NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|21225653|ref|NP_631432|]
View 

hypothetical protein SCO7380 [Streptomyces coelicolor A3(2)]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
239-433 1.75e-45

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


:

Pssm-ID: 284611  Cd Length: 190  Bit Score: 157.41  E-value: 1.75e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225653   239 ETTLHVAVLDAMGHDLASGLTTTVSLAACRNARRTGADLPELVRSVDEALSSWLP-DKFCTSVIAQLDLVTGVLRWANCG 317
Cdd:pfam07228   1 DGRVALVIGDVMGHGLPAALLMGMLRTALRALAAEGLDPAEVLKRLNRLLQRNLEeDMFATAVLAVYDPETGTLEYANAG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225653   318 HPAPILIRDQRLVIdAMERDADPPMGMpslLSPHARRTHEISLEPGDRVLMYTDGVVEARTREAKLLGLERFADYVIRAT 397
Cdd:pfam07228  81 HPPPLLLRPDGGVV-ELLESTGLPLGI---LPDADYEVVELELEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAERH 156
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 21225653   398 agGELAPESLRRLIHSILAMQEGRLRDDATLLMFEW 433
Cdd:pfam07228 157 --GLPPEELLDALLEALLRLGGGELEDDITLLVLRV 190
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
239-433 1.75e-45

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 284611  Cd Length: 190  Bit Score: 157.41  E-value: 1.75e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225653   239 ETTLHVAVLDAMGHDLASGLTTTVSLAACRNARRTGADLPELVRSVDEALSSWLP-DKFCTSVIAQLDLVTGVLRWANCG 317
Cdd:pfam07228   1 DGRVALVIGDVMGHGLPAALLMGMLRTALRALAAEGLDPAEVLKRLNRLLQRNLEeDMFATAVLAVYDPETGTLEYANAG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225653   318 HPAPILIRDQRLVIdAMERDADPPMGMpslLSPHARRTHEISLEPGDRVLMYTDGVVEARTREAKLLGLERFADYVIRAT 397
Cdd:pfam07228  81 HPPPLLLRPDGGVV-ELLESTGLPLGI---LPDADYEVVELELEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAERH 156
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 21225653   398 agGELAPESLRRLIHSILAMQEGRLRDDATLLMFEW 433
Cdd:pfam07228 157 --GLPPEELLDALLEALLRLGGGELEDDITLLVLRV 190
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
223-391 8.79e-24

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 97.42  E-value: 8.79e-24
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225653    223 EPAYEIGGDAFD-HALTETTLHVAVLDAMGHDLASGLTTTVSLAACRNARRTGADLPELVRSVDEALSS-WLPDKFCTSV 300
Cdd:smart00331  11 EDATQVGGDFYDvVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYEnGEDGMFATLF 90
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225653    301 IAQLDLVTGVLRWANCGHPAPILIRDQ-RLVIDAmeRDADPPMGMPSLLSPharRTHEISLEPGDRVLMYTDGVVEARTR 379
Cdd:smart00331  91 LALYDFAGGTLSYANAGHSPPYLLRADgGLVEDL--DDLGAPLGLEPDVEV---DVRELTLEPGDLLLLYTDGLTEARNP 165
                          170
                   ....*....|..
gi 21225653    380 EAKLLGLERFAD 391
Cdd:smart00331 166 ERLEELLEELLG 177
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, ...
194-429 2.13e-25

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, Transcription];


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 105.18  E-value: 2.13e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225653 194 RMTLPAEMLRALL----PPRTIGNGNVVSTavlePAYEIGGDAFDH-ALTETTLHVAVLDAMGHDLASGLtttvSLAACR 268
Cdd:COG2208 127 ELEVARQIQQNLLpkalPLFPGIDIEAILV----PASEVGGDYYDFiQLGEKRLRIGIGDVSGKGVPAAL----LMLMPK 198
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225653 269 NARRT-----GADLPELVRSVDEALSSWLP-DKFCTSVIAQLDLVTGVLRWANCGHPAPILIRD--QRLVIDAMERDadP 340
Cdd:COG2208 199 LALRLllesgPLDPADVLETLNRVLKQNLEeDMFVTLFLGVYDLDSGELTYSNAGHEPALILSAdgEIEVEDLTALG--L 276
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225653 341 PMGMPSLLSPharRTHEISLEPGDRVLMYTDGVVEARTREAKLLGLERFADYVIRATagGELAPESLRRLIHSILAMQEG 420
Cdd:COG2208 277 PIGLLPDYQY---EVASLQLEPGDLLVLYTDGVTEARNSDGEFFGLERLLKILGRLL--GQPAEEILEAILESLEELQGD 351
                       250
                ....*....|
gi 21225653 421 RL-RDDATLL 429
Cdd:COG2208 352 QIqDDDITLL 361
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
239-433 1.75e-45

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 284611  Cd Length: 190  Bit Score: 157.41  E-value: 1.75e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225653   239 ETTLHVAVLDAMGHDLASGLTTTVSLAACRNARRTGADLPELVRSVDEALSSWLP-DKFCTSVIAQLDLVTGVLRWANCG 317
Cdd:pfam07228   1 DGRVALVIGDVMGHGLPAALLMGMLRTALRALAAEGLDPAEVLKRLNRLLQRNLEeDMFATAVLAVYDPETGTLEYANAG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225653   318 HPAPILIRDQRLVIdAMERDADPPMGMpslLSPHARRTHEISLEPGDRVLMYTDGVVEARTREAKLLGLERFADYVIRAT 397
Cdd:pfam07228  81 HPPPLLLRPDGGVV-ELLESTGLPLGI---LPDADYEVVELELEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAERH 156
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 21225653   398 agGELAPESLRRLIHSILAMQEGRLRDDATLLMFEW 433
Cdd:pfam07228 157 --GLPPEELLDALLEALLRLGGGELEDDITLLVLRV 190
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
223-391 8.79e-24

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 97.42  E-value: 8.79e-24
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225653    223 EPAYEIGGDAFD-HALTETTLHVAVLDAMGHDLASGLTTTVSLAACRNARRTGADLPELVRSVDEALSS-WLPDKFCTSV 300
Cdd:smart00331  11 EDATQVGGDFYDvVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYEnGEDGMFATLF 90
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225653    301 IAQLDLVTGVLRWANCGHPAPILIRDQ-RLVIDAmeRDADPPMGMPSLLSPharRTHEISLEPGDRVLMYTDGVVEARTR 379
Cdd:smart00331  91 LALYDFAGGTLSYANAGHSPPYLLRADgGLVEDL--DDLGAPLGLEPDVEV---DVRELTLEPGDLLLLYTDGLTEARNP 165
                          170
                   ....*....|..
gi 21225653    380 EAKLLGLERFAD 391
Cdd:smart00331 166 ERLEELLEELLG 177
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, ...
194-429 2.13e-25

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, Transcription];


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 105.18  E-value: 2.13e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225653 194 RMTLPAEMLRALL----PPRTIGNGNVVSTavlePAYEIGGDAFDH-ALTETTLHVAVLDAMGHDLASGLtttvSLAACR 268
Cdd:COG2208 127 ELEVARQIQQNLLpkalPLFPGIDIEAILV----PASEVGGDYYDFiQLGEKRLRIGIGDVSGKGVPAAL----LMLMPK 198
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225653 269 NARRT-----GADLPELVRSVDEALSSWLP-DKFCTSVIAQLDLVTGVLRWANCGHPAPILIRD--QRLVIDAMERDadP 340
Cdd:COG2208 199 LALRLllesgPLDPADVLETLNRVLKQNLEeDMFVTLFLGVYDLDSGELTYSNAGHEPALILSAdgEIEVEDLTALG--L 276
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225653 341 PMGMPSLLSPharRTHEISLEPGDRVLMYTDGVVEARTREAKLLGLERFADYVIRATagGELAPESLRRLIHSILAMQEG 420
Cdd:COG2208 277 PIGLLPDYQY---EVASLQLEPGDLLVLYTDGVTEARNSDGEFFGLERLLKILGRLL--GQPAEEILEAILESLEELQGD 351
                       250
                ....*....|
gi 21225653 421 RL-RDDATLL 429
Cdd:COG2208 352 QIqDDDITLL 361
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH