NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|21224637|ref|NP_630416|]
View 

hypothetical protein SCO6321 [Streptomyces coelicolor A3(2)]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
163-350 6.96e-45

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


:

Pssm-ID: 254114  Cd Length: 192  Bit Score: 154.37  E-value: 6.96e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21224637   163 GVRVIVGDVQGKGLAAVETAAVVLGAFREAAHDEPDLVKLGERLERSLSRELEGEKFVTAVLAEIGAGD-EAVFLNFGHP 241
Cdd:pfam07228   4 RVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGERFATAVLAVYDPETgTLEYANAGHP 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21224637   242 APMVVRADGTVDFPEPPSyALPlgLGMEGTEGPQPYRVGFVPGDQLLLYTDGVTEARDEEDAFYPLAHRACLLNEP---D 318
Cdd:pfam07228  84 PPLLLRPDGGVVELLESP-GLP--LGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAERhglS 160
                         170       180       190
                  ....*....|....*....|....*....|..
gi 21224637   319 AHHALEALRADLSEHAVGPPHDDAAMLLVRHQ 350
Cdd:pfam07228 161 PEELLDALLEDLLRLGGGELEDDITLLVLRVR 192
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
163-350 6.96e-45

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 154.37  E-value: 6.96e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21224637   163 GVRVIVGDVQGKGLAAVETAAVVLGAFREAAHDEPDLVKLGERLERSLSRELEGEKFVTAVLAEIGAGD-EAVFLNFGHP 241
Cdd:pfam07228   4 RVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGERFATAVLAVYDPETgTLEYANAGHP 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21224637   242 APMVVRADGTVDFPEPPSyALPlgLGMEGTEGPQPYRVGFVPGDQLLLYTDGVTEARDEEDAFYPLAHRACLLNEP---D 318
Cdd:pfam07228  84 PPLLLRPDGGVVELLESP-GLP--LGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAERhglS 160
                         170       180       190
                  ....*....|....*....|....*....|..
gi 21224637   319 AHHALEALRADLSEHAVGPPHDDAAMLLVRHQ 350
Cdd:pfam07228 161 PEELLDALLEDLLRLGGGELEDDITLLVLRVR 192
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
141-302 3.48e-26

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 103.20  E-value: 3.48e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21224637    141 YTSAIAEARIGGDLYEVVASPYG-VRVIVGDVQGKGLAAVETAAVVLGAFREAAHDEPDLVKLGERLERSLSRELEGEKF 219
Cdd:smart00331   7 AQYYEDATQVGGDFYDVVKLPEGrLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYENGEDGMF 86
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21224637    220 VTAVLAEIG-AGDEAVFLNFGHPAPMVVRADG-TVDFPEPPSYAlplgLGMEGTEGPQPYRVGFVPGDQLLLYTDGVTEA 297
Cdd:smart00331  87 ATLFLALYDfAGGTLSYANAGHSPPYLLRADGgLVEDLDDLGAP----LGLEPDVEVDVRELTLEPGDLLLLYTDGLTEA 162

                   ....*
gi 21224637    298 RDEED 302
Cdd:smart00331 163 RNPER 167
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
58-351 2.84e-19

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 86.30  E-value: 2.84e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21224637  58 RIGAVALALTVALGLYDGLFDGRRG-----LTACLSVAGVTGVGLAAA----VIRERR--EAELanvrSIAESAQRVLL- 125
Cdd:COG2208  65 RFLPVEVLLGVSGKLRALSEEIKHWrgglpLVAELLVEINRAVGLVSAhnelLLLEQNniSAEL----EVARQIQQNLLp 140
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21224637 126 RPVPLtVGPLQMAVSYTSAIAearIGGDLYEVV-ASPYGVRVIVGDVQGKGL-AAVETAAVVLGAFREAAHDEPDLVKLG 203
Cdd:COG2208 141 KALPL-FPGIDIEAILVPASE---VGGDYYDFIqLGEKRLRIGIGDVSGKGVpAALLMLMPKLALRLLLESGPLDPADVL 216
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21224637 204 ERLERSLSRELEGEKFVTAVLAEIGAGD-EAVFLNFGHPAPMVVRADGTVDFPEPPSYALPLGLGMEGTegpqpYRVGFV 282
Cdd:COG2208 217 ETLNRVLKQNLEEDMFVTLFLGVYDLDSgELTYSNAGHEPALILSADGEIEVEDLTALGLPIGLLPDYQ-----YEVASL 291
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 21224637 283 ---PGDQLLLYTDGVTEARDEEDAFYPLA---HRACLLNEPDAHHALEALRADLSEHAVGPP-HDDAAMLLVRHQG 351
Cdd:COG2208 292 qlePGDLLVLYTDGVTEARNSDGEFFGLErllKILGRLLGQPAEEILEAILESLEELQGDQIqDDDITLLVLKVKK 367
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
163-350 6.96e-45

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 154.37  E-value: 6.96e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21224637   163 GVRVIVGDVQGKGLAAVETAAVVLGAFREAAHDEPDLVKLGERLERSLSRELEGEKFVTAVLAEIGAGD-EAVFLNFGHP 241
Cdd:pfam07228   4 RVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGERFATAVLAVYDPETgTLEYANAGHP 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21224637   242 APMVVRADGTVDFPEPPSyALPlgLGMEGTEGPQPYRVGFVPGDQLLLYTDGVTEARDEEDAFYPLAHRACLLNEP---D 318
Cdd:pfam07228  84 PPLLLRPDGGVVELLESP-GLP--LGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAERhglS 160
                         170       180       190
                  ....*....|....*....|....*....|..
gi 21224637   319 AHHALEALRADLSEHAVGPPHDDAAMLLVRHQ 350
Cdd:pfam07228 161 PEELLDALLEDLLRLGGGELEDDITLLVLRVR 192
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
141-302 3.48e-26

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 103.20  E-value: 3.48e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21224637    141 YTSAIAEARIGGDLYEVVASPYG-VRVIVGDVQGKGLAAVETAAVVLGAFREAAHDEPDLVKLGERLERSLSRELEGEKF 219
Cdd:smart00331   7 AQYYEDATQVGGDFYDVVKLPEGrLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYENGEDGMF 86
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21224637    220 VTAVLAEIG-AGDEAVFLNFGHPAPMVVRADG-TVDFPEPPSYAlplgLGMEGTEGPQPYRVGFVPGDQLLLYTDGVTEA 297
Cdd:smart00331  87 ATLFLALYDfAGGTLSYANAGHSPPYLLRADGgLVEDLDDLGAP----LGLEPDVEVDVRELTLEPGDLLLLYTDGLTEA 162

                   ....*
gi 21224637    298 RDEED 302
Cdd:smart00331 163 RNPER 167
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
58-351 2.84e-19

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 86.30  E-value: 2.84e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21224637  58 RIGAVALALTVALGLYDGLFDGRRG-----LTACLSVAGVTGVGLAAA----VIRERR--EAELanvrSIAESAQRVLL- 125
Cdd:COG2208  65 RFLPVEVLLGVSGKLRALSEEIKHWrgglpLVAELLVEINRAVGLVSAhnelLLLEQNniSAEL----EVARQIQQNLLp 140
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21224637 126 RPVPLtVGPLQMAVSYTSAIAearIGGDLYEVV-ASPYGVRVIVGDVQGKGL-AAVETAAVVLGAFREAAHDEPDLVKLG 203
Cdd:COG2208 141 KALPL-FPGIDIEAILVPASE---VGGDYYDFIqLGEKRLRIGIGDVSGKGVpAALLMLMPKLALRLLLESGPLDPADVL 216
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21224637 204 ERLERSLSRELEGEKFVTAVLAEIGAGD-EAVFLNFGHPAPMVVRADGTVDFPEPPSYALPLGLGMEGTegpqpYRVGFV 282
Cdd:COG2208 217 ETLNRVLKQNLEEDMFVTLFLGVYDLDSgELTYSNAGHEPALILSADGEIEVEDLTALGLPIGLLPDYQ-----YEVASL 291
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 21224637 283 ---PGDQLLLYTDGVTEARDEEDAFYPLA---HRACLLNEPDAHHALEALRADLSEHAVGPP-HDDAAMLLVRHQG 351
Cdd:COG2208 292 qlePGDLLVLYTDGVTEARNSDGEFFGLErllKILGRLLGQPAEEILEAILESLEELQGDQIqDDDITLLVLKVKK 367
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH