NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|21225295|ref|NP_631074|]
View 

hypothetical protein SCO7009 [Streptomyces coelicolor A3(2)]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
HATPase_c cd00075
Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: ...
503-562 1.97e-05

Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins


:

Pssm-ID: 238030  Cd Length: 103  Bit Score: 43.02  E-value: 1.97e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295 503 VVSELVGNALRYGNAPG---ELRLLRH-ERLSVEVSDSGP-----DLPQI-----QHADVSDESGRGL------QLINMM 562
Cdd:cd00075   4 VLLNLLSNAIKHTPEGGgriTISVERDgDHLEIRVEDNGPgipeeDLERIferfsDGSRSRKGGGTGLglsivkKLVELH 83
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
274-454 4.78e-44

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


:

Pssm-ID: 254114  Cd Length: 192  Bit Score: 155.91  E-value: 4.78e-44
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295   274 PSGRTALMVGDVMGRGLAAAATMGRLRTVARTLMALDIAPERLLARLD-LAARDLEEDQVATCLCAVYDPYGNTFRIASA 352
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNrALQRNLEGERFATAVLAVYDPETGTLEYANA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295   353 GHPPPLLTGPDGAVSFLDVPAGAPLG-TGVIPYDPVERPVPELSRLTLYTDGLIRSRTADLGT-QLERLREAVGGGVPED 430
Cdd:pfam07228  81 GHPPPLLLRPDGGVVELLESPGLPLGvLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGELfGLERLLALLAERHGLS 160
                         170       180
                  ....*....|....*....|....*....
gi 21225295   431 GTE-CRAVAERV----GGDRSDDAIVLAA 454
Cdd:pfam07228 161 PEElLDALLEDLlrlgGGELEDDITLLVL 189
GAF smart00065
Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these ...
135-227 2.36e-08

Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these domains in PDE6B result in autosomal recessive inheritance of retinitis pigmentosa.


:

Pssm-ID: 214500  Cd Length: 149  Bit Score: 52.38  E-value: 2.36e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295    135 LTTRRPVLVSRMTRADFAVIAPSressdiMRRAGVHSYLAVPLIARGVLLGLADFVRAGHRAPFNRTDVALAMELASKAA 214
Cdd:smart00065  63 AETGRPLNIPDVEADPLFAEDLL------GRYQGVRSFLAVPLVADGELVGVLALHNKKSPRPFTEEDEELLQALANQLA 136
                           90
                   ....*....|...
gi 21225295    215 VCIDNARLYGRER 227
Cdd:smart00065 137 IALANAQLYEELR 149
 
Name Accession Description Interval E-value
HATPase_c cd00075
Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: ...
503-562 1.97e-05

Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins


Pssm-ID: 238030  Cd Length: 103  Bit Score: 43.02  E-value: 1.97e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295 503 VVSELVGNALRYGNAPG---ELRLLRH-ERLSVEVSDSGP-----DLPQI-----QHADVSDESGRGL------QLINMM 562
Cdd:cd00075   4 VLLNLLSNAIKHTPEGGgriTISVERDgDHLEIRVEDNGPgipeeDLERIferfsDGSRSRKGGGTGLglsivkKLVELH 83
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
274-454 4.78e-44

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 155.91  E-value: 4.78e-44
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295   274 PSGRTALMVGDVMGRGLAAAATMGRLRTVARTLMALDIAPERLLARLD-LAARDLEEDQVATCLCAVYDPYGNTFRIASA 352
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNrALQRNLEGERFATAVLAVYDPETGTLEYANA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295   353 GHPPPLLTGPDGAVSFLDVPAGAPLG-TGVIPYDPVERPVPELSRLTLYTDGLIRSRTADLGT-QLERLREAVGGGVPED 430
Cdd:pfam07228  81 GHPPPLLLRPDGGVVELLESPGLPLGvLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGELfGLERLLALLAERHGLS 160
                         170       180
                  ....*....|....*....|....*....
gi 21225295   431 GTE-CRAVAERV----GGDRSDDAIVLAA 454
Cdd:pfam07228 161 PEElLDALLEDLlrlgGGELEDDITLLVL 189
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
248-424 1.46e-41

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 148.65  E-value: 1.46e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295    248 LAVTSCYDPAADPAAVGGDWFDVVALPSGRTALMVGDVMGRGLAAAATMGRLRTVARTLMALDIAPERLLARLDLAARDL 327
Cdd:smart00331   1 DDGGLIAQYYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYEN 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295    328 EED-QVATCLCAVYDPYGNTFRIASAGHPPPLLTGPDG-AVSFLDVPaGAPLGTGV-IPYDPVERPVPELSRLTLYTDGL 404
Cdd:smart00331  81 GEDgMFATLFLALYDFAGGTLSYANAGHSPPYLLRADGgLVEDLDDL-GAPLGLEPdVEVDVRELTLEPGDLLLLYTDGL 159
                          170       180
                   ....*....|....*....|
gi 21225295    405 IRSRTADLGtqLERLREAVG 424
Cdd:smart00331 160 TEARNPERL--EELLEELLG 177
HATPase_c_2 pfam13581
Histidine kinase-like ATPase domain;
470-578 4.87e-13

Histidine kinase-like ATPase domain;


Pssm-ID: 257897  Cd Length: 126  Bit Score: 66.50  E-value: 4.87e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295   470 LPPDGKAAGQARTAVREQLERWGL-QELVDTTELVVSELVGNALRYGNAPGELRLLR------HERLSVEVSDSGP--DL 540
Cdd:pfam13581   1 FPADLEALRAARRFVAAFLARAGLsEERLEEIELAVEEALTNAVEHAYREDPGGPVRvrleidGDGLVVEVRDSGPgfDP 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 21225295   541 PQIQHADVSD-----ESGRGLQLINMMCRRWGSCRTPDGKVVW 578
Cdd:pfam13581  81 LELPDPDLTEpddlpEGGRGLFLIRQLMDEVEYERGDGGNVLR 123
GAF smart00065
Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these ...
135-227 2.36e-08

Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these domains in PDE6B result in autosomal recessive inheritance of retinitis pigmentosa.


Pssm-ID: 214500  Cd Length: 149  Bit Score: 52.38  E-value: 2.36e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295    135 LTTRRPVLVSRMTRADFAVIAPSressdiMRRAGVHSYLAVPLIARGVLLGLADFVRAGHRAPFNRTDVALAMELASKAA 214
Cdd:smart00065  63 AETGRPLNIPDVEADPLFAEDLL------GRYQGVRSFLAVPLVADGELVGVLALHNKKSPRPFTEEDEELLQALANQLA 136
                           90
                   ....*....|...
gi 21225295    215 VCIDNARLYGRER 227
Cdd:smart00065 137 IALANAQLYEELR 149
GAF pfam01590
GAF domain; This domain is present in cGMP-specific phosphodiesterases, adenylyl and guanylyl ...
80-217 2.54e-08

GAF domain; This domain is present in cGMP-specific phosphodiesterases, adenylyl and guanylyl cyclases, phytochromes, FhlA and NifA. Adenylyl and guanylyl cyclases catalyse ATP and GTP to the second messengers cAMP and cGMP, respectively, these products up-regulating catalytic activity by binding to the regulatory GAF domain(s). The opposite hydrolysis reaction is catalysed by phosphodiesterase. cGMP-dependent 3',5'-cyclic phosphodiesterase catalyses the conversion of guanosine 3',5'-cyclic phosphate to guanosine 5'-phosphate. Here too, cGMP regulates catalytic activity by GAF-domain binding. Phytochromes are regulatory photoreceptors in plants and bacteria which exist in two thermally-stable states that are reversibly inter-convertible by light: the Pr state absorbs maximally in the red region of the spectrum, while the Pfr state absorbs maximally in the far-red region. This domain is also found in FhlA (formate hydrogen lyase transcriptional activator) and NifA, a transcriptional activator which is required for activation of most Nif operons which are directly involved in nitrogen fixation. NifA interacts with sigma-54.


Pssm-ID: 250726  Cd Length: 146  Bit Score: 52.59  E-value: 2.54e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295    80 LLDSVLRFQEGDRVSGGgAPRLRAMAVSEVEGLNLAPDPVGELSVHTADRLGQRCLTTRRPVLVSRMTR-ADFAVIAPSR 158
Cdd:pfam01590   9 ILEELRELLGADRVAIY-LADADGLLLYLVAGDGLSDIPLAARGLPLGGGVVGEVIAGGNPIVVPDVQDdPRFRDLTALA 87
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295   159 E-SSDIMRRAGVHSYLAVPLIARGVLLGLADFVRAGHRaPFNRTDVALAMELASKAAVCI 217
Cdd:pfam01590  88 SdLPHFLRGLGIRSCLAVPLKGGGELIGVLVLHSTSPR-AFTEEELELLQALADQVAIAL 146
HATPase_c smart00387
Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.
503-562 1.95e-05

Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.


Pssm-ID: 214643  Cd Length: 111  Bit Score: 43.41  E-value: 1.95e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295    503 VVSELVGNALRYGNAPGELRL---LRHERLSVEVSDSGP-----DLPQIQHA------DVSDESGRGL------QLINMM 562
Cdd:smart00387   9 VLSNLLDNAIKYTPEGGRITVtleRDGDHVEITVEDNGPgippeDLEKIFEPffrtdkRSRKIGGTGLglsivkKLVELH 88
FhlA COG2203
FOG: GAF domain [Signal transduction mechanisms]
166-227 2.20e-05

FOG: GAF domain [Signal transduction mechanisms]


Pssm-ID: 225113  Cd Length: 175  Bit Score: 43.81  E-value: 2.20e-05
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 21225295 166 RAGVHSYLAVPLIARGVLLGLADFVRAGHRAPFNRTDVALAMELASKAAVCIDNARLYGRER 227
Cdd:COG2203 111 EPPIRSYLGVPLIAQGELLGLLCVHDSEPRRQWSEEELELLEELAEQVAIAIERARLYEELQ 172
RsbW COG2172
Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms]
470-560 3.21e-04

Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms]


Pssm-ID: 225083  Cd Length: 146  Bit Score: 40.05  E-value: 3.21e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295 470 LPPDGKAAGQARTAVREQLER--WGLQELVDTtELVVSELVGNALRYGNA----PGELRLLRH---ERLSVEVSDSGPDL 540
Cdd:COG2172  10 LPAKLSAVGTARLTLREFARElgLTYVDIADL-AIAVSEALTNAVKHAYKldpsEGEIRIEVSlddGKLEIRIWDQGPGI 88
                        90       100
                ....*....|....*....|....*...
gi 21225295 541 PQIQH--------ADVSDESGRGLQLIN 560
Cdd:COG2172  89 EDLEEslgpgdttAEGLQEGGLGLFLAK 116
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
170-455 2.04e-26

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 110.18  E-value: 2.04e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295 170 HSYLAVPLIARGVLLGLADFVRAghrapfNRTDVALAMEL--ASKAAVCIDNA--RLYGRER---DHVVT----LQRALL 238
Cdd:COG2208  66 FLPVEVLLGVSGKLRALSEEIKH------WRGGLPLVAELlvEINRAVGLVSAhnELLLLEQnniSAELEvarqIQQNLL 139
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295 239 PRSSPSTPGLAVTSCYDPAAdpaAVGGDWFDVVALPSGRTALMVGDVMGRGLAAAATMGRLRTVARTLMALDIA-PERLL 317
Cdd:COG2208 140 PKALPLFPGIDIEAILVPAS---EVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLESGPLdPADVL 216
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295 318 ARLDLAAR-DLEEDQVATCLCAVYDPYGNTFRIASAGHPPPLLTGPDGAVSFLDVPA-GAPLGTGV-IPYDPVERPVPEL 394
Cdd:COG2208 217 ETLNRVLKqNLEEDMFVTLFLGVYDLDSGELTYSNAGHEPALILSADGEIEVEDLTAlGLPIGLLPdYQYEVASLQLEPG 296
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 21225295 395 SRLTLYTDGLIRSRTAD---LGtqLERLREAVGGGVPEDGTE-CRAVAERV----GGDRSDDAIVLAAL 455
Cdd:COG2208 297 DLLVLYTDGVTEARNSDgefFG--LERLLKILGRLLGQPAEEiLEAILESLeelqGDQIQDDDITLLVL 363
envZ PRK09467
osmolarity sensor protein; Provisional
503-559 5.33e-03

osmolarity sensor protein; Provisional


Pssm-ID: 236531 [Multi-domain]  Cd Length: 435  Bit Score: 37.97  E-value: 5.33e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 21225295  503 VVSELVGNALRYGNapGELRLL---RHERLSVEVSDSGPDLP--QIQH----------ADVSDESGRGLQLI 559
Cdd:PRK09467 335 ALANLVVNAARYGN--GWIKVSsgtEGKRAWFQVEDDGPGIPpeQLKHlfqpftrgdsARGSSGTGLGLAIV 404
 
Name Accession Description Interval E-value
HATPase_c cd00075
Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: ...
503-562 1.97e-05

Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins


Pssm-ID: 238030  Cd Length: 103  Bit Score: 43.02  E-value: 1.97e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295 503 VVSELVGNALRYGNAPG---ELRLLRH-ERLSVEVSDSGP-----DLPQI-----QHADVSDESGRGL------QLINMM 562
Cdd:cd00075   4 VLLNLLSNAIKHTPEGGgriTISVERDgDHLEIRVEDNGPgipeeDLERIferfsDGSRSRKGGGTGLglsivkKLVELH 83
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
274-454 4.78e-44

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 155.91  E-value: 4.78e-44
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295   274 PSGRTALMVGDVMGRGLAAAATMGRLRTVARTLMALDIAPERLLARLD-LAARDLEEDQVATCLCAVYDPYGNTFRIASA 352
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNrALQRNLEGERFATAVLAVYDPETGTLEYANA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295   353 GHPPPLLTGPDGAVSFLDVPAGAPLG-TGVIPYDPVERPVPELSRLTLYTDGLIRSRTADLGT-QLERLREAVGGGVPED 430
Cdd:pfam07228  81 GHPPPLLLRPDGGVVELLESPGLPLGvLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGELfGLERLLALLAERHGLS 160
                         170       180
                  ....*....|....*....|....*....
gi 21225295   431 GTE-CRAVAERV----GGDRSDDAIVLAA 454
Cdd:pfam07228 161 PEElLDALLEDLlrlgGGELEDDITLLVL 189
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
248-424 1.46e-41

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 148.65  E-value: 1.46e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295    248 LAVTSCYDPAADPAAVGGDWFDVVALPSGRTALMVGDVMGRGLAAAATMGRLRTVARTLMALDIAPERLLARLDLAARDL 327
Cdd:smart00331   1 DDGGLIAQYYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYEN 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295    328 EED-QVATCLCAVYDPYGNTFRIASAGHPPPLLTGPDG-AVSFLDVPaGAPLGTGV-IPYDPVERPVPELSRLTLYTDGL 404
Cdd:smart00331  81 GEDgMFATLFLALYDFAGGTLSYANAGHSPPYLLRADGgLVEDLDDL-GAPLGLEPdVEVDVRELTLEPGDLLLLYTDGL 159
                          170       180
                   ....*....|....*....|
gi 21225295    405 IRSRTADLGtqLERLREAVG 424
Cdd:smart00331 160 TEARNPERL--EELLEELLG 177
HATPase_c_2 pfam13581
Histidine kinase-like ATPase domain;
470-578 4.87e-13

Histidine kinase-like ATPase domain;


Pssm-ID: 257897  Cd Length: 126  Bit Score: 66.50  E-value: 4.87e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295   470 LPPDGKAAGQARTAVREQLERWGL-QELVDTTELVVSELVGNALRYGNAPGELRLLR------HERLSVEVSDSGP--DL 540
Cdd:pfam13581   1 FPADLEALRAARRFVAAFLARAGLsEERLEEIELAVEEALTNAVEHAYREDPGGPVRvrleidGDGLVVEVRDSGPgfDP 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 21225295   541 PQIQHADVSD-----ESGRGLQLINMMCRRWGSCRTPDGKVVW 578
Cdd:pfam13581  81 LELPDPDLTEpddlpEGGRGLFLIRQLMDEVEYERGDGGNVLR 123
GAF smart00065
Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these ...
135-227 2.36e-08

Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these domains in PDE6B result in autosomal recessive inheritance of retinitis pigmentosa.


Pssm-ID: 214500  Cd Length: 149  Bit Score: 52.38  E-value: 2.36e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295    135 LTTRRPVLVSRMTRADFAVIAPSressdiMRRAGVHSYLAVPLIARGVLLGLADFVRAGHRAPFNRTDVALAMELASKAA 214
Cdd:smart00065  63 AETGRPLNIPDVEADPLFAEDLL------GRYQGVRSFLAVPLVADGELVGVLALHNKKSPRPFTEEDEELLQALANQLA 136
                           90
                   ....*....|...
gi 21225295    215 VCIDNARLYGRER 227
Cdd:smart00065 137 IALANAQLYEELR 149
GAF pfam01590
GAF domain; This domain is present in cGMP-specific phosphodiesterases, adenylyl and guanylyl ...
80-217 2.54e-08

GAF domain; This domain is present in cGMP-specific phosphodiesterases, adenylyl and guanylyl cyclases, phytochromes, FhlA and NifA. Adenylyl and guanylyl cyclases catalyse ATP and GTP to the second messengers cAMP and cGMP, respectively, these products up-regulating catalytic activity by binding to the regulatory GAF domain(s). The opposite hydrolysis reaction is catalysed by phosphodiesterase. cGMP-dependent 3',5'-cyclic phosphodiesterase catalyses the conversion of guanosine 3',5'-cyclic phosphate to guanosine 5'-phosphate. Here too, cGMP regulates catalytic activity by GAF-domain binding. Phytochromes are regulatory photoreceptors in plants and bacteria which exist in two thermally-stable states that are reversibly inter-convertible by light: the Pr state absorbs maximally in the red region of the spectrum, while the Pfr state absorbs maximally in the far-red region. This domain is also found in FhlA (formate hydrogen lyase transcriptional activator) and NifA, a transcriptional activator which is required for activation of most Nif operons which are directly involved in nitrogen fixation. NifA interacts with sigma-54.


Pssm-ID: 250726  Cd Length: 146  Bit Score: 52.59  E-value: 2.54e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295    80 LLDSVLRFQEGDRVSGGgAPRLRAMAVSEVEGLNLAPDPVGELSVHTADRLGQRCLTTRRPVLVSRMTR-ADFAVIAPSR 158
Cdd:pfam01590   9 ILEELRELLGADRVAIY-LADADGLLLYLVAGDGLSDIPLAARGLPLGGGVVGEVIAGGNPIVVPDVQDdPRFRDLTALA 87
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295   159 E-SSDIMRRAGVHSYLAVPLIARGVLLGLADFVRAGHRaPFNRTDVALAMELASKAAVCI 217
Cdd:pfam01590  88 SdLPHFLRGLGIRSCLAVPLKGGGELIGVLVLHSTSPR-AFTEEELELLQALADQVAIAL 146
HATPase_c pfam02518
Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; This family represents the ...
503-584 5.62e-07

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; This family represents the structurally related ATPase domains of histidine kinase, DNA gyrase B and HSP90.


Pssm-ID: 251347  Cd Length: 111  Bit Score: 48.08  E-value: 5.62e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295   503 VVSELVGNALRYGNAPGELRL---LRHERLSVEVSDSGP-----DLPQIQHADVS--------DESGRGLQLINMMCRRW 566
Cdd:pfam02518   9 VLSNLLDNAIKHAPAGGEIEVtleRDGGRLRITVEDNGIgippeDLPKIFEPFFRtdgsrskvGGTGLGLSIVRKLVELH 88
                          90       100
                  ....*....|....*....|...
gi 21225295   567 G-----SCRTPDGKVVWAEQDLP 584
Cdd:pfam02518  89 GgtitvESEPGGGTTFTLTLPLE 111
GAF_2 pfam13185
GAF domain;
59-218 1.17e-05

GAF domain;


Pssm-ID: 257553  Cd Length: 150  Bit Score: 44.51  E-value: 1.17e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295    59 RTAEELADFTVPEL-----ADGAAVDLLDSVLRFQEGDRVSGGGAPRLRAMAVSEVEGLNLAPDPVGelsvhtadrLGQR 133
Cdd:pfam13185   2 LSLEELLEAILEALleltgSEAGFIGLLDEDGTLLLLAASGGTEELLRELAALSGELGGPPAAGAVG---------LGEG 72
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295   134 CLTTRRPVLVSRMTRAdfaviaPSRESSDIMRRAGVHSYLAVPLIARGVLLGLAdFVRAGHRAPFNRTDVALAMELASKA 213
Cdd:pfam13185  73 ALRTGKPVIINDVASD------PSGAGGLPAGHEGLRSFLSVPLISGGRVIGVL-ALGSKEPGAFDEEDLELLELLAEQI 145

                  ....*
gi 21225295   214 AVCID 218
Cdd:pfam13185 146 AIAIE 150
HATPase_c smart00387
Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.
503-562 1.95e-05

Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.


Pssm-ID: 214643  Cd Length: 111  Bit Score: 43.41  E-value: 1.95e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295    503 VVSELVGNALRYGNAPGELRL---LRHERLSVEVSDSGP-----DLPQIQHA------DVSDESGRGL------QLINMM 562
Cdd:smart00387   9 VLSNLLDNAIKYTPEGGRITVtleRDGDHVEITVEDNGPgippeDLEKIFEPffrtdkRSRKIGGTGLglsivkKLVELH 88
FhlA COG2203
FOG: GAF domain [Signal transduction mechanisms]
166-227 2.20e-05

FOG: GAF domain [Signal transduction mechanisms]


Pssm-ID: 225113  Cd Length: 175  Bit Score: 43.81  E-value: 2.20e-05
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 21225295 166 RAGVHSYLAVPLIARGVLLGLADFVRAGHRAPFNRTDVALAMELASKAAVCIDNARLYGRER 227
Cdd:COG2203 111 EPPIRSYLGVPLIAQGELLGLLCVHDSEPRRQWSEEELELLEELAEQVAIAIERARLYEELQ 172
RsbW COG2172
Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms]
470-560 3.21e-04

Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms]


Pssm-ID: 225083  Cd Length: 146  Bit Score: 40.05  E-value: 3.21e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295 470 LPPDGKAAGQARTAVREQLER--WGLQELVDTtELVVSELVGNALRYGNA----PGELRLLRH---ERLSVEVSDSGPDL 540
Cdd:COG2172  10 LPAKLSAVGTARLTLREFARElgLTYVDIADL-AIAVSEALTNAVKHAYKldpsEGEIRIEVSlddGKLEIRIWDQGPGI 88
                        90       100
                ....*....|....*....|....*...
gi 21225295 541 PQIQH--------ADVSDESGRGLQLIN 560
Cdd:COG2172  89 EDLEEslgpgdttAEGLQEGGLGLFLAK 116
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
170-455 2.04e-26

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 110.18  E-value: 2.04e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295 170 HSYLAVPLIARGVLLGLADFVRAghrapfNRTDVALAMEL--ASKAAVCIDNA--RLYGRER---DHVVT----LQRALL 238
Cdd:COG2208  66 FLPVEVLLGVSGKLRALSEEIKH------WRGGLPLVAELlvEINRAVGLVSAhnELLLLEQnniSAELEvarqIQQNLL 139
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295 239 PRSSPSTPGLAVTSCYDPAAdpaAVGGDWFDVVALPSGRTALMVGDVMGRGLAAAATMGRLRTVARTLMALDIA-PERLL 317
Cdd:COG2208 140 PKALPLFPGIDIEAILVPAS---EVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLESGPLdPADVL 216
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21225295 318 ARLDLAAR-DLEEDQVATCLCAVYDPYGNTFRIASAGHPPPLLTGPDGAVSFLDVPA-GAPLGTGV-IPYDPVERPVPEL 394
Cdd:COG2208 217 ETLNRVLKqNLEEDMFVTLFLGVYDLDSGELTYSNAGHEPALILSADGEIEVEDLTAlGLPIGLLPdYQYEVASLQLEPG 296
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 21225295 395 SRLTLYTDGLIRSRTAD---LGtqLERLREAVGGGVPEDGTE-CRAVAERV----GGDRSDDAIVLAAL 455
Cdd:COG2208 297 DLLVLYTDGVTEARNSDgefFG--LERLLKILGRLLGQPAEEiLEAILESLeelqGDQIQDDDITLLVL 363
envZ PRK09467
osmolarity sensor protein; Provisional
503-559 5.33e-03

osmolarity sensor protein; Provisional


Pssm-ID: 236531 [Multi-domain]  Cd Length: 435  Bit Score: 37.97  E-value: 5.33e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 21225295  503 VVSELVGNALRYGNapGELRLL---RHERLSVEVSDSGPDLP--QIQH----------ADVSDESGRGLQLI 559
Cdd:PRK09467 335 ALANLVVNAARYGN--GWIKVSsgtEGKRAWFQVEDDGPGIPpeQLKHlfqpftrgdsARGSSGTGLGLAIV 404
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH