIFESSPDAIIVIDLEGNILYVNPAFEEIFGYSAEELIGRNVL-ELIPEEDReevRERIERRLEGEREpVSEERRV 81
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*.
gi 218437596   749 RLRNGTTIdtsWANVKLS----NG---AIIGIGQDITVRKHIEEAL 787
Cdd:TIGR00229   82 RRKDGSEI---WVEVSVSpirtNGgelGVVGIVRDITERKQAEEAL 124
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
420-538 2.60e-12

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator [Regulatory functions, Small molecule interactions].


Pssm-ID: 232884 [Multi-domain]  Cd Length: 124  Bit Score: 65.77  E-value: 2.60e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   420 VDNSPLGVIEWDNDYRVKRWSSQAEKIFGWKEEEVVGKGWqeWQFVYEEDLDLIVAKVSEIIKKETSRHFVTNRNYTKTG 499
Cdd:TIGR00229    9 FESSPDAIIVIDLEGNILYVNPAFEEIFGYSAEELIGRNV--LELIPEEDREEVRERIERRLEGEREPVSEERRVRRKDG 86
                           90       100       110
                   ....*....|....*....|....*....|....*....
gi 218437596   500 EIIDCKWyNSVQYDQSGEILSILSLVLDVSEQKRAEAAL 538
Cdd:TIGR00229   87 SEIWVEV-SVSPIRTNGGELGVVGIVRDITERKQAEEAL 124
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
129-252 1.94e-10

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator [Regulatory functions, Small molecule interactions].


Pssm-ID: 232884 [Multi-domain]  Cd Length: 124  Bit Score: 60.37  E-value: 1.94e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   129 SRSRYRAIVEEQTELICRFRPDGTLTFVNEAYYRYFEKTPEYLLEKIFLPLIPFPDQQQVLDNL-KSLNQQKRVITHEHR 207
Cdd:TIGR00229    1 SEERYRAIFESSPDAIIVIDLEGNILYVNPAFEEIFGYSAEELIGRNVLELIPEEDREEVRERIeRRLEGEREPVSEERR 80
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*
gi 218437596   208 VIISSGEMRWHQWTNRAIvDRQGKIIEFQAVGRDITELKQIETAL 252
Cdd:TIGR00229   81 VRRKDGSEIWVEVSVSPI-RTNGGELGVVGIVRDITERKQAEEAL 124
PAS_4 pfam08448
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
137-247 2.30e-09

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 254806 [Multi-domain]  Cd Length: 110  Bit Score: 56.65  E-value: 2.30e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   137 VEEQTELICRFRPDGTLTFVNEAYYRYFEKTPEYLLEKIFLPLIPFPDQQQVLDNL-KSLNQQKRVITHEHRViiSSGEM 215
Cdd:pfam08448    1 LDSLPDALAVLDPDGRVRYANAAAAELFGLPPEELLGKTLAELLPPEDAARLERALrRALEGEEPIDFLEELL--LNGEE 78
                           90       100       110
                   ....*....|....*....|....*....|..
gi 218437596   216 RWHQWTNRAIVDRQGKIIEFQAVGRDITELKQ 247
Cdd:pfam08448   79 RHYELRLTPLRDPDGEVIGVLVISRDITERRR 110
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
541-668 1.83e-08

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator [Regulatory functions, Small molecule interactions].


Pssm-ID: 232884 [Multi-domain]  Cd Length: 124  Bit Score: 54.21  E-value: 1.83e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   541 SQERLQLALEGSGDSIWEWNLQTGEIYCDQSWWQKLGYEPDhETMSYEWWrSQVAPEFLPIHEASLQDYLAGKTEYLTLE 620
Cdd:TIGR00229    1 SEERYRAIFESSPDAIIVIDLEGNILYVNPAFEEIFGYSAE-ELIGRNVL-ELIPEEDREEVRERIERRLEGEREPVSEE 78
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 218437596   621 YKIQSSSGDWVWMSARGKSVanDEEGNPLKIVGTHRDITESKEIEEEL 668
Cdd:TIGR00229   79 RRVRRKDGSEIWVEVSVSPI--RTNGGELGVVGIVRDITERKQAEEAL 124
PAS_9 pfam13426
PAS domain;
802-903 1.03e-07

PAS domain;


Pssm-ID: 257751 [Multi-domain]  Cd Length: 104  Bit Score: 51.62  E-value: 1.03e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   802 PNPLWVYDVKTLaFLEVNQAAIEHYGYSREEFLGMTLRDI-RPSEDVKILETYIANINPSFNRSGYWQHRKSNGEIIDVE 880
Cdd:pfam13426    1 PDGILVLDPEGR-IVYANPAALRLLGYTREELLGKSIRDLfGPGTDEEAVARLREALRNGGEVEVELELRRKDGEPFPVL 79
                           90       100
                   ....*....|....*....|....*
gi 218437596   881 ITSHGIEFAGRQAR--LVLVNDITE 903
Cdd:pfam13426   80 VSASPVRDEDGEVVgiVGILRDITE 104
PAS pfam00989
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
673-777 4.80e-07

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 250275 [Multi-domain]  Cd Length: 111  Bit Score: 49.70  E-value: 4.80e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   673 ELLQTIVDYIPVMLAYIDPNYNFLWVNEEFERILGWSLEEIKNLNILAQLYPDPDERQYVMNYIQSAEEKWEDFKTRLR- 751
Cdd:pfam00989    1 EDLRAILESLPDGIFVVDEDGRILYVNAAAEELLGLSREEVIGKSLLDLIPEEDDAVAELLRQALLQGEESRGFEVSFRv 80
                           90       100       110
                   ....*....|....*....|....*....|....
gi 218437596   752 -NGTTIdtsWANVKLS-------NGAIIGIGQDI 777
Cdd:pfam00989   81 rDGRPR---HVEVRASpvrdaggEIGFLGVLRDI 111
RocR COG3829
Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains ...
643-792 3.81e-05

Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]


Pssm-ID: 226350 [Multi-domain]  Cd Length: 560  Bit Score: 46.53  E-value: 3.81e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  643 DEEGNPLKIVGTHRDITESKE-IEEELKQQGELLQTIVDYIPVMLAYIDPNYNFLWVNEEFERILGWSLEEI--KNLNIL 719
Cdd:COG3829    86 DEQGRVVGVLEVFLDISEALElIEENLRQLRQRLEAILDSIDDGLLVVDEDGIIIYYNKAYAKLLGLSPEEVlgKHLLDV 165
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 218437596  720 AQLYPDPderqYVMNYIQSAEEKWEDFKTRLRNGTTIDTSWanVKlSNGAIIG---IGQDITVRKHIEEALRESEQ 792
Cdd:COG3829   166 VSAGEDS----TLLEVLRTGKPIRDVVQTYNGNKIIVNVAP--VY-ADGQLIGvvgISKDVSELERLTRELEESEG 234
PRK13560 PRK13560
hypothetical protein; Provisional
113-290 7.64e-04

hypothetical protein; Provisional


Pssm-ID: 106506 [Multi-domain]  Cd Length: 807  Bit Score: 42.74  E-value: 7.64e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  113 LGQLNIL------KKIKQALKKSRsryrAIVEEQTELICRFR--PDGTLTFVNEAYYRyFEKTPEYLL--EKIFLPLIPF 182
Cdd:PRK13560  453 IGAIALLvditerKQVEEQLLLAN----LIVENSPLVLFRWKaeEGWPVELVSKNITQ-FGYEPDEFIsgKRMFAAIIHP 527
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  183 PDQQQVLDNLKSLNQQK-RVITHEHRVIISSGEMRWHQWTNRAIVDRQGKIIEFQAVGRDITELK----QIETALRE--- 254
Cdd:PRK13560  528 ADLEQVAAEVAEFAAQGvDRFEQEYRILGKGGAVCWIDDQSAAERDEEGQISHFEGIVIDISERKhaeeKIKAALTEkev 607
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 218437596  255 LNEELEQRVeQRTLQLEAQIQERQAveKALMESEAK 290
Cdd:PRK13560  608 LLKEIHHRV-KNNLQIISSLLDLQA--EKLHDEEAK 640
 
Name Accession Description Interval E-value
EAL cd01948
EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL ...
1221-1460 5.91e-111

EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.


Pssm-ID: 238923  Cd Length: 240  Bit Score: 351.46  E-value: 5.91e-111
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1221 TNLRLALEREELIVHYQPIVSLTTGKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGEWVLLESCRQMKAWQKe 1300
Cdd:cd01948     1 ADLRRALERGEFELYYQPIVDLRTGRIVGYEALLRWRHPEGGLISPAEFIPLAEETGLIVELGRWVLEEACRQLARWQA- 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1301 fsGLDKIRVSVNLSGKQLEYPHLINCLESILKQTGLEGKNLKLEITESMLMNNKEVVSDLLLQIKGKNIQISIDDFGTGY 1380
Cdd:cd01948    80 --GGPDLRLSVNLSARQLRDPDFLDRLLELLAETGLPPRRLVLEITESALIDDLEEALATLRRLRALGVRIALDDFGTGY 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1381 SSLSYLHYLPVDTLKIDRSFVNRMTQLGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQLGCESGQGYFFSKPLD 1460
Cdd:cd01948   158 SSLSYLKRLPVDYLKIDRSFVRDIETDPEDRAIVRAIIALAHSLGLKVVAEGVETEEQLELLRELGCDYVQGYLFSRPLP 237
GGDEF cd01949
Diguanylate-cyclase (DGC) or GGDEF domain; Diguanylate-cyclase (DGC) or GGDEF domain: ...
1045-1202 1.14e-59

Diguanylate-cyclase (DGC) or GGDEF domain; Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.


Pssm-ID: 143635  Cd Length: 158  Bit Score: 203.56  E-value: 1.14e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1045 HDQLTGLPNRILLLDRIEQAIKRTQQEEKYlFALLFIDLDRFKVVNDSLGHWVGDQLLGAIADKLKACVRPMDTVARFGG 1124
Cdd:cd01949     2 TDPLTGLPNRRAFEERLERLLARARRSGRP-LALLLIDIDHFKQINDTYGHAAGDEVLKEVAERLRSSLRESDLVARLGG 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 218437596 1125 DEFVILLENlTSRTEATKMAQQITDELRSSFCLQGQDFFISVSIGITFPSSYEESASELLRNADIAMYRAKEKGRARY 1202
Cdd:cd01949    81 DEFAILLPG-TDLEEAEALAERLREAIEEPFFIDGQEIRVTASIGIATYPEDGEDAEELLRRADEALYRAKRSGRNRV 157
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
142-242 8.60e-10

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 58.03  E-value: 8.60e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  142 ELICRFRPDGTLTFVNEAYYRYFEKTPEYLLEKIFLPLIPFPDQQQVLDNLKSLNQQKRVITHEHRVIISSGEMRWHQWT 221
Cdd:cd00130     3 DGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEDREELRERLENLLSGGEPVTLEVRLRRKDGSVIWVLVS 82
                          90       100
                  ....*....|....*....|.
gi 218437596  222 NRAIVDRQGKIIEFQAVGRDI 242
Cdd:cd00130    83 LTPIRDEGGEVIGLLGVVRDI 103
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
423-528 1.73e-08

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 54.18  E-value: 1.73e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  423 SPLGVIEWDNDYRVKRWSSQAEKIFGWKEEEVVGKGWqeWQFVYEEDLDLIVAKVSEIIKKETSRHFVTnRNYTKTGEII 502
Cdd:cd00130     1 LPDGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSL--LDLIHPEDREELRERLENLLSGGEPVTLEV-RLRRKDGSVI 77
                          90       100
                  ....*....|....*....|....*.
gi 218437596  503 DCKWYNSVQYDQSGEILSILSLVLDV 528
Cdd:cd00130    78 WVLVSLTPIRDEGGEVIGLLGVVRDI 103
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
802-899 1.56e-07

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 51.09  E-value: 1.56e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  802 PNPLWVYDVKTLaFLEVNQAAIEHYGYSREEFLGMTLRDIRPSEDV-KILETYIANINPSFNRSGYWQHRKSNGEIIDVE 880
Cdd:cd00130     2 PDGVIVLDLDGR-ILYANPAAEQLLGYSPEELIGKSLLDLIHPEDReELRERLENLLSGGEPVTLEVRLRRKDGSVIWVL 80
                          90
                  ....*....|....*....
gi 218437596  881 ITSHGIEFAGRQARLVLVN 899
Cdd:cd00130    81 VSLTPIRDEGGEVIGLLGV 99
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
925-1029 5.80e-07

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 49.55  E-value: 5.80e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  925 APLPILIHAEDGEIIQVNHAWTELTGYTHEDIPTIADWTEKAYGERKEIVRSVIDELykIDGKVEEGEFTITIKTGETRI 1004
Cdd:cd00130     1 LPDGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEDREELRERLENLL--SGGEPVTLEVRLRRKDGSVIW 78
                          90       100
                  ....*....|....*....|....*
gi 218437596 1005 WNFSSAPLGRLADNRRLIMSMALDI 1029
Cdd:cd00130    79 VLVSLTPIRDEGGEVIGLLGVVRDI 103
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
312-399 4.58e-05

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 43.39  E-value: 4.58e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  312 LYCSSYVKSILGYSTDE-IDLPWLwiNSIHPEDLPKVKEMIQEFVQ-GKNFEIEYRVKDAQGQWHWIL-DRSIGRQAADQ 388
Cdd:cd00130    15 LYANPAAEQLLGYSPEElIGKSLL--DLIHPEDREELRERLENLLSgGEPVTLEVRLRRKDGSVIWVLvSLTPIRDEGGE 92
                          90
                  ....*....|.
gi 218437596  389 EMMIEGVAIDI 399
Cdd:cd00130    93 VIGLLGVVRDI 103
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
682-777 6.35e-05

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 43.01  E-value: 6.35e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  682 IPVMLAYIDPNYNFLWVNEEFERILGWSLEEIKNLNILAQLYPD--PDERQYVMNYIQSAEEKWEDFKTRLRNGTTIDTS 759
Cdd:cd00130     1 LPDGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEdrEELRERLENLLSGGEPVTLEVRLRRKDGSVIWVL 80
                          90       100
                  ....*....|....*....|...
gi 218437596  760 WANVKLSNGA-----IIGIGQDI 777
Cdd:cd00130    81 VSLTPIRDEGgevigLLGVVRDI 103
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
552-658 8.72e-05

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 42.62  E-value: 8.72e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  552 SGDSIWEWNLQTGEIYCDQSWWQKLGYEPD--HETMSYEWwrsqVAPEFLPIHEASLQDYLAGKTEYlTLEYKIQSSSGD 629
Cdd:cd00130     1 LPDGVIVLDLDGRILYANPAAEQLLGYSPEelIGKSLLDL----IHPEDREELRERLENLLSGGEPV-TLEVRLRRKDGS 75
                          90       100
                  ....*....|....*....|....*....
gi 218437596  630 WVWMSARGKSVAnDEEGNPLKIVGTHRDI 658
Cdd:cd00130    76 VIWVLVSLTPIR-DEGGEVIGLLGVVRDI 103
Rtn COG2200
c-di-GMP phosphodiesterase class I (EAL domain) [Signal transduction mechanisms]
1217-1470 2.09e-102

c-di-GMP phosphodiesterase class I (EAL domain) [Signal transduction mechanisms]


Pssm-ID: 225110  Cd Length: 256  Bit Score: 327.71  E-value: 2.09e-102
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1217 LELETNLRLALEREELIVHYQPIVSLTTGKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGEWVLLESCRQMKA 1296
Cdd:COG2200     2 LQLERDLRQALENGEFSLYYQPIVDLATGRIVGYEALLRWRHPDGGLISPGEFIPLAEETGLIVELGRWVLEEACRQLRT 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1297 WQKEFSgldkIRVSVNLSGKQLEYPHLINCLESILKQTGLEGKNLKLEITESMLMNNKEVVSDLLLQIKGKNIQISIDDF 1376
Cdd:COG2200    82 WPRAGP----LRLAVNLSPVQLRSPGLVDLLLRLLARLGLPPHRLVLEITESALIDDLDTALALLRQLRELGVRIALDDF 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1377 GTGYSSLSYLHYLPVDTLKIDRSFVNRMTQLGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQLGCESGQGYFFS 1456
Cdd:COG2200   158 GTGYSSLSYLKRLPPDILKIDRSFVRDLETDARDQAIVRAIVALAHKLGLTVVAEGVETEEQLDLLRELGCDYLQGYLFS 237
                         250
                  ....*....|....
gi 218437596 1457 KPLDSQKVTSWFEK 1470
Cdd:COG2200   238 RPLPADALDALLSS 251
EAL smart00052
Putative diguanylate phosphodiesterase; Putative diguanylate phosphodiesterase, present in a ...
1220-1459 3.23e-99

Putative diguanylate phosphodiesterase; Putative diguanylate phosphodiesterase, present in a variety of bacteria.


Pssm-ID: 214491  Cd Length: 242  Bit Score: 318.39  E-value: 3.23e-99
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   1220 ETNLRLALEREELIVHYQPIVSLTTGKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGEWVLLESCRQMKAWQK 1299
Cdd:smart00052    1 ERELRQALENGQFLLYYQPIVSLRTGRLVGVEALIRWQHPEGGIISPDEFIPLAEETGLIVPLGRWVLEQACQQLAEWQA 80
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   1300 efSGLDKIRVSVNLSGKQLEYPHLINCLESILKQTGLEGKNLKLEITESMLMNNKEVVSDLLLQIKGKNIQISIDDFGTG 1379
Cdd:smart00052   81 --QGPPPLLISINLSARQLISPDLVPRVLELLEETGLPPQRLELEITESVLLDDDESAVATLQRLRELGVRIALDDFGTG 158
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   1380 YSSLSYLHYLPVDTLKIDRSFVNRMTQLGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQLGCESGQGYFFSKPL 1459
Cdd:smart00052  159 YSSLSYLKRLPVDLLKIDKSFVRDLQTDPEDEAIVQSIIELAQKLGLQVVAEGVETPEQLDLLRSLGCDYGQGYLFSRPL 238
EAL pfam00563
EAL domain; This domain is found in diverse bacterial signaling proteins. It is called EAL ...
1222-1458 3.98e-69

EAL domain; This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues. The EAL domain is a good candidate for a diguanylate phosphodiesterase function. The domain contains many conserved acidic residues that could participate in metal binding and might form the phosphodiesterase active site.


Pssm-ID: 249961  Cd Length: 231  Bit Score: 233.43  E-value: 3.98e-69
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  1222 NLRLALEREELIVHYQPIVSLTTGKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGEWVLLESCRQMKAWQKEf 1301
Cdd:pfam00563    3 ALREALENGEFSLYFQPIVDLRTGKVLGYEALLRWQHPDGGLISPDEFLPLAERLGLIAELDRWVLEKALAQLAEWLNP- 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  1302 sgldKIRVSVNLSGKQLEYPHLINCLESiLKQTGLEGKNLKLEITESmLMNNKEVVSDLLLQIKGKNIQISIDDFGTGYS 1381
Cdd:pfam00563   82 ----DLPLSVNLSPASLLDPSFLEALLA-LKQGGLPPSRLVLEITES-ALDEDLRLLEALARLRSLGFRLALDDFGTGYS 155
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 218437596  1382 SLSYLHYLPVDTLKIDRSFVNRMTQlGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQLGCESGQGYFFSKP 1458
Cdd:pfam00563  156 SLSLLSRLPPDYIKIDRSFIKDLSD-PESRALLRALIALARSLGIKVVAEGVETEEQLELLKELGIDYVQGYLFSKP 231
COG2199 COG2199
c-di-GMP synthetase (diguanylate cyclase, GGDEF domain) [Signal transduction mechanisms]
1025-1205 7.65e-59

c-di-GMP synthetase (diguanylate cyclase, GGDEF domain) [Signal transduction mechanisms]


Pssm-ID: 225109  Cd Length: 181  Bit Score: 202.29  E-value: 7.65e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1025 MALDITERKQAEEQLRHAAVHDQLTGLPNRILLLDRIEQAIKRTQQEEKYlFALLFIDLDRFKVVNDSLGHWVGDQLLGA 1104
Cdd:COG2199     2 LLRLLTRLRKAEERLERLALHDPLTGLPNRRAFEERLERALARARRHGEP-LALLLLDLDHFKQINDTYGHAAGDEVLRE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1105 IADKLKACVRPMDTVARFGGDEFVILLENlTSRTEATKMAQQITDELRSSFCLQGQDFFISVSIGIT-FPSSYEESASEL 1183
Cdd:COG2199    81 VARRLRSNLREGDLVARLGGDEFAVLLPG-TSLEEAARLAERIRAALEEPFFLGGEELRVTVSIGVAlYPEDGSDDAELL 159
                         170       180
                  ....*....|....*....|..
gi 218437596 1184 LRNADIAMYRAKEKGRARYTIF 1205
Cdd:COG2199   160 LRRADLALYRAKRAGRNRVVVF 181
GGDEF pfam00990
GGDEF domain; This domain is found linked to a wide range of non-homologous domains in a ...
1043-1199 7.50e-54

GGDEF domain; This domain is found linked to a wide range of non-homologous domains in a variety of bacteria. It has been shown to be homologous to the adenylyl cyclase catalytic domain and has diguanylate cyclase activity. This observation correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate.


Pssm-ID: 250276  Cd Length: 159  Bit Score: 187.06  E-value: 7.50e-54
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  1043 AVHDQLTGLPNRILLLDRIEQAIKRtQQEEKYLFALLFIDLDRFKVVNDSLGHWVGDQLLGAIADKLKACVRPMDTVARF 1122
Cdd:pfam00990    1 AAHDPLTGLPNRRYFEEELEQELQR-ARRQQSPLALLLIDLDNFKRINDTYGHAVGDEVLQEVAQRLSSSLRRSDLVARL 79
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 218437596  1123 GGDEFVILLENLTSRT--EATKMAQQITDELRSSFCLQGQDFFISVSIGITFPSSYEESASELLRNADIAMYRAKEKGR 1199
Cdd:pfam00990   80 GGEEFAILLPDTSLEGaqELAERIRRLLAALAIPHTLSGLPLYVTISIGIAAYPNDGEDPEDLLKRADQALYQAKQQGR 158
GGDEF smart00267
diguanylate cyclase; Diguanylate cyclase, present in a variety of bacteria.
1041-1205 6.18e-52

diguanylate cyclase; Diguanylate cyclase, present in a variety of bacteria.


Pssm-ID: 128563  Cd Length: 163  Bit Score: 181.68  E-value: 6.18e-52
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   1041 HAAVHDQLTGLPNRILLLDRIEQAIKRtQQEEKYLFALLFIDLDRFKVVNDSLGHWVGDQLLGAIADKLKACVRPMDTVA 1120
Cdd:smart00267    1 RLAFRDPLTGLPNRRYFEEELEQELQR-AQRQGSPFALLLIDLDNFKDINDTYGHAVGDELLQEVAQRLSSCLRPGDLLA 79
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   1121 RFGGDEFVILLENlTSRTEATKMAQQITDELRSSFCLQGQDFFISVSIGITFPSSYEESASELLRNADIAMYRAKEKGRA 1200
Cdd:smart00267   80 RLGGDEFALLLPE-TSLEEAIALAERILQQLREPIIIHGIPLYLTISIGVAAYPNPGEDAEDLLKRADTALYQAKKAGRN 158

                    ....*
gi 218437596   1201 RYTIF 1205
Cdd:smart00267  159 QVAVY 163
GGDEF TIGR00254
diguanylate cyclase (GGDEF) domain; The GGDEF domain is named for the motif GG[DE]EF shared by ...
1043-1206 1.75e-39

diguanylate cyclase (GGDEF) domain; The GGDEF domain is named for the motif GG[DE]EF shared by many proteins carrying the domain. There is evidence that the domain has diguanylate cyclase activity. Several proteins carrying this domain also carry domains with functions relating to environmental sensing. These include PleD, a response regulator protein involved in the swarmer-to-stalked cell transition in Caulobacter crescentus, and FixL, a heme-containing oxygen sensor protein [Regulatory functions, Small molecule interactions, Signal transduction, Other].


Pssm-ID: 232895  Cd Length: 165  Bit Score: 146.33  E-value: 1.75e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  1043 AVHDQLTGLPNRILLLDRIEQAIKRTQQEEkYLFALLFIDLDRFKVVNDSLGHWVGDQLLGAIADKLKACVRPMDTVARF 1122
Cdd:TIGR00254    2 AVRDPLTGLYNRRYLEEMLDSELKRARRFQ-RSFSVLMIDIDNFKKINDTLGHDVGDEVLREVARILQSSVRGSDVVGRY 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  1123 GGDEFVILLENlTSRTEATKMAQQITDELRSSFCL--QGQDFFISVSIGItfpSSYEESAS---ELLRNADIAMYRAKEK 1197
Cdd:TIGR00254   81 GGEEFVVILPG-TPLEDALSKAERLRDAINSKPIEvaGSETLTVTVSIGV---ACYPGHGLtleELLKRADEALYQAKKA 156

                   ....*....
gi 218437596  1198 GRARYTIFD 1206
Cdd:TIGR00254  157 GRNRVVVAD 165
PRK11596 PRK11596
cyclic-di-GMP phosphodiesterase; Provisional
1235-1459 1.29e-13

cyclic-di-GMP phosphodiesterase; Provisional


Pssm-ID: 183222  Cd Length: 255  Bit Score: 71.57  E-value: 1.29e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1235 HYQPIVSlTTGKLLGFEALVRWEHPKkgliSPGEFI-PIAEETGLIIPLGEWVLLESCRQMKAWQKEFsGLDKIRVSVNL 1313
Cdd:PRK11596   33 TFQPIYR-TSGRLMAIELLTAVTHPS----NPSQRLsPERYFAEITVSHRLDVVKEQLDLLAQWADFF-VRHGLLASVNI 106
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1314 SGKQLeyphlinclesILKQTGLEGKNL-------KLEITESMLMNNKEVVSdlllQIKGKNiQISIDDFGTG---YSSL 1383
Cdd:PRK11596  107 DGPTL-----------IALRQQPAILRLierlpwlRFELVEHIRLPKDSPFA----SMCEFG-PLWLDDFGTGmanFSAL 170
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 218437596 1384 SYLHYlpvDTLKIDRSFVNRMTQLGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQLGCESGQGYFFSKPL 1459
Cdd:PRK11596  171 SEVRY---DYIKVARELFIMLRQSEEGRNLFSQLLHLMNRYCRGVIVEGVETPEEWRDVQRSPAFAAQGYFLSRPA 243
Nucleotidyl_cyc_III cd07556
Class III nucleotidyl cyclases; Class III nucleotidyl cyclases are the largest, most diverse ...
1078-1170 8.42e-09

Class III nucleotidyl cyclases; Class III nucleotidyl cyclases are the largest, most diverse group of nucleotidyl cyclases (NC's) containing prokaryotic and eukaryotic proteins. They can be divided into two major groups; the mononucleotidyl cyclases (MNC's) and the diguanylate cyclases (DGC's). The MNC's, which include the adenylate cyclases (AC's) and the guanylate cyclases (GC's), have a conserved cyclase homology domain (CHD), while the DGC's have a conserved GGDEF domain, named after a conserved motif within this subgroup. Their products, cyclic guanylyl and adenylyl nucleotides, are second messengers that play important roles in eukaryotic signal transduction and prokaryotic sensory pathways.


Pssm-ID: 143637  Cd Length: 133  Bit Score: 55.44  E-value: 8.42e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1078 LLFIDLDRFKVVNDSLGHWVGDQLLGAIADKL-KACVRPMDTVARFGGDEFVILLeNLTSRTEATKMAQQITDELRSSFC 1156
Cdd:cd07556     4 ILFADIVGFTSLADALGPDEGDELLNELAGRFdSLIRRSGDLKIKTIGDEFMVVS-GLDHPAAAVAFAEDMREAVSALNQ 82
                          90
                  ....*....|....
gi 218437596 1157 LQGQDffISVSIGI 1170
Cdd:cd07556    83 SEGNP--VRVRIGI 94
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
673-741 5.19e-07

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 48.93  E-value: 5.19e-07
                            10        20        30        40        50        60
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 218437596    673 ELLQTIVDYIPVMLAYIDPNYNFLWVNEEFERILGWSLEEIKNLNILaQLYPdPDERQYVMNYIQSAEE 741
Cdd:smart00091    1 ERLRAILESLPDGIFVLDLDGRILYANPAAEELLGYSPEELIGKSLL-ELIH-PEDRERVQEALQRLLS 67
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
416-482 1.73e-06

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 47.39  E-value: 1.73e-06
                            10        20        30        40        50        60
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 218437596    416 LTFHVDNSPLGVIEWDNDYRVKRWSSQAEKIFGWKEEEVVGKGWqeWQFVYEEDLDLIVAKVSEIIK 482
Cdd:smart00091    3 LRAILESLPDGIFVLDLDGRILYANPAAEELLGYSPEELIGKSL--LELIHPEDRERVQEALQRLLS 67
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
792-856 9.34e-06

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 45.08  E-value: 9.34e-06
                            10        20        30        40        50        60
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 218437596    792 QKYRLLFYANPNPLWVYDVKTlAFLEVNQAAIEHYGYSREEFLGMTLRDIRPSEDVKILETYIAN 856
Cdd:smart00091    1 ERLRAILESLPDGIFVLDLDG-RILYANPAAEELLGYSPEELIGKSLLELIHPEDRERVQEALQR 64
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
131-195 3.76e-05

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 43.54  E-value: 3.76e-05
                            10        20        30        40        50        60
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 218437596    131 SRYRAIVEEQTELICRFRPDGTLTFVNEAYYRYFEKTPEYLLEKIFLPLIPFPDQQQVLDNLKSL 195
Cdd:smart00091    1 ERLRAILESLPDGIFVLDLDGRILYANPAAEELLGYSPEELIGKSLLELIHPEDRERVQEALQRL 65
PAC smart00086
Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain); PAC motif ...
203-245 1.64e-04

Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain); PAC motif occurs C-terminal to a subset of all known PAS motifs. It is proposed to contribute to the PAS domain fold.


Pssm-ID: 197509  Cd Length: 43  Bit Score: 41.01  E-value: 1.64e-04
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|...
gi 218437596    203 THEHRVIISSGEMRWHQWTNRAIVDRQGKIIEFQAVGRDITEL 245
Cdd:smart00086    1 TVEYRLRRKDGSYIWVLVSASPIRDEDGEVEGILGVVRDITER 43
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
917-956 2.48e-04

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 40.85  E-value: 2.48e-04
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|
gi 218437596    917 RFRRAVIDAPLPILIHAEDGEIIQVNHAWTELTGYTHEDI 956
Cdd:smart00091    2 RLRAILESLPDGIFVLDLDGRILYANPAAEELLGYSPEEL 41
Phage_GP20 pfam06810
Phage minor structural protein GP20; This family consists of several phage minor structural ...
227-298 1.07e-03

Phage minor structural protein GP20; This family consists of several phage minor structural protein GP20 sequences of around 180 residues in length. The function of this family is unknown.


Pssm-ID: 253923  Cd Length: 156  Bit Score: 40.02  E-value: 1.07e-03
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 218437596   227 DRQGKIIEFQAVGRDITELKQietalrELnEELEQRVEQRTLQLEAQIQERQ---AVEKALMESEAKYERLVERL 298
Cdd:pfam06810   38 NRDKQIEDLKKKVKDNEELQK------KI-EKLKQQNKTAKEEYEAKLADTKlnnAIELALKKAKARNAKAVKAL 105
PAS_8 pfam13188
PAS domain;
673-737 1.11e-03

PAS domain;


Pssm-ID: 257556  Cd Length: 66  Bit Score: 39.13  E-value: 1.11e-03
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 218437596   673 ELLQTIVDYIPVMLAYIDPNYNFLWVNEEFERILGW-SLEEIKNLNILAQLYPDPDERQYVMNYIQ 737
Cdd:pfam13188    1 ERLRALFENAPDGILVLDRGGRILYANPAALELLGYeELLGELLGELLDDLEALAEEALELLEELE 66
PAC smart00086
Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain); PAC motif ...
618-660 2.77e-03

Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain); PAC motif occurs C-terminal to a subset of all known PAS motifs. It is proposed to contribute to the PAS domain fold.


Pssm-ID: 197509  Cd Length: 43  Bit Score: 37.55  E-value: 2.77e-03
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|...
gi 218437596    618 TLEYKIQSSSGDWVWMSARGKSVaNDEEGNPLKIVGTHRDITE 660
Cdd:smart00086    1 TVEYRLRRKDGSYIWVLVSASPI-RDEDGEVEGILGVVRDITE 42
PRK11359 PRK11359
cyclic-di-GMP phosphodiesterase; Provisional
689-1469 7.96e-100

cyclic-di-GMP phosphodiesterase; Provisional


Pssm-ID: 183097 [Multi-domain]  Cd Length: 799  Bit Score: 339.44  E-value: 7.96e-100
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  689 IDPNYNFLWVNEEFERILGWSLEEIKNLNIlAQLYPdPDERQYVMNYIQS--------AEEKWEDFKTRLRNGTTIDTSW 760
Cdd:PRK11359   28 INENDEVLFFNPAAEKLWGYKREEVIGNNI-DMLIP-RDLRPAHPEYIRHnreggkarVEGMSRELQLEKKDGSKIWTRF 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  761 ANVKLS-NGAI--IGIGQDITVrkhiEEALRESEqkyRLLFYANPN---PLWVYDVKTlAFLEVNQAAIEHYGYSREEFL 834
Cdd:PRK11359  106 ALSKVSaEGKVyyLALVRDASV----EMAQKEQT---RQLIIAVDHldrPVIVLDPER-RIVQCNRAFTEMFGYCISEAS 177
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  835 GMTLRDIRPSEDvkiletyianiNPSFNR----SGYWQHRKSNGEIIDVeiTSHGIEFAGR------------QARLVLV 898
Cdd:PRK11359  178 GMQPDTLLNIPE-----------FPADNRirlqQLLWKTARDQDEFLLL--TRTGEKIWIKasispvydvlahLQNLVMT 244
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  899 -NDITEQLKAQQklqesenrFRRAVIDAPLPILIHAEDGEIIQVNhaWTELTGYTHEDIPTIAD-----WT----EKAYG 968
Cdd:PRK11359  245 fSDITEERQIRQ--------LEGNILAAMCSSPPFHEMGEIICRN--IESVLNESHVSLFALRNgmpihWAssshGAEYQ 314
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  969 ERKEIVRSVidelYKIDGKVEeGEFTI-TIKTGETriwnfsSAPLGRLADNRRLIMSMALditERKQAEEQLRHAAVHDQ 1047
Cdd:PRK11359  315 NAQSWSATI----RQRDGAPA-GTLQIkTSSGAET------SAFIERVADISQHLAALAL---EQEKSRQHIEQLIQFDP 380
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1048 LTGLPNRILLLDRIEQAIKRTQQeekylFALLFIDLDRFKVVNDSLGHWVGDQLLGAIADKLKACVRPMDTVARFGGDEF 1127
Cdd:PRK11359  381 LTGLPNRNNLHNYLDDLVDKAVS-----PVVYLIGVDHFQDVIDSLGYAWADQALLEVVNRFREKLKPDQYLCRIEGTQF 455
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1128 VIL-LENLTSRteATKMAQQITDELRSSFCLQGQDFFISVSIGItfpsSYEESASE--LLRNADIAMYRAKEKGRARYTI 1204
Cdd:PRK11359  456 VLVsLENDVSN--ITQIADELRNVVSKPIMIDDKPFPLTLSIGI----SYDVGKNRdyLLSTAHNAMDYIRKNGGNGWQF 529
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1205 FDSKMHIQATRLLELETNLRLALEREELIVHYQPIVSLTTGKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGE 1284
Cdd:PRK11359  530 FSPAMNEMVKERLVLGAALKEAISNNQLKLVYQPQIFAETGELYGIEALARWHDPLHGHVPPSRFIPLAEEIGEIENIGR 609
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1285 WVLLESCRQMKAWQKEfsGLDKIRVSVNLSGKQLEYPHLINCLESILKQTGLEGKNLKLEITESMLMNNKEVVSDLLLQI 1364
Cdd:PRK11359  610 WVIAEACRQLAEWRSQ--NIHIPALSVNLSALHFRSNQLPNQVSDAMQAWGIDGHQLTVEITESMMMEHDTEIFKRIQIL 687
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1365 KGKNIQISIDDFGTGYSSLSYLHYLPVDTLKIDRSFVNRMTQLGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQ 1444
Cdd:PRK11359  688 RDMGVGLSVDDFGTGFSGLSRLVSLPVTEIKIDKSFVDRCLTEKRILALLEAITSIGQSLNLTVVAEGVETKEQFEMLRK 767
                         810       820
                  ....*....|....*....|....*
gi 218437596 1445 LGCESGQGYFFSKPLDSQKVTSWFE 1469
Cdd:PRK11359  768 IHCRVIQGYFFSRPLPAEEIPGWMS 792
AtoS COG2202
FOG: PAS/PAC domain [Signal transduction mechanisms]
312-535 1.64e-17

FOG: PAS/PAC domain [Signal transduction mechanisms]


Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 83.36  E-value: 1.64e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  312 LYCSSYVKSILGYSTDEIdlpWLWINSIHPEDLPKVKEMIQEFVQGKN-FEIEYRVKDAQGQWHWILDRSIGRQAADQEM 390
Cdd:COG2202    12 IYANEAAEELLGYSAEEL---LGLLLALHPEDRDRLRELLRRLLAGEElLSEELRLVRKDGEERWVELSAAPLRDGEGRV 88
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  391 MIEGVAIDITETKKTQMALQQAHQCLTFHVDNSPLGVIEWDNDYRVKRWSSQAEKIFGWKEEEVVGKGWQEWQFVYEEDL 470
Cdd:COG2202    89 LGLLGLRDITERKRAEEALRESEERLRALLEASPDGIWVLDEDGRILYANPAAEELLGYSPEEELGRGLSDLIHPEDEER 168
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 218437596  471 DLIVAKVSEIIKKETSRHFVTnRNYTKTGEIIDCKWYNSVQYDQSGEILSILSLVLDVSEQKRAE 535
Cdd:COG2202   169 RELELARALAEGRGGPLEIEY-RVRRKDGERVRWILSRISPVRDDGEIVGVVGIARDITERKQAE 232
PAS_3 pfam08447
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
566-655 2.56e-15

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 254805 [Multi-domain]  Cd Length: 90  Bit Score: 73.95  E-value: 2.56e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   566 IYCDQSWWQKLGYEPDHETMSYEWWRSQVAPEFLPIHEASLQDYLAGKTEYLTLEYKIQSSSGDWVWMSARGKSVAnDEE 645
Cdd:pfam08447    2 IYWSPRFEEILGYTPEELKSSYEGWLDLVHPEDRERVRRALQELLLKKGEPYSGEYRIRRKDGSYRWVEARGRPIR-DEN 80
                           90
                   ....*....|
gi 218437596   646 GNPLKIVGTH 655
Cdd:pfam08447   81 GKPVRVIGVA 90
AtoS COG2202
FOG: PAS/PAC domain [Signal transduction mechanisms]
143-406 5.82e-12

FOG: PAS/PAC domain [Signal transduction mechanisms]


Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 66.03  E-value: 5.82e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  143 LICRFRPDGTLTFVNEAYYRYFEKTPEYLLekIFLPLIPFPDQQQVLDNLKSLNQQKRVITHEHRVIISSGEMRWHQWTN 222
Cdd:COG2202     1 LILVLDRDGRIIYANEAAEELLGYSAEELL--GLLLALHPEDRDRLRELLRRLLAGEELLSEELRLVRKDGEERWVELSA 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  223 RAIVDRQGKIIEFQAvgrditelkqietalrelneeleqrveqrtlqlEAQIQERQAVEKALMESEAKYERLVERLPAVI 302
Cdd:COG2202    79 APLRDGEGRVLGLLG---------------------------------LRDITERKRAEEALRESEERLRALLEASPDGI 125
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  303 YQFSPTKGKLYCSSYVKSILGYSTDEIDLPWLWINSIHPEDLPKVKEMIQEFV--QGKNFEIEYRVKDAQGQ-WHWILDR 379
Cdd:COG2202   126 WVLDEDGRILYANPAAEELLGYSPEEELGRGLSDLIHPEDEERRELELARALAegRGGPLEIEYRVRRKDGErVRWILSR 205
                         250       260
                  ....*....|....*....|....*..
gi 218437596  380 SIGRQAADQEMMIEGVAIDITETKKTQ 406
Cdd:COG2202   206 ISPVRDDGEIVGVVGIARDITERKQAE 232
PRK10060 PRK10060
RNase II stability modulator; Provisional
929-1468 5.76e-124

RNase II stability modulator; Provisional


Pssm-ID: 236645 [Multi-domain]  Cd Length: 663  Bit Score: 403.68  E-value: 5.76e-124
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  929 ILIHAEDGEIIQVNHAWTELTGYTHEDIptIADWTEKAYGERKEIV--RSVIDELYKiDGKVEEGEFTITIKTGEtRIWN 1006
Cdd:PRK10060  124 IVILDSRGNIQRFNRLCEEYTGLKEHDV--IGQSVFKLFMSRREAAasRRNIRGFFR-SGNAYEVERWIKTRKGQ-RLFL 199
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1007 FSSAPL--GRLADNRRLIMSmALDITERKQAEEQLRHAAVHDQLTGLPNRILLLDRIEQAIKRTQQEEkylFALLFIDLD 1084
Cdd:PRK10060  200 FRNKFVhsGSGKNEIFLICS-GTDITEERRAQERLRILANTDSITGLPNRNAIQELIDHAINAADNNQ---VGIVYLDLD 275
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1085 RFKVVNDSLGHWVGDQLLGAIADKLKACVRPMDTVARFGGDEFVILLENlTSRTEATKMAQQITDELRSSFCLQGQDFFI 1164
Cdd:PRK10060  276 NFKKVNDAYGHMFGDQLLQDVSLAILSCLEEDQTLARLGGDEFLVLASH-TSQAALEAMASRILTRLRLPFRIGLIEVYT 354
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1165 SVSIGITFPSSYEESASELLRNADIAMYRAKEKGRARYTIFDSKMHIQATRLLELETNLRLALEREELIVHYQPIVSLtT 1244
Cdd:PRK10060  355 GCSIGIALAPEHGDDSESLIRSADTAMYTAKEGGRGQFCVFSPEMNQRVFEYLWLDTNLRKALENDQLVIHYQPKITW-R 433
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1245 GKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGEWVLLESCRQMKAWQKEfsGLDkIRVSVNLSGKQLEYPHLI 1324
Cdd:PRK10060  434 GEVRSLEALVRWQSPERGLIPPLEFISYAEESGLIVPLGRWVMLDVVRQVAKWRDK--GIN-LRVAVNVSARQLADQTIF 510
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1325 NCLESILKQTGLEGKNLKLEITESMLMNNKEVVSDLLLQIKGKNIQISIDDFGTGYSSLSYLHYLPVDTLKIDRSFVNRM 1404
Cdd:PRK10060  511 TALKQALQELNFEYCPIDVELTESCLIENEELALSVIQQFSQLGAQVHLDDFGTGYSSLSQLARFPIDAIKLDQSFVRDI 590
                         490       500       510       520       530       540
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 218437596 1405 TQLGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQLGCESGQGYFFSKPLDSQKVTSWF 1468
Cdd:PRK10060  591 HKQPVSQSLVRAIVAVAQALNLQVIAEGVETAKEDAFLTKNGVNERQGFLFAKPMPAVAFERWY 654
COG5001 COG5001
Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain ...
1006-1462 9.38e-101

Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain [Signal transduction mechanisms]


Pssm-ID: 227334 [Multi-domain]  Cd Length: 663  Bit Score: 338.02  E-value: 9.38e-101
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1006 NFSSAPLGRLADNRRLimsmalDITERKQAEEQLrhAAVHDQLTGLPNRILLLDRIEQAIKRTQQEEKYlFALLFIDLDR 1085
Cdd:COG5001   199 EFSDMVQSQVTLTQRA------EETRRLSDENDR--LANLDSLTGLPNRRRFFAELDARLAAARQSGRR-LVLGVIDLDG 269
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1086 FKVVNDSLGHWVGDQLLGAIADKLKA-CVRPMdTVARFGGDEFVILLENLTSRTEATKMAQQITDELRSSFCLQGQDFFI 1164
Cdd:COG5001   270 FKPVNDAFGHATGDRLLIEVGRRLKAfDGAPI-LAARLGGDEFALIIPALEDDALRVAGARALCESLQAPYDLRGVRVQV 348
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1165 SVSIGITFPSSYEESASELLRNADIAMYRAKEKGRARYTIFDSKMHIQATRLLELETNLRLALEREELIVHYQPIVSLTT 1244
Cdd:COG5001   349 GASIGIAPFPSGADTSEQLFERADYALYHAKQNGKGAAVLFDARHEAAIRDMAVVEQALRSADLEQELSVHFQPIVDIVS 428
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1245 GKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGEWVLLESCRQMKAWQkefsglDKIRVSVNLSGKQLEYPHLI 1324
Cdd:COG5001   429 GKTIALEALARWHSPEIGPVPPDVFIGIAERSGQIVELTRLLLAKALREARAWP------MDVRVSINLSARDLASMENV 502
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1325 NCLESILKQTGLEGKNLKLEITESMLMNNKEVVSDLLLQIKGKNIQISIDDFGTGYSSLSYLHYLPVDTLKIDRSFVNRM 1404
Cdd:COG5001   503 RRLLAIVSESCIAPHRLDFEITETAIVCDFDQARDALAALHELGVRTALDDFGTGYSSLSHLRALPLDKIKIDRSFVSDL 582
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 218437596 1405 TQLGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQLGCESGQGYFFSKPLDSQ 1462
Cdd:COG5001   583 EENPTSEDIVRTVLQLGRNLRMECVVEGVETEAQRDRVAALGATVMQGYHYARPMPAE 640
PRK13561 PRK13561
putative diguanylate cyclase; Provisional
1033-1459 3.03e-78

putative diguanylate cyclase; Provisional


Pssm-ID: 184143 [Multi-domain]  Cd Length: 651  Bit Score: 273.51  E-value: 3.03e-78
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1033 KQAEEQLRHAaVHDQLTGLPNRILLLDRIEQAIKRTQQeekylFALLFIDLDRFKVVNDSLGHWVGDQLLGAIADKLKAC 1112
Cdd:PRK13561  222 RQYEEQSRNA-TRFPVSDLPNKALLMALLEQVVARKQT-----TALMIITCETLRDTAGVLKEAQREILLLTLVEKLKSV 295
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1113 VRPMDTVARFGGDEFVILLENLTSRTEATKMAQQITDELRSSFCLQGQDFFISVSIGItfpSSYE--ESASELLRNADIA 1190
Cdd:PRK13561  296 LSPRMVLAQISGYDFAIIANGVKEPWHAITLGQQVLTIINERLPIQRIQLRPSCSIGI---AMFYgdLTAEQLYSRAISA 372
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1191 MYRAKEKGRARYTIFDSKMHIQATRLLELETNLRLALEREELIVHYQPIVSLTTGKLLGFEALVRWEHPKKGLISPGEFI 1270
Cdd:PRK13561  373 AFTARRKGKNQIQFFDPQQMEAAQKRLTEESDILNALENHQFAIWLQPQVEMRSGKLVSAEALLRMQQPDGSWDLPEGLI 452
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1271 PIAEETGLIIPLGEWVLLESCRQMKAWQKEFSGLDkirVSVNLSGKQLEYPHLINCLESILKQTGLEGKNLKLEITESML 1350
Cdd:PRK13561  453 DRIESCGLMVTVGHWVLEESCRLLAAWQERGIMLP---LSVNLSALQLMHPNMVADMLELLTRYRIQPGTLILEVTESRR 529
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1351 MNNKEVVSDLLLQIKGKNIQISIDDFGTGYSSLSYLHY---LPVDTLKIDRSFVnrmTQLGENFEIVEAIINLAHHLQMD 1427
Cdd:PRK13561  530 IDDPHAAVAILRPLRNAGVRVALDDFGMGYAGLRQLQHmksLPIDVLKIDKMFV---DGLPEDDSMVAAIIMLAQSLNLQ 606
                         410       420       430
                  ....*....|....*....|....*....|..
gi 218437596 1428 VVAEGVETEQHIKQLKQLGCESGQGYFFSKPL 1459
Cdd:PRK13561  607 VIAEGVETEAQRDWLLKAGVGIAQGFLFARAL 638
PRK09776 PRK09776
putative diguanylate cyclase; Provisional
445-1458 1.92e-74

putative diguanylate cyclase; Provisional


Pssm-ID: 182070 [Multi-domain]  Cd Length: 1092  Bit Score: 269.62  E-value: 1.92e-74
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  445 KIFGWKEEEVVGKGWQewQFVYEEDLDLIVAKVSEIIKKETSRHFVTNRNYTKTGEIIDCKWYNSVQYDQSGEILSILSL 524
Cdd:PRK09776  314 QFLGYSQEELRGLTFQ--QLTWPEDLNKDLQQVEKLLSGEINSYSMEKRYYRRDGEVVWALLAVSLVRDTDGTPLYFIAQ 391
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  525 VLDVSEQKRAEAALQVSQERLQLALEGSGDSIWEWNLQTGEIYcdqswWQKLGYE----PDHETMSYEWWRSQVAPEFLP 600
Cdd:PRK09776  392 IEDINELKRTEQVNERLMERITLANEAGGIGIWEWDLKPNIIS-----WDKRMFElyeiPPHIKPTWQVWYACLHPEDRQ 466
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  601 IHEASLQDYLAGKTEYlTLEYKIQSSSG-DWVwmsargKSVAN---DEEGNPLKIVGTHRDITESKEIEEELkqqgellq 676
Cdd:PRK09776  467 RVEKEIRDALQGRSPF-KLEFRIVVKDGvRHI------RALANrvlNKDGEVERLLGINMDMTEVRQLNEAL-------- 531
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  677 tivdyipvmlayidpnynflwvNEEFERiLGWSLEEIKNlnilAQLYPDPDERQYVMNYIqsAEEKwedfktrlrngtti 756
Cdd:PRK09776  532 ----------------------FQEKER-LHITLDSIGE----AVVCTDMAMKVTFMNPV--AEKM-------------- 568
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  757 dTSWANVklsngaiIGIGQDItvrkhieealresEQKYRLLFyanpnplwvydvktlaflEVNQAAIEhygySREEFLgM 836
Cdd:PRK09776  569 -TGWTQE-------EALGVPL-------------LTVLHITF------------------GDNGPLME----NIYSCL-T 604
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  837 TLRDIRPSEDVKIletyianinpsfnrsgywQHRksNGEIIDVeitshgiefagrqarlvlvnditeqlkaqqklQESEn 916
Cdd:PRK09776  605 SRSAAYLEQDVVL------------------HCR--SGGSYDV--------------------------------HYSI- 631
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  917 rfrravidAPLPILihaeDGEIIqvnhawteltgythediptiadwtekaygerkeivrsvidelykidGKVeegeftit 996
Cdd:PRK09776  632 --------TPLSTL----DGENI----------------------------------------------GSV-------- 645
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  997 iktgetriwnfssaplgrladnrrLIMSmalDITERKQAEEQLRHAAVHDQLTGLPNRI---LLLDRIEQAIKRTQQEEk 1073
Cdd:PRK09776  646 ------------------------LVIQ---DVTESRKMLRQLSYSASHDALTHLANRAsfeKQLRRLLQTVNSTHQRH- 697
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1074 ylfALLFIDLDRFKVVNDSLGHWVGDQLLGAIADKLKACVRPMDTVARFGGDEFVILLENLTSrTEATKMAQQITDELRS 1153
Cdd:PRK09776  698 ---ALVFIDLDRFKAVNDSAGHAAGDALLRELASLMLSMLRSSDVLARLGGDEFGLLLPDCNV-ESARFIATRIISAIND 773
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1154 -SFCLQGQDFFISVSIGITFPSSYEESASELLRNADIAMYRAKEKGRARYTI--FDSKMHIQATRLLELETNLRLALERE 1230
Cdd:PRK09776  774 yHFPWEGRVYRVGASAGITLIDANNHQASEVMSQADIACYAAKNAGRGRVTVyePQQAAAHSEHRALSLAEQWRMIKENQ 853
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1231 ELIVHYQPIVSLTTGKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGEWVLLESCRQmkawQKEFSGLDKIRVS 1310
Cdd:PRK09776  854 LMMLAHGVASPRIPEARNHWLISLRLWDPEGEIIDEGAFRPAAEDPALMHALDRRVIHEFFRQ----AAKAVASKGLSIA 929
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1311 VNLSGKQLEYPHLINCLESILKQTGLEGKNLKLEITESMLMNNKEVVSDLLLQIKGKNIQISIDDFGTGYSSLSYLHYLP 1390
Cdd:PRK09776  930 LPLSVAGLSSPTLLPFLLEQLENSPLPPRLLHLEITETALLNHAESASRLVQKLRLAGCRVVLSDFGRGLSSFNYLKAFM 1009
                         970       980       990      1000      1010      1020      1030
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 218437596 1391 VDTLKIDRSFVnrmTQLGENF---EIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQLGCESGQGYFFSKP 1458
Cdd:PRK09776 1010 ADYLKLDGELV---ANLHGNLmdeMLISIIQGHAQRLGMKTIAGPVELPLVLDTLSGIGVDLAYGYAIARP 1077
PRK11829 PRK11829
biofilm formation regulator HmsP; Provisional
1049-1459 2.71e-71

biofilm formation regulator HmsP; Provisional


Pssm-ID: 183329 [Multi-domain]  Cd Length: 660  Bit Score: 253.33  E-value: 2.71e-71
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1049 TGLPNRILLLDRIEQAIkrTQQEEKYLFALLFIDLDRFKVVNDSLGHWVGDQLLGAIADKLKACVRPMDTVARFGGDEFV 1128
Cdd:PRK11829  238 TELPNRSLFISLLEKEI--ASSTRTDHFHLLVIGIETLQEVSGAMSEAQHQQLLLTIVQRIEQCIDDSDLLAQLSKTEFA 315
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1129 ILLENLTSRTEATKMAQQITDELRSSFCLQGQDFFISVSIGITFPSSYEESASELLRNADIAMYRAKEKGRARYTIFDSK 1208
Cdd:PRK11829  316 VLARGTRRSFPAMQLARRIMSQVTQPLFFDEITLRPSASIGITRYQAQQDTAESMMRNASTAMMAAHHEGRNQIMVFEPH 395
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1209 MHIQATRLLELETNLRLALEREELIVHYQPIVSLTTGKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGEWVLL 1288
Cdd:PRK11829  396 LIEKTHKRLTQENDLLQAIENHDFTLFLQPQWDMKRQQVIGAEALLRWCQPDGSYVLPSGFVHFAEEEGMMVPLGNWVLE 475
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1289 ESCRQMKAWQKEfsGLdKIRVSVNLSGKQLEYPHLINCLESILKQTGLEGKNLKLEITESMLMNNKEVVSDLLLQIKGKN 1368
Cdd:PRK11829  476 EACRILADWKAR--GV-SLPLSVNISGLQVQNKQFLPHLKTLISHYHIDPQQLLLEITETAQIQDLDEALRLLRELQGLG 552
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1369 IQISIDDFGTGYSSLSYLHY---LPVDTLKIDRSFVNrmtQLGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQL 1445
Cdd:PRK11829  553 LLIALDDFGIGYSSLRYLNHlksLPIHMIKLDKSFVK---NLPEDDAIARIISCVSDVLKVRVMAEGVETEEQRQWLLEH 629
                         410
                  ....*....|....
gi 218437596 1446 GCESGQGYFFSKPL 1459
Cdd:PRK11829  630 GIQCGQGFLFSPPL 643
COG4943 COG4943
Predicted signal transduction protein containing sensor and EAL domains [Signal transduction ...
1215-1471 2.38e-69

Predicted signal transduction protein containing sensor and EAL domains [Signal transduction mechanisms]


Pssm-ID: 227279 [Multi-domain]  Cd Length: 524  Bit Score: 244.26  E-value: 2.38e-69
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1215 RLLELETNLRLALEREELIVHYQPIVSLTTGKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGEWVLLESCRQM 1294
Cdd:COG4943   265 RYLSPRRRLQRAIERRELCVHYQPIVDLATGKCVGAEALARWPQEDGTVVSPDVFIPLAEESGMIEQITDYVIRNVFRDL 344
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1295 KAWQKEFSGLdkiRVSVNLSGKQLEYPHLINCLESILKQTGLEGKNLKLEITESMLMNNKEVvSDLLLQIKGKNIQISID 1374
Cdd:COG4943   345 GDLLRQHRDL---HVSINLSASDLASPRLIDRLNRKLAQYQVRPQQIALELTERTFADPKKM-TPIILRLREAGHEIYID 420
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1375 DFGTGYSSLSYLHYLPVDTLKIDRSFVNRMTQLGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQLGCESGQGYF 1454
Cdd:COG4943   421 DFGTGYSNLHYLQSLPVDALKIDKSFVDTLGTDSASHLIAPHIIEMAKSLGLKIVAEGVETEEQVDWLRKRGVHYGQGWL 500
                         250
                  ....*....|....*..
gi 218437596 1455 FSKPLDSQKVTSWFEKL 1471
Cdd:COG4943   501 FSKALPAQAFLDWAEQQ 517
PRK10551 PRK10551
phage resistance protein; Provisional
1225-1470 1.83e-40

phage resistance protein; Provisional


Pssm-ID: 182541 [Multi-domain]  Cd Length: 518  Bit Score: 158.23  E-value: 1.83e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1225 LALEREELIVHYQPIVSLTTGKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGEWVLLESCRQMKAWQKEFSGL 1304
Cdd:PRK10551  270 TGIKRGQFYVEYQPVVDTQTLRVTGLEALLRWRHPTAGEIPPDAFINYAEAQKLIVPLTQHLFELIARDAAELQKVLPVG 349
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1305 DKIrvSVNLSGKQLEYPHLINCLESILKQTGLEGKNLKLEITESMlMNNKEVVSDLLLQIKGKNIQISIDDFGTGYSSLS 1384
Cdd:PRK10551  350 AKL--GINISPAHLHSDSFKADVQRLLASLPADHFQIVLEITERD-MVQEEEATKLFAWLHSQGIEIAIDDFGTGHSALI 426
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1385 YLHYLPVDTLKIDRSFVNrmtQLGENF---EIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQLGCESGQGYFFSKPLDS 1461
Cdd:PRK10551  427 YLERFTLDYLKIDRGFIQ---AIGTETvtsPVLDAVLTLAKRLNMLTVAEGVETPEQARWLRERGVNFLQGYWISRPLPL 503

                  ....*....
gi 218437596 1462 QKVTSWFEK 1470
Cdd:PRK10551  504 EDFVRWLKE 512
PleD COG3706
Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal ...
953-1202 3.02e-39

Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms]


Pssm-ID: 226229 [Multi-domain]  Cd Length: 435  Bit Score: 153.25  E-value: 3.02e-39
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  953 HEDIPTIADWTEKayGERKEIV---RSVIDELYKIdgkVEEGEFTITIKTgetriwNFSSAPLgrladNRRLIMSMaldi 1029
Cdd:COG3706   204 TRDIPIILLSSKD--DDELVVRafeLGVNDYITKP---IEEGELRARLRR------QLRRKRY-----ERQLRESL---- 263
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1030 terkqaeEQLRHAAVHDQLTGLPNRILLLDRIEQAIKRTQqEEKYLFALLFIDLDRFKVVNDSLGHWVGDQLLGAIADKL 1109
Cdd:COG3706   264 -------ERLQELALVDGLTGLFNRRYFDEHLADLWKRAL-REGRPLSLLMLDIDDFKEINDTYGHDVGDEVLRQVARRL 335
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1110 KACVRPMDTVARFGGDEFVILLENlTSRTEATKMAQQITDELRSS-FCLQGQD--FFISVSIGITFPSSYEESASELLRN 1186
Cdd:COG3706   336 RQTVRGLDLVARYGGEEFAVVLPD-TDLEAAIAIAERIRQKINELpFVHELSRepLEVTISIGVAEGKPGEDSIEELLKR 414
                         250
                  ....*....|....*.
gi 218437596 1187 ADIAMYRAKEKGRARY 1202
Cdd:COG3706   415 ADKALYKAKASGRNRV 430
pleD PRK09581
response regulator PleD; Reviewed
1032-1201 1.01e-31

response regulator PleD; Reviewed


Pssm-ID: 236577 [Multi-domain]  Cd Length: 457  Bit Score: 130.02  E-value: 1.01e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1032 RKQAEEQLRHA-------AVHDQLTGLPNRILLLDRIEQAIKRTQQEEKYLfALLFIDLDRFKVVNDSLGHWVGDQLLGA 1104
Cdd:PRK09581  274 RKRYQDALRNNleqsiemAVTDGLTGLHNRRYFDMHLKNLIERANERGKPL-SLMMIDIDHFKKVNDTYGHDAGDEVLRE 352
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1105 IADKLKACVRPMDTVARFGGDEFVILLENlTSRTEATKMAQQITDELRSS-FCLQGQDFFISV--SIGITFPSSYEESAS 1181
Cdd:PRK09581  353 FAKRLRNNIRGTDLIARYGGEEFVVVMPD-TDIEDAIAVAERIRRKIAEEpFIISDGKERLNVtvSIGVAELRPSGDTIE 431
                         170       180
                  ....*....|....*....|
gi 218437596 1182 ELLRNADIAMYRAKEKGRAR 1201
Cdd:PRK09581  432 ALIKRADKALYEAKNTGRNR 451
PRK09894 PRK09894
diguanylate cyclase; Provisional
1017-1208 1.57e-28

diguanylate cyclase; Provisional


Pssm-ID: 182133 [Multi-domain]  Cd Length: 296  Bit Score: 118.25  E-value: 1.57e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1017 DNRRLIMSMALDITERkqaeEQLRHAAVHDQLTGLPNRILLLDRIEQAIKRTQQEEkylFALLFIDLDRFKVVNDSLGHW 1096
Cdd:PRK09894  107 QEGLLSFTAALTDYKI----YLLTIRSNMDVLTGLPGRRVLDESFDHQLRNREPQN---LYLALLDIDRFKLVNDTYGHL 179
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1097 VGDQLLGAIADKLKACVRPMDTVARFGGDEFVILLENlTSRTEATKMAQQITDEL-RSSFCLQGQDFFISVSIGITfPSS 1175
Cdd:PRK09894  180 IGDVVLRTLATYLASWTRDYETVYRYGGEEFIICLKA-ATDEEACRAGERIRQLIaNHAITHSDGRINITATFGVS-RAF 257
                         170       180       190
                  ....*....|....*....|....*....|...
gi 218437596 1176 YEESASELLRNADIAMYRAKEKGRARyTIFDSK 1208
Cdd:PRK09894  258 PEETLDVVIGRADRAMYEGKQTGRNR-VMFIDE 289
PRK11059 PRK11059
regulatory protein CsrD; Provisional
1024-1458 1.39e-24

regulatory protein CsrD; Provisional


Pssm-ID: 236833 [Multi-domain]  Cd Length: 640  Bit Score: 109.57  E-value: 1.39e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1024 SMALD--ITERKQAEEQ-------LRHAAVHDQLTGLPNRILLLDRIEqaikrTQQEEKYLFA----LLFIDLDRFKVVN 1090
Cdd:PRK11059  200 SRALDhlLSELQDAREErsrfdtfIRSNAFQDAKTGLGNRLFFDNQLA-----TLLEDQEMVGahgvVMLIRLPDFDLLQ 274
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1091 DSLGHWVGDQLLGAIADKLKACV-RPMDTV-ARFGGDEFVILLENLTSRtEATKMAQQ---ITDELRSSFCLQGQDFFis 1165
Cdd:PRK11059  275 EEWGESQVEELLFELINLLSTFVmRYPGALlARYSRSDFAVLLPHRSLK-EADSLASQllkAVDALPPPKMLDRDDFL-- 351
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1166 vSIGITFPSSyEESASELLRNADIAMYRAKEKGRARYTIFDSKMHIQATR-------LLELetnlrlALEREELIVHYQP 1238
Cdd:PRK11059  352 -HIGICAYRS-GQSTEQVMEEAEMALRSAQLQGGNGWFVYDKAQLPEKGRgsvrwrtLLEQ------TLVRGGPRLYQQP 423
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1239 IVsLTTGKLLGFEALVRWEHPKKGLISPGEFIPIAEETGLIIPLGEWVLLESCRQMKAWQKEfsgldkiRVSVNLSGKQL 1318
Cdd:PRK11059  424 AV-TRDGKVHHRELFCRIRDGQGELLSAELFMPMVQQLGLSEQYDRQVIERVLPLLRYWPEE-------NLSINLSVDSL 495
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1319 EYPHLINCLESILKQTG-LEGKNLKLEITESMLMNNKEVVSDLLLQIKGKNIQISIDDFGTGYSSLSYLHYLPVDTLKID 1397
Cdd:PRK11059  496 LSRAFQRWLRDTLLQCPrSQRKRLIFELAEADVCQHISRLRPVLRMLRGLGCRLAVDQAGLTVVSTSYIKELNVELIKLH 575
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 218437596 1398 RSFVNRMTQLGENFEIVEAIINLAHHLQMDVVAEGVETEQHIKQLKQLGCESGQGYFFSKP 1458
Cdd:PRK11059  576 PSLVRNIHKRTENQLFVRSLVGACAGTETQVFATGVESREEWQTLQELGVSGGQGDFFAES 636
PRK15426 PRK15426
putative diguanylate cyclase YedQ; Provisional
1037-1201 2.29e-24

putative diguanylate cyclase YedQ; Provisional


Pssm-ID: 237964 [Multi-domain]  Cd Length: 570  Bit Score: 108.18  E-value: 2.29e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1037 EQLRHAAVHDQLTGLPNRILLLDRIEQAIKRtQQEEKYLFALLFIDLDRFKVVNDSLGHWVGDQLLGAIADKLKACVRPM 1116
Cdd:PRK15426  392 SSLQWQAWHDPLTRLYNRGALFEKARALAKR-CQRDQQPFSVIQLDLDHFKSINDRFGHQAGDRVLSHAAGLISSSLRAQ 470
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1117 DTVARFGGDEFVILLENlTSRTEATKMAQQITDELRSSFCLQGQD--FFISVSIGItfpSSYEESAS----ELLRNADIA 1190
Cdd:PRK15426  471 DVAGRVGGEEFCVVLPG-ASLAEAAQVAERIRLRINEKEILVAKSttIRISASLGV---SSAEEDGDydfeQLQSLADRR 546
                         170
                  ....*....|.
gi 218437596 1191 MYRAKEKGRAR 1201
Cdd:PRK15426  547 LYLAKQAGRNR 557
PRK13560 PRK13560
hypothetical protein; Provisional
656-1042 2.07e-20

hypothetical protein; Provisional


Pssm-ID: 106506 [Multi-domain]  Cd Length: 807  Bit Score: 96.67  E-value: 2.07e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  656 RDITESKEIEEelKQQGEllQTIVDYIPVM--LAYIDPNYNFLW-----VNEEFERILGWSLEEIKNLniLAQLYPDPDE 728
Cdd:PRK13560   55 RAIAEAEAQDC--REQCE--RNLKANIPGGmfLFALDGDGTFSFpslldANGELAAIAKHDLMADKGL--LAMLIGGDDG 128
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  729 RQYVMNYIQSAE--------EKWEDFKTRLR--NGTTIDTSWANVKLSNGAII--GIGQDITVRKHIEEALRESEQKYRL 796
Cdd:PRK13560  129 DFFFANPFRSAEtiamalqsDDWQEEEGHFRcgDGRFIDCCLRFERHAHADDQvdGFAEDITERKRAEERIDEALHFLQQ 208
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  797 LFYANPNPLWvYDVKTLAFLEVNQAAIEHYGYSREEFLGMTLRDIRPSEDVKI-LETYIANINPSFNRSGYWQHRKSNGE 875
Cdd:PRK13560  209 LLDNIADPAF-WKDEDAKVFGCNDAACLACGFRREEIIGMSIHDFAPAQPADDyQEADAAKFDADGSQIIEAEFQNKDGR 287
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  876 IIDVEITSHGIEFAGRQARLV----LVNDITEQLKAQQKLQESENRFRRAVIDAPLPILIHAEDGEIIQVNHAWTE-LTG 950
Cdd:PRK13560  288 TRPVDVIFNHAEFDDKENHCAglvgAITDISGRRAAERELLEKEDMLRAIIEAAPIAAIGLDADGNICFVNNNAAErMLG 367
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  951 YTHEDIPTIADWTEKAYgERKEIVRSVIDELYKiDGK---VEEGEFTITIKTG------ETRIWNFSSAPLGRLA----- 1016
Cdd:PRK13560  368 WSAAEVMGKPLPGMDPE-LNEEFWCGDFQEWYP-DGRpmaFDACPMAKTIKGGkifdgqEVLIEREDDGPADCSAyaepl 445
                         410       420       430
                  ....*....|....*....|....*....|
gi 218437596 1017 --DNRRLIMSMAL--DITERKQAEEQLRHA 1042
Cdd:PRK13560  446 hdADGNIIGAIALlvDITERKQVEEQLLLA 475
PRK09966 PRK09966
putative inner membrane diguanylate cyclase; Provisional
1032-1204 2.01e-19

putative inner membrane diguanylate cyclase; Provisional


Pssm-ID: 182171 [Multi-domain]  Cd Length: 407  Bit Score: 91.22  E-value: 2.01e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1032 RKQAEE-QLRHAAVHDQLTGLPNRILLLDRIEQAIKRTQQEEKYlfALLFIDLDRFKVVNDSLGHWVGDQLLGAIADKLK 1110
Cdd:PRK09966  236 RLQAKNaQLLRTALHDPLTGLANRAAFRSGINTLMNNSDARKTS--ALLFLDGDNFKYINDTWGHATGDRVLIEIAKRLA 313
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1111 ACVRPMDTVARFGGDEFVILLENLTSRTEATKMAQQITDELRSSFCLQ-GQDFFISVSIGitFPSSYEESASELLRN-AD 1188
Cdd:PRK09966  314 EFGGLRHKAYRLGGDEFAMVLYDVQSESEVQQICSALTQIFNLPFDLHnGHQTTMTLSIG--YAMTIEHASAEKLQElAD 391
                         170
                  ....*....|....*.
gi 218437596 1189 IAMYRAKEKgRARYTI 1204
Cdd:PRK09966  392 HNMYQAKHQ-RAEKLV 406
AtoS COG2202
FOG: PAS/PAC domain [Signal transduction mechanisms]
815-1036 5.99e-19

FOG: PAS/PAC domain [Signal transduction mechanisms]


Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 87.98  E-value: 5.99e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  815 FLEVNQAAIEHYGYSREEFLGMTLRDIRPSEDVkILETYIANINPSFNRSGYWQHRKSNGEIIDVEITSHGI-EFAGRQA 893
Cdd:COG2202    11 IIYANEAAEELLGYSAEELLGLLLALHPEDRDR-LRELLRRLLAGEELLSEELRLVRKDGEERWVELSAAPLrDGEGRVL 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  894 RLVLVNDITEQLKAQQKLQESENRFRRAVIDAPLPILIHAEDGEIIQVNHAWTELTGYTHEDIPTIADWTEKAYGERKEI 973
Cdd:COG2202    90 GLLGLRDITERKRAEEALRESEERLRALLEASPDGIWVLDEDGRILYANPAAEELLGYSPEEELGRGLSDLIHPEDEERR 169
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 218437596  974 VRSVIDELYKIDGKVEEGEFTITIKTGETRIWNFSSAPLGRLADNRRLIMSMALDITERKQAE 1036
Cdd:COG2202   170 ELELARALAEGRGGPLEIEYRVRRKDGERVRWILSRISPVRDDGEIVGVVGIARDITERKQAE 232
adrA PRK10245
diguanylate cyclase AdrA; Provisional
1014-1201 2.10e-17

diguanylate cyclase AdrA; Provisional


Pssm-ID: 182329 [Multi-domain]  Cd Length: 366  Bit Score: 84.50  E-value: 2.10e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1014 RLADNRRLIMSMAlditerkqaeeqlrhaaVHDQLTGLPNR----ILLldRIEQAIKRTQQEEKylfALLFIDLDRFKVV 1089
Cdd:PRK10245  193 KLAEHKRRLQVMS-----------------TRDGMTGVYNRrhweTLL--RNEFDNCRRHHRDA---TLLIIDIDHFKSI 250
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1090 NDSLGHWVGDQLLGAIADKLKACVRPMDTVARFGGDEFVILLENLTSRTEATKMAqQITDELRSSFCLQGQDFFISVSIG 1169
Cdd:PRK10245  251 NDTWGHDVGDEAIVALTRQLQITLRGSDVIGRFGGDEFAVIMSGTPAESAITAMS-RVHEGLNTLRLPNAPQVTLRISVG 329
                         170       180       190
                  ....*....|....*....|....*....|..
gi 218437596 1170 ITFPSSYEESASELLRNADIAMYRAKEKGRAR 1201
Cdd:PRK10245  330 VAPLNPQMSHYREWLKSADLALYKAKNAGRNR 361
PRK13560 PRK13560
hypothetical protein; Provisional
277-790 6.34e-16

hypothetical protein; Provisional


Pssm-ID: 106506 [Multi-domain]  Cd Length: 807  Bit Score: 82.03  E-value: 6.34e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  277 RQAVEKALMESEAKYER-LVERLPAVIYQFS----PTKGKLYCSSYVKSILGYSTDEIDLP-WLWINSIHPEDLPKV--- 347
Cdd:PRK13560   55 RAIAEAEAQDCREQCERnLKANIPGGMFLFAldgdGTFSFPSLLDANGELAAIAKHDLMADkGLLAMLIGGDDGDFFfan 134
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  348 ----KEMIQEFVQGKNF-EIEYRVKDAQGQWHWILDRSigRQAADQEMMIEGVAIDITETKKTQMALQQAHQCLTFHVDN 422
Cdd:PRK13560  135 pfrsAETIAMALQSDDWqEEEGHFRCGDGRFIDCCLRF--ERHAHADDQVDGFAEDITERKRAEERIDEALHFLQQLLDN 212
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  423 SPLGVIEWDNDYRVKRWSSQAEKIFGWKEEEVVGKGWQEWQFVY------EEDLDLIVAKVSEIIKKEtsrhFVTNRNYT 496
Cdd:PRK13560  213 IADPAFWKDEDAKVFGCNDAACLACGFRREEIIGMSIHDFAPAQpaddyqEADAAKFDADGSQIIEAE----FQNKDGRT 288
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  497 KTGEIIdckwYNSVQY-DQSGEILSILSLVLDVSEQKRAEAALQVSQERLQ----------LALEGSGDSIWEWN----- 560
Cdd:PRK13560  289 RPVDVI----FNHAEFdDKENHCAGLVGAITDISGRRAAERELLEKEDMLRaiieaapiaaIGLDADGNICFVNNnaaer 364
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  561 ---LQTGEIYCDQSWWQKLGYEPDHETMSYEWWRSQVAPefLPIHEASLQDYLAGKTEYLTLEYKIQSSSGDWVWMSARG 637
Cdd:PRK13560  365 mlgWSAAEVMGKPLPGMDPELNEEFWCGDFQEWYPDGRP--MAFDACPMAKTIKGGKIFDGQEVLIEREDDGPADCSAYA 442
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  638 KSVaNDEEGNPLKIVGTHRDITESKEIEEELKQQgellQTIVDYIPVMLayidpnynFLWVNEEferilGWSLEEIKNlN 717
Cdd:PRK13560  443 EPL-HDADGNIIGAIALLVDITERKQVEEQLLLA----NLIVENSPLVL--------FRWKAEE-----GWPVELVSK-N 503
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  718 ILAQLY-PD--------------PDERQYVMNYI-----QSAEEKWEDFKTRLRNGTT--IDTSWANVKLSNGAII---G 772
Cdd:PRK13560  504 ITQFGYePDefisgkrmfaaiihPADLEQVAAEVaefaaQGVDRFEQEYRILGKGGAVcwIDDQSAAERDEEGQIShfeG 583
                         570
                  ....*....|....*...
gi 218437596  773 IGQDITVRKHIEEALRES 790
Cdd:PRK13560  584 IVIDISERKHAEEKIKAA 601
PRK13560 PRK13560
hypothetical protein; Provisional
620-1070 6.66e-15

hypothetical protein; Provisional


Pssm-ID: 106506 [Multi-domain]  Cd Length: 807  Bit Score: 78.56  E-value: 6.66e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  620 EYKIQSSSGDWVWMSARGKSVANDEEgnplKIVGTHRDITESKEIEEELKQQGELLQTIVDYIPVMLAYIDPNYNFLWVN 699
Cdd:PRK13560  155 EGHFRCGDGRFIDCCLRFERHAHADD----QVDGFAEDITERKRAEERIDEALHFLQQLLDNIADPAFWKDEDAKVFGCN 230
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  700 EEFERILGWSLEEIKNLNI--LAQLYP------------DPDERQYVMNYIQSAEEKWEDFKTRLrNGTTIDTSWANVKL 765
Cdd:PRK13560  231 DAACLACGFRREEIIGMSIhdFAPAQPaddyqeadaakfDADGSQIIEAEFQNKDGRTRPVDVIF-NHAEFDDKENHCAG 309
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  766 SNGAIigigQDITVRKHIEEALRESEQKYRLLFYANPNPLWVYDVKTLAFLEVNQAAIEHYGYSREEFLGMTLRDIRPSE 845
Cdd:PRK13560  310 LVGAI----TDISGRRAAERELLEKEDMLRAIIEAAPIAAIGLDADGNICFVNNNAAERMLGWSAAEVMGKPLPGMDPEL 385
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  846 DVKI----LETYIANINPSFNRSGYWQHRKSNGEIID-VEITSHGIE------------FAGRQARLV----LVNDITEQ 904
Cdd:PRK13560  386 NEEFwcgdFQEWYPDGRPMAFDACPMAKTIKGGKIFDgQEVLIEREDdgpadcsayaepLHDADGNIIgaiaLLVDITER 465
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  905 LKAQQKLQESEnrfrRAVIDAPLPIL-IHAEDG-EIIQVNHAWTELtGYTHEDIPT---------IADWTEKAYGERKEI 973
Cdd:PRK13560  466 KQVEEQLLLAN----LIVENSPLVLFrWKAEEGwPVELVSKNITQF-GYEPDEFISgkrmfaaiiHPADLEQVAAEVAEF 540
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  974 VRSVIDELykidgkveEGEFTITIKTGETRiWNFSSAPLGRLADNR-RLIMSMALDITERKQAEEQLRHAavhdqltgLP 1052
Cdd:PRK13560  541 AAQGVDRF--------EQEYRILGKGGAVC-WIDDQSAAERDEEGQiSHFEGIVIDISERKHAEEKIKAA--------LT 603
                         490
                  ....*....|....*...
gi 218437596 1053 NRILLLDRIEQAIKRTQQ 1070
Cdd:PRK13560  604 EKEVLLKEIHHRVKNNLQ 621
AtoS COG2202
FOG: PAS/PAC domain [Signal transduction mechanisms]
426-665 8.75e-15

FOG: PAS/PAC domain [Signal transduction mechanisms]


Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 74.89  E-value: 8.75e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  426 GVIEWDNDYRVKRWSSQAEKIFGWKEEEVVGkgwqeWQFVYEEDLDLIVAKVSEIIKKETSRHFVTNRNYTKTGEIIDCK 505
Cdd:COG2202     1 LILVLDRDGRIIYANEAAEELLGYSAEELLG-----LLLALHPEDRDRLRELLRRLLAGEELLSEELRLVRKDGEERWVE 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  506 WYNSVQYDQSGEILSILSLVlDVSEQKRAEAALQVSQERLQLALEGSGDSIWEWNLQTGEIYCDQSWWQKLGYEPDHETM 585
Cdd:COG2202    76 LSAAPLRDGEGRVLGLLGLR-DITERKRAEEALRESEERLRALLEASPDGIWVLDEDGRILYANPAAEELLGYSPEEELG 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  586 SYEWWRSQVAPEFLPIHEAsLQDYLAGKTEYLTLEYKIQSSSGD-WVWMSARGKSVANDeeGNPLKIVGTHRDITESKEI 664
Cdd:COG2202   155 RGLSDLIHPEDEERRELEL-ARALAEGRGGPLEIEYRVRRKDGErVRWILSRISPVRDD--GEIVGVVGIARDITERKQA 231

                  .
gi 218437596  665 E 665
Cdd:COG2202   232 E 232
PAS_3 pfam08447
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
311-379 1.94e-14

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 254805 [Multi-domain]  Cd Length: 90  Bit Score: 71.26  E-value: 1.94e-14
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 218437596   311 KLYCSSYVKSILGYSTDEIDLPW-LWINSIHPEDLPKVKEMIQEFV--QGKNFEIEYRVKDAQGQWHWILDR 379
Cdd:pfam08447    1 IIYWSPRFEEILGYTPEELKSSYeGWLDLVHPEDRERVRRALQELLlkKGEPYSGEYRIRRKDGSYRWVEAR 72
AtoS COG2202
FOG: PAS/PAC domain [Signal transduction mechanisms]
685-908 2.69e-14

FOG: PAS/PAC domain [Signal transduction mechanisms]


Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 73.34  E-value: 2.69e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  685 MLAYIDPNYNFLWVNEEFERILGWSLEEIKNLNILAQLYPDPDERQYVMNYIQSAEEKWEDFKTRLRNGTTIDTSWANVK 764
Cdd:COG2202     1 LILVLDRDGRIIYANEAAEELLGYSAEELLGLLLALHPEDRDRLRELLRRLLAGEELLSEELRLVRKDGEERWVELSAAP 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  765 LSNGAIIGIG----QDITVRKHIEEALRESEQKYRLLFYANPNPLWVYDVKTLaFLEVNQAAIEHYGYSREEFLGMTLRD 840
Cdd:COG2202    81 LRDGEGRVLGllglRDITERKRAEEALRESEERLRALLEASPDGIWVLDEDGR-ILYANPAAEELLGYSPEEELGRGLSD 159
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 218437596  841 IRPSED----VKILETYIANINPSFNRSGYWQHRKSNGEIIDVEITSHGIEFAGRQARLVLVN-DITEQLKAQ 908
Cdd:COG2202   160 LIHPEDeerrELELARALAEGRGGPLEIEYRVRRKDGERVRWILSRISPVRDDGEIVGVVGIArDITERKQAE 232
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
914-1039 2.29e-13

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator [Regulatory functions, Small molecule interactions].


Pssm-ID: 232884 [Multi-domain]  Cd Length: 124  Bit Score: 68.85  E-value: 2.29e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   914 SENRFRRAVIDAPLPILIHAEDGEIIQVNHAWTELTGYTHED-----IPTIADwtekayGERKEIVRSVIDELYKIDGKV 988
Cdd:TIGR00229    1 SEERYRAIFESSPDAIIVIDLEGNILYVNPAFEEIFGYSAEEligrnVLELIP------EEDREEVRERIERRLEGEREP 74
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|.
gi 218437596   989 EEGEFTITIKTGETRIWNFSSAPLgRLADNRRLIMSMALDITERKQAEEQL 1039
Cdd:TIGR00229   75 VSEERRVRRKDGSEIWVEVSVSPI-RTNGGELGVVGIVRDITERKQAEEAL 124
AtoS COG2202
FOG: PAS/PAC domain [Signal transduction mechanisms]
556-784 3.29e-13

FOG: PAS/PAC domain [Signal transduction mechanisms]


Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 69.88  E-value: 3.29e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  556 IWEWNLQTGEIYCDQSWWQKLGYEPDhetmSYEWWRSQVAPEFLPIHEASLQDYLAGKtEYLTLEYKIQSSSGDWVWMSA 635
Cdd:COG2202     2 ILVLDRDGRIIYANEAAEELLGYSAE----ELLGLLLALHPEDRDRLRELLRRLLAGE-ELLSEELRLVRKDGEERWVEL 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  636 RGKSVAnDEEGNPLKIVGtHRDITESKEIEEELKQQGELLQTIVDYIPVMLAYIDPNYNFLWVNEEFERILGWSLEEIKN 715
Cdd:COG2202    77 SAAPLR-DGEGRVLGLLG-LRDITERKRAEEALRESEERLRALLEASPDGIWVLDEDGRILYANPAAEELLGYSPEEELG 154
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 218437596  716 LNILAQLYPDPDERQYVMNYIQSAEEK----WEDFKTRLRNGTTIDTSWANVKLSNG-----AIIGIGQDITVRKHIE 784
Cdd:COG2202   155 RGLSDLIHPEDEERRELELARALAEGRggplEIEYRVRRKDGERVRWILSRISPVRDdgeivGVVGIARDITERKQAE 232
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
673-787 5.51e-13

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator [Regulatory functions, Small molecule interactions].


Pssm-ID: 232884 [Multi-domain]  Cd Length: 124  Bit Score: 68.08  E-value: 5.51e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   673 ELLQTIVDYIPVMLAYIDPNYNFLWVNEEFERILGWSLEEIKNLNILaQLYPDPDE---RQYVMNYIQSAEE-KWEDFKT 748
Cdd:TIGR00229    3 ERYRAIFESSPDAIIVIDLEGNILYVNPAFEEIFGYSAEELIGRNVL-ELIPEEDReevRERIERRLEGEREpVSEERRV 81
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*.
gi 218437596   749 RLRNGTTIdtsWANVKLS----NG---AIIGIGQDITVRKHIEEAL 787
Cdd:TIGR00229   82 RRKDGSEI---WVEVSVSpirtNGgelGVVGIVRDITERKQAEEAL 124
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
790-911 8.53e-13

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator [Regulatory functions, Small molecule interactions].


Pssm-ID: 232884 [Multi-domain]  Cd Length: 124  Bit Score: 67.31  E-value: 8.53e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   790 SEQKYRLLFYANPNPLWVYDVKTlAFLEVNQAAIEHYGYSREEFLGMTLRDIRPSEDVKILETYIANI---NPSFNRSGY 866
Cdd:TIGR00229    1 SEERYRAIFESSPDAIIVIDLEG-NILYVNPAFEEIFGYSAEELIGRNVLELIPEEDREEVRERIERRlegEREPVSEER 79
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*.
gi 218437596   867 WQHRKsNGEIIDVEITSHGIEFAGRQARLVL-VNDITEQLKAQQKL 911
Cdd:TIGR00229   80 RVRRK-DGSEIWVEVSVSPIRTNGGELGVVGiVRDITERKQAEEAL 124
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
420-538 2.60e-12

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator [Regulatory functions, Small molecule interactions].


Pssm-ID: 232884 [Multi-domain]  Cd Length: 124  Bit Score: 65.77  E-value: 2.60e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   420 VDNSPLGVIEWDNDYRVKRWSSQAEKIFGWKEEEVVGKGWqeWQFVYEEDLDLIVAKVSEIIKKETSRHFVTNRNYTKTG 499
Cdd:TIGR00229    9 FESSPDAIIVIDLEGNILYVNPAFEEIFGYSAEELIGRNV--LELIPEEDREEVRERIERRLEGEREPVSEERRVRRKDG 86
                           90       100       110
                   ....*....|....*....|....*....|....*....
gi 218437596   500 EIIDCKWyNSVQYDQSGEILSILSLVLDVSEQKRAEAAL 538
Cdd:TIGR00229   87 SEIWVEV-SVSPIRTNGGELGVVGIVRDITERKQAEEAL 124
AtoS COG2202
FOG: PAS/PAC domain [Signal transduction mechanisms]
119-249 5.90e-11

FOG: PAS/PAC domain [Signal transduction mechanisms]


Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 62.94  E-value: 5.90e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  119 LKKIKQALKKSRSRYRAIVEEQTELICRFRPDGTLTFVNEAYYRYFEKTPEYLLEKIFLPLIPFPDQQQVLDNLKSLNQQ 198
Cdd:COG2202   100 RKRAEEALRESEERLRALLEASPDGIWVLDEDGRILYANPAAEELLGYSPEEELGRGLSDLIHPEDEERRELELARALAE 179
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
gi 218437596  199 KRVITHEHRVIISSGEMRWHQWTNRAIVD--RQGKIIEFQAVGRDITELKQIE 249
Cdd:COG2202   180 GRGGPLEIEYRVRRKDGERVRWILSRISPvrDDGEIVGVVGIARDITERKQAE 232
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
129-252 1.94e-10

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator [Regulatory functions, Small molecule interactions].


Pssm-ID: 232884 [Multi-domain]  Cd Length: 124  Bit Score: 60.37  E-value: 1.94e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   129 SRSRYRAIVEEQTELICRFRPDGTLTFVNEAYYRYFEKTPEYLLEKIFLPLIPFPDQQQVLDNL-KSLNQQKRVITHEHR 207
Cdd:TIGR00229    1 SEERYRAIFESSPDAIIVIDLEGNILYVNPAFEEIFGYSAEELIGRNVLELIPEEDREEVRERIeRRLEGEREPVSEERR 80
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*
gi 218437596   208 VIISSGEMRWHQWTNRAIvDRQGKIIEFQAVGRDITELKQIETAL 252
Cdd:TIGR00229   81 VRRKDGSEIWVEVSVSPI-RTNGGELGVVGIVRDITERKQAEEAL 124
PRK09776 PRK09776
putative diguanylate cyclase; Provisional
149-457 2.88e-10

putative diguanylate cyclase; Provisional


Pssm-ID: 182070 [Multi-domain]  Cd Length: 1092  Bit Score: 63.92  E-value: 2.88e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  149 PDGTLTFVNEAYYRYFEKTPEYLLEKIFlPLIPFPDQ----QQVLDNLksLNQQKRVITHEHRVIISSGEMRWHQWTNRA 224
Cdd:PRK09776  301 TEGQWLQVNKALCQFLGYSQEELRGLTF-QQLTWPEDlnkdLQQVEKL--LSGEINSYSMEKRYYRRDGEVVWALLAVSL 377
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  225 IVDRQGKIIEFQAVGRDITELKQIEtalrELNEELEQRVeqrTLQLEAQ---IQERQaVEKALMESEAKYERLVERLPAV 301
Cdd:PRK09776  378 VRDTDGTPLYFIAQIEDINELKRTE----QVNERLMERI---TLANEAGgigIWEWD-LKPNIISWDKRMFELYEIPPHI 449
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  302 iyqfSPTkgklycssyvksilgystdeidlPWLWINSIHPEDLPKVKEMIQEFVQG-KNFEIEYRVKDAQGQwHWIldRS 380
Cdd:PRK09776  450 ----KPT-----------------------WQVWYACLHPEDRQRVEKEIRDALQGrSPFKLEFRIVVKDGV-RHI--RA 499
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  381 IGRQAADQEMMIE---GVAIDITETKKTQMALQQAHQCLTFHVDNSPLGVIEWDNDYRVKRWSSQAEKIFGWKEEEVVGK 457
Cdd:PRK09776  500 LANRVLNKDGEVErllGINMDMTEVRQLNEALFQEKERLHITLDSIGEAVVCTDMAMKVTFMNPVAEKMTGWTQEEALGV 579
PRK13560 PRK13560
hypothetical protein; Provisional
274-541 5.24e-10

hypothetical protein; Provisional


Pssm-ID: 106506 [Multi-domain]  Cd Length: 807  Bit Score: 62.77  E-value: 5.24e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  274 IQERQAVEKALMESEAKYERLVERLPAVIYQFSpTKGKL--YCSSYVKSILGYSTDEIDLPWLW--------------IN 337
Cdd:PRK13560  317 ISGRRAAERELLEKEDMLRAIIEAAPIAAIGLD-ADGNIcfVNNNAAERMLGWSAAEVMGKPLPgmdpelneefwcgdFQ 395
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  338 SIHPEDLPKVKE---MIQEFVQGKNFE-IEYRVKDAQGQWhwiLDRSI-GRQAADQEMMIEG---VAIDITETKKTQMAL 409
Cdd:PRK13560  396 EWYPDGRPMAFDacpMAKTIKGGKIFDgQEVLIEREDDGP---ADCSAyAEPLHDADGNIIGaiaLLVDITERKQVEEQL 472
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  410 QQAHqcltFHVDNSPLGVIEW--DNDYRVKRWSSQAEKiFGWKEEEVVGKGWQEWQFVYEEDLDLIVAKVSEIIKKETSR 487
Cdd:PRK13560  473 LLAN----LIVENSPLVLFRWkaEEGWPVELVSKNITQ-FGYEPDEFISGKRMFAAIIHPADLEQVAAEVAEFAAQGVDR 547
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....
gi 218437596  488 HFVTNRNYTKTGEIIDCKWYNSVQYDQSGEILSILSLVLDVSEQKRAEAALQVS 541
Cdd:PRK13560  548 FEQEYRILGKGGAVCWIDDQSAAERDEEGQISHFEGIVIDISERKHAEEKIKAA 601
PAS_9 pfam13426
PAS domain;
424-530 7.86e-10

PAS domain;


Pssm-ID: 257751 [Multi-domain]  Cd Length: 104  Bit Score: 58.16  E-value: 7.86e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   424 PLGVIEWDNDYRVKRWSSQAEKIFGWKEEEVVGKGWqeWQFVYEEDLDLIVAKVSEIIKKETSRHFVTnRNYTKTGEIID 503
Cdd:pfam13426    1 PDGILVLDPEGRIVYANPAALRLLGYTREELLGKSI--RDLFGPGTDEEAVARLREALRNGGEVEVEL-ELRRKDGEPFP 77
                           90       100
                   ....*....|....*....|....*..
gi 218437596   504 CKWYNSVQYDQSGEILSILSLVLDVSE 530
Cdd:pfam13426   78 VLVSASPVRDEDGEVVGIVGILRDITE 104
PAS_4 pfam08448
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
137-247 2.30e-09

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 254806 [Multi-domain]  Cd Length: 110  Bit Score: 56.65  E-value: 2.30e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   137 VEEQTELICRFRPDGTLTFVNEAYYRYFEKTPEYLLEKIFLPLIPFPDQQQVLDNL-KSLNQQKRVITHEHRViiSSGEM 215
Cdd:pfam08448    1 LDSLPDALAVLDPDGRVRYANAAAAELFGLPPEELLGKTLAELLPPEDAARLERALrRALEGEEPIDFLEELL--LNGEE 78
                           90       100       110
                   ....*....|....*....|....*....|..
gi 218437596   216 RWHQWTNRAIVDRQGKIIEFQAVGRDITELKQ 247
Cdd:pfam08448   79 RHYELRLTPLRDPDGEVIGVLVISRDITERRR 110
PAS_9 pfam13426
PAS domain;
149-244 5.61e-09

PAS domain;


Pssm-ID: 257751 [Multi-domain]  Cd Length: 104  Bit Score: 55.47  E-value: 5.61e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   149 PDGTLTFVNEAYYRYFEKTPEYLLEKIFLPLIPFPDQQQVLDNLKSLNQQKRVITHEHRVIISSGEMRWHQWTNRAIVDR 228
Cdd:pfam13426    9 PEGRIVYANPAALRLLGYTREELLGKSIRDLFGPGTDEEAVARLREALRNGGEVEVELELRRKDGEPFPVLVSASPVRDE 88
                           90
                   ....*....|....*.
gi 218437596   229 QGKIIEFQAVGRDITE 244
Cdd:pfam13426   89 DGEVVGIVGILRDITE 104
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
541-668 1.83e-08

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator [Regulatory functions, Small molecule interactions].


Pssm-ID: 232884 [Multi-domain]  Cd Length: 124  Bit Score: 54.21  E-value: 1.83e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   541 SQERLQLALEGSGDSIWEWNLQTGEIYCDQSWWQKLGYEPDhETMSYEWWrSQVAPEFLPIHEASLQDYLAGKTEYLTLE 620
Cdd:TIGR00229    1 SEERYRAIFESSPDAIIVIDLEGNILYVNPAFEEIFGYSAE-ELIGRNVL-ELIPEEDREEVRERIERRLEGEREPVSEE 78
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 218437596   621 YKIQSSSGDWVWMSARGKSVanDEEGNPLKIVGTHRDITESKEIEEEL 668
Cdd:TIGR00229   79 RRVRRKDGSEIWVEVSVSPI--RTNGGELGVVGIVRDITERKQAEEAL 124
nifL_nitrog TIGR02938
nitrogen fixation negative regulator NifL; NifL is a modulator of the nitrogen fixation ...
643-725 9.36e-08

nitrogen fixation negative regulator NifL; NifL is a modulator of the nitrogen fixation positive regulator protein NifA, and is therefore a negative regulator. It binds NifA. NifA and NifL are encoded by adjacent genes [Central intermediary metabolism, Nitrogen fixation, Regulatory functions, Protein interactions].


Pssm-ID: 131984 [Multi-domain]  Cd Length: 494  Bit Score: 54.91  E-value: 9.36e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   643 DEEGNPLKIVGTHRDITESKEIEEELKQQGELLQTIVDYIPVMLAYIDPNYNFLWVNEEFERILGWSLEEIKNLNILAQL 722
Cdd:TIGR02938  100 NEAGETTHFLGMHRDITELHRLEQVVANQKLLIESVVDAAPVAFVLLDPTGRVILDNQEYKKLATDLRVKEPAHTVLDLL 179

                   ...
gi 218437596   723 YPD 725
Cdd:TIGR02938  180 REA 182
PAS_9 pfam13426
PAS domain;
802-903 1.03e-07

PAS domain;


Pssm-ID: 257751 [Multi-domain]  Cd Length: 104  Bit Score: 51.62  E-value: 1.03e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   802 PNPLWVYDVKTLaFLEVNQAAIEHYGYSREEFLGMTLRDI-RPSEDVKILETYIANINPSFNRSGYWQHRKSNGEIIDVE 880
Cdd:pfam13426    1 PDGILVLDPEGR-IVYANPAALRLLGYTREELLGKSIRDLfGPGTDEEAVARLREALRNGGEVEVELELRRKDGEPFPVL 79
                           90       100
                   ....*....|....*....|....*
gi 218437596   881 ITSHGIEFAGRQAR--LVLVNDITE 903
Cdd:pfam13426   80 VSASPVRDEDGEVVgiVGILRDITE 104
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
287-409 2.26e-07

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator [Regulatory functions, Small molecule interactions].


Pssm-ID: 232884 [Multi-domain]  Cd Length: 124  Bit Score: 50.74  E-value: 2.26e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   287 SEAKYERLVERLPAVIYQFSPtKGK-LYCSSYVKSILGYSTDE-IDLPWLWInsIHPEDLPKVKEMIQEFVQGKN--FEI 362
Cdd:TIGR00229    1 SEERYRAIFESSPDAIIVIDL-EGNiLYVNPAFEEIFGYSAEElIGRNVLEL--IPEEDREEVRERIERRLEGERepVSE 77
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*..
gi 218437596   363 EYRVKDAQGQWHWILDRSIGRQAADQEMMIEGVAIDITETKKTQMAL 409
Cdd:TIGR00229   78 ERRVRRKDGSEIWVEVSVSPIRTNGGELGVVGIVRDITERKQAEEAL 124
PAS pfam00989
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
673-777 4.80e-07

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 250275 [Multi-domain]  Cd Length: 111  Bit Score: 49.70  E-value: 4.80e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   673 ELLQTIVDYIPVMLAYIDPNYNFLWVNEEFERILGWSLEEIKNLNILAQLYPDPDERQYVMNYIQSAEEKWEDFKTRLR- 751
Cdd:pfam00989    1 EDLRAILESLPDGIFVVDEDGRILYVNAAAEELLGLSREEVIGKSLLDLIPEEDDAVAELLRQALLQGEESRGFEVSFRv 80
                           90       100       110
                   ....*....|....*....|....*....|....
gi 218437596   752 -NGTTIdtsWANVKLS-------NGAIIGIGQDI 777
Cdd:pfam00989   81 rDGRPR---HVEVRASpvrdaggEIGFLGVLRDI 111
PpsR-CrtJ TIGR02040
transcriptional regulator PpsR; This model represents the transcriptional regulator PpsR which ...
785-1032 6.85e-07

transcriptional regulator PpsR; This model represents the transcriptional regulator PpsR which is strictly associated with photosynthetic proteobacteria and found in photosynthetic operons. PpsR has been reported to be a repressor. These proteins contain a Helix-Turn_Helix motif of the "fis" type (pfam02954) [Energy metabolism, Photosynthesis].


Pssm-ID: 233697 [Multi-domain]  Cd Length: 442  Bit Score: 52.13  E-value: 6.85e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   785 EALRESEQKYRLLFYANPNPLWVYDVKTLAFLEVNQAAIEHYGYSREEFLGMTLRDIRPSEDVKILETYIANINPsfnrs 864
Cdd:TIGR02040  126 WTLREMETRYRVVLEVSSDAVLLVDMSTGRIVEANSAAAALLGGVGQSLVGRAFPQEFEGRRREELMLTLRNVRA----- 200
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   865 gywQHRKSNGEIIDVEiTSHGIEFAGRQARLVLVNDITEQL---KAQQKLQ-ESENRFRRAVIDAPLPILIHAEDGEIIQ 940
Cdd:TIGR02040  201 ---TGSAAPVRILLRR-SQKRLLVVVSVFRQDGESLFLCQLspaGATQPVGdELSENLARLYHEAPDAIVFSDADGTIRG 276
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   941 VNHAWTELTGYTHEDI---PTIADWTEKAYGERKEIVRSVidelyKIDGKVEEGEFTITIKTGETRIWNFSSAPLGRlaD 1017
Cdd:TIGR02040  277 ANEAFLELTDSSSLEAvrgRTLDRWLGRGGVDLRVLLSNV-----RRTGQVRLYATTLTGEFGAQTEVEISAAWVDQ--G 349
                          250
                   ....*....|....*
gi 218437596  1018 NRRLIMSMALDITER 1032
Cdd:TIGR02040  350 ERPLIVLVIRDISRR 364
COG3434 COG3434
Predicted signal transduction protein containing EAL and modified HD-GYP domains [Signal ...
1350-1458 1.22e-06

Predicted signal transduction protein containing EAL and modified HD-GYP domains [Signal transduction mechanisms]


Pssm-ID: 225968 [Multi-domain]  Cd Length: 407  Bit Score: 51.26  E-value: 1.22e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596 1350 LMNNKEVVSDLLLQIKG---KNIQISIDDFgTGYSSLSYLHYLP-VDTLKIDrsfVNRMTqlgenFEIVEAIINLAHHLQ 1425
Cdd:COG3434    90 ILEDCPPTEKLLSAIKElkqKGYLLALDDF-IFSNVSEWKPLLPlSDIVKID---FKRVT-----FDKARLFDRDLGYIN 160
                          90       100       110
                  ....*....|....*....|....*....|...
gi 218437596 1426 MDVVAEGVETEQHIKQLKQLGCESGQGYFFSKP 1458
Cdd:COG3434   161 KKFLAEKVETEEEFEQAKKAGFDLFQGYFFSKP 193
PAS_9 pfam13426
PAS domain;
926-1031 6.53e-06

PAS domain;


Pssm-ID: 257751 [Multi-domain]  Cd Length: 104  Bit Score: 46.22  E-value: 6.53e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   926 PLPILIHAEDGEIIQVNHAWTELTGYTHEDIPTIaDWTEKAYGERKEIVRSVIDELYKiDGKVEEGEFTITIKTGETRIW 1005
Cdd:pfam13426    1 PDGILVLDPEGRIVYANPAALRLLGYTREELLGK-SIRDLFGPGTDEEAVARLREALR-NGGEVEVELELRRKDGEPFPV 78
                           90       100
                   ....*....|....*....|....*.
gi 218437596  1006 NFSSAPLGRLADNRRLIMSMALDITE 1031
Cdd:pfam13426   79 LVSASPVRDEDGEVVGIVGILRDITE 104
PAS_4 pfam08448
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
420-533 6.70e-06

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 254806 [Multi-domain]  Cd Length: 110  Bit Score: 46.25  E-value: 6.70e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   420 VDNSPLGVIEWDNDYRVKRWSSQAEKIFGWKEEEVVGKGWQEwqFVYEEDLDLIVAKVSEIIKKETSRHFVTNRNYTKTG 499
Cdd:pfam08448    1 LDSLPDALAVLDPDGRVRYANAAAAELFGLPPEELLGKTLAE--LLPPEDAARLERALRRALEGEEPIDFLEELLLNGEE 78
                           90       100       110
                   ....*....|....*....|....*....|....
gi 218437596   500 EIIDCKwYNSVqYDQSGEILSILSLVLDVSEQKR 533
Cdd:pfam08448   79 RHYELR-LTPL-RDPDGEVIGVLVISRDITERRR 110
PAS pfam00989
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
792-901 9.36e-06

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 250275 [Multi-domain]  Cd Length: 111  Bit Score: 45.85  E-value: 9.36e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   792 QKYRLLFYANPNPLWVYDVKTLaFLEVNQAAIEHYGYSREEFLGMTLRDIRPSED---VKILETYIANINPSFNRSGYWq 868
Cdd:pfam00989    1 EDLRAILESLPDGIFVVDEDGR-ILYVNAAAEELLGLSREEVIGKSLLDLIPEEDdavAELLRQALLQGEESRGFEVSF- 78
                           90       100       110
                   ....*....|....*....|....*....|....
gi 218437596   869 hRKSNGEIIDVEITSHGIEFAGRQARLVLV-NDI 901
Cdd:pfam00989   79 -RVRDGRPRHVEVRASPVRDAGGEIGFLGVlRDI 111
PAS_9 pfam13426
PAS domain;
683-778 1.00e-05

PAS domain;


Pssm-ID: 257751 [Multi-domain]  Cd Length: 104  Bit Score: 45.45  E-value: 1.00e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   683 PVMLAYIDPNYNFLWVNEEFERILGWSLEEIKNLNILAQLYPDPDERQYVMNYIQSAEEKWEDFKTRLR--NGTTIDTSW 760
Cdd:pfam13426    1 PDGILVLDPEGRIVYANPAALRLLGYTREELLGKSIRDLFGPGTDEEAVARLREALRNGGEVEVELELRrkDGEPFPVLV 80
                           90       100
                   ....*....|....*....|...
gi 218437596   761 --ANVKLSNGA---IIGIGQDIT 778
Cdd:pfam13426   81 saSPVRDEDGEvvgIVGILRDIT 103
PAS_4 pfam08448
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
679-781 1.55e-05

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 254806 [Multi-domain]  Cd Length: 110  Bit Score: 45.10  E-value: 1.55e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   679 VDYIPVMLAYIDPNYNFLWVNEEFERILGWSLEEIKNLnILAQLYPDPDeRQYVMNYIQSA---EEKWEDFKTRLRNGTT 755
Cdd:pfam08448    1 LDSLPDALAVLDPDGRVRYANAAAAELFGLPPEELLGK-TLAELLPPED-AARLERALRRAlegEEPIDFLEELLLNGEE 78
                           90       100       110
                   ....*....|....*....|....*....|.
gi 218437596   756 --IDTSWANVKLSNGAIIG---IGQDITVRK 781
Cdd:pfam08448   79 rhYELRLTPLRDPDGEVIGvlvISRDITERR 109
PRK13558 PRK13558
bacterio-opsin activator; Provisional
444-550 3.78e-05

bacterio-opsin activator; Provisional


Pssm-ID: 237426 [Multi-domain]  Cd Length: 665  Bit Score: 46.75  E-value: 3.78e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  444 EKIFGWKEEEVVGKgwqEWQFVYEEDLDLI-VAKVSEIIKKETSRHfVTNRNYTKTGEiidcKWYNSVQ----YDQSGEI 518
Cdd:PRK13558  181 ERITGYSPDEVLGR---NCRFLQGEDTNEErVAELREAIDEERPTS-VELRNYRKDGS----TFWNQVDiapiRDEDGTV 252
                          90       100       110
                  ....*....|....*....|....*....|..
gi 218437596  519 LSILSLVLDVSEQKRAEAALQVSQERLQLALE 550
Cdd:PRK13558  253 THYVGFQTDVTERKEAELALQRERRKLQRLLE 284
RocR COG3829
Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains ...
643-792 3.81e-05

Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]


Pssm-ID: 226350 [Multi-domain]  Cd Length: 560  Bit Score: 46.53  E-value: 3.81e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596  643 DEEGNPLKIVGTHRDITESKE-IEEELKQQGELLQTIVDYIPVMLAYIDPNYNFLWVNEEFERILGWSLEEI--KNLNIL 719
Cdd:COG3829    86 DEQGRVVGVLEVFLDISEALElIEENLRQLRQRLEAILDSIDDGLLVVDEDGIIIYYNKAYAKLLGLSPEEVlgKHLLDV 165
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 218437596  720 AQLYPDPderqYVMNYIQSAEEKWEDFKTRLRNGTTIDTSWanVKlSNGAIIG---IGQDITVRKHIEEALRESEQ 792
Cdd:COG3829   166 VSAGEDS----TLLEVLRTGKPIRDVVQTYNGNKIIVNVAP--VY-ADGQLIGvvgISKDVSELERLTRELEESEG 234
PAS_3 pfam08447
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
439-525 4.00e-05

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 254805 [Multi-domain]  Cd Length: 90  Bit Score: 43.52  E-value: 4.00e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   439 WSSQAEKIFGWKEEEVVGkGWQEW-QFVYEEDLDLIVAKVSEIIKKETSRHFVTNRNYTKTGEIIDCKWYNSVQYDQSGE 517
Cdd:pfam08447    4 WSPRFEEILGYTPEELKS-SYEGWlDLVHPEDRERVRRALQELLLKKGEPYSGEYRIRRKDGSYRWVEARGRPIRDENGK 82

                   ....*...
gi 218437596   518 ILSILSLV 525
Cdd:pfam08447   83 PVRVIGVA 90
PAS pfam00989
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
916-1029 1.22e-04

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 250275 [Multi-domain]  Cd Length: 111  Bit Score: 42.39  E-value: 1.22e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   916 NRFRRAVIDAPLPILIHAEDGEIIQVNHAWTELTGYTHEDI--PTIADwtekAYGERKEIVRSVIDELYKIDGKVEEGEF 993
Cdd:pfam00989    1 EDLRAILESLPDGIFVVDEDGRILYVNAAAEELLGLSREEVigKSLLD----LIPEEDDAVAELLRQALLQGEESRGFEV 76
                           90       100       110
                   ....*....|....*....|....*....|....*.
gi 218437596   994 TITIKTGETRIWNFSSAPLgRLADNRRLIMSMALDI 1029
Cdd:pfam00989   77 SFRVRDGRPRHVEVRASPV-RDAGGEIGFLGVLRDI 111
PAS_3 pfam08447
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
154-238 1.40e-04

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 254805 [Multi-domain]  Cd Length: 90  Bit Score: 41.98  E-value: 1.40e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   154 TFVNEAYYRYFEKTPEYLLEKI--FLPLIPFPDQQQVLDNL-KSLNQQKRVITHEHRVIISSGEMRWHQWTNRAIVDRQG 230
Cdd:pfam08447    2 IYWSPRFEEILGYTPEELKSSYegWLDLVHPEDRERVRRALqELLLKKGEPYSGEYRIRRKDGSYRWVEARGRPIRDENG 81

                   ....*...
gi 218437596   231 KIIEFQAV 238
Cdd:pfam08447   82 KPVRVIGV 89
PAS pfam00989
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
132-242 4.49e-04

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 250275 [Multi-domain]  Cd Length: 111  Bit Score: 40.46  E-value: 4.49e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218437596   132 RYRAIVEEQTELICRFRPDGTLTFVNEAYYRYFEKTPEYLLEKIFLPLIPfPDQQQVLDNLKS-LNQQKRVITHEHRVII 210
Cdd:pfam00989    2 DLRAILESLPDGIFVVDEDGRILYVNAAAEELLGLSREEVIGKSLLDLIP-EEDDAVAELLRQaLLQGEESRGFEVSFRV 80
                           90       100       110
                   ....*....|....*....|....*....|..
gi 218437596   211 SSGEMRWHQWTNRAIVDRQGKiIEFQAVGRDI 242
Cdd:pfam00989   81 RDGRPRHVEVRASPVRDAGGE-IGFLGVLRDI 111
<