NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|194036298|ref|XP_001926797|]
View 

PREDICTED: synaptic vesicle glycoprotein 2A [Sus scrofa]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
170-320 9.07e-21

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


:

Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 93.15  E-value: 9.07e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 170 FVLGLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFS 249
Cdd:cd06174    2 LLLFLGFFLSGLDRGLLSPALPLLAEDLGLSASQAGLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLLL 81
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 194036298 250 SFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGW 320
Cdd:cd06174   82 AFASSLWLLLVGRFLLGLGGGALYPAAAALIAEWFPPKERGRALGLFSAGFGLGALLGPLLGGLLAESLGW 152
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
591-731 2.97e-08

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


:

Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 55.01  E-value: 2.97e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 591 GEGAYMVYFVSFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSESAMIALLCLFGGVSIASWNALD 670
Cdd:cd06174   30 GLSASQAGLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLLLAFASSLWLLLVGRFLLGLGGGALYPAAA 109
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 194036298 671 VLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAAPILFASAALALGSSLAL 731
Cdd:cd06174  110 ALIAEWFPPKERGRALGLFSAGFGLGALLGPLLGGLLAESLGWRWLFLILAILGLLLALLL 170
synapt_SV2 TIGR01299
synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger ...
1-742 0e+00

synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by PFAM model pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.


:

Pssm-ID: 130366 [Multi-domain]  Cd Length: 742  Bit Score: 1394.71  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298    1 MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEEDDDDFPAPADGYYRGEGAQDEEEGGAS 80
Cdd:TIGR01299   1 MEDGFKDRAAFIKGAKDIAKEVKKHAAKKVNKALDRAQDEYSQRSYSRFEDEDDDDDFPAPADGYSRGEAADDEEEGEAS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298   81 SDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLGDGEGPPGGRGEAQRRKEREELAQQYETILRECG 160
Cdd:TIGR01299  81 SDATEGHDEDDEIYEGEYQGIPRAENGGKDEIMADGAPKAGVRDELKDGEGPPGGEGEAERRADEEELAQQYELIIQECG 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  161 HGRFQWTLYFVLGLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLS 240
Cdd:TIGR01299 161 HGRFQWALFFVLGLALMADGVEVFVVGFVLPSAEKDLCIPDSGKGMLGLIVYLGMMVGAFFWGGLADKLGRKQCLLICLS 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  241 VNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGW 320
Cdd:TIGR01299 241 VNGFFAFFSSFVQGYGFFLFCRLLSGFGIGGAIPIVFSYFAEFLAQEKRGEHLSWLCMFWMIGGIYAAAMAWAIIPHYGW 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  321 SFQMGSAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTI 400
Cdd:TIGR01299 321 SFQMGSAYQFHSWRVFVIVCAFPCVFAIGALTFMPESPRFFLENGKHDEAWMILKLIHDTNMRAKGHPEKVFSVNHIKTI 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  401 HQEDELIEIQSDTGTWYQRWGVRALSLGGQVWGNFLSCFGPEYRRITLMMMGVWFTMSFSYYGLTVWFPDMIRHLQAVDY 480
Cdd:TIGR01299 401 HQEDELIEIESDTGTWYQRCFVRALSEGGGIWGNFLRCFNPEVREITIKLMGVWFTLSFGYYGLSVWFPDMIKHLQADDY 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  481 AARTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTD 560
Cdd:TIGR01299 481 AALTKNFPGDKVAHFSFNFTLENQIHRGGEYDNDKFIGLKFKSVSFEDSLFEECTFDDVTSSNTFFKNCTFIDTLFENTD 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  561 LFEYKFVNSRLVNSTFLHNKEGCPLDVTGTGEGAYMVYFVSFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCF 640
Cdd:TIGR01299 561 FEEYKFIDSEFQNCSFLHNKEGCPIDFDGDDEGAYMIYFVNFLGTLAVLPGNIVSALLMDKIGRLRMLAGSMVLSCISCF 640
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  641 FLSFGNSESAMIALLCLFGGVSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAAPILFAS 720
Cdd:TIGR01299 641 FLSFGNSESAMIALLCLFGGLSIAAWNALDVLTVELYPSDKRATAFGFLNALCKAAAVLGILIFGSFVGITKAAPILFAS 720
                         730       740
                  ....*....|....*....|..
gi 194036298  721 AALALGSSLALKLPETRGQVLQ 742
Cdd:TIGR01299 721 AALACGGLLALKLPDTRGQVLM 742
 
Name Accession Description Interval E-value
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
170-320 9.07e-21

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 93.15  E-value: 9.07e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 170 FVLGLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFS 249
Cdd:cd06174    2 LLLFLGFFLSGLDRGLLSPALPLLAEDLGLSASQAGLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLLL 81
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 194036298 250 SFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGW 320
Cdd:cd06174   82 AFASSLWLLLVGRFLLGLGGGALYPAAAALIAEWFPPKERGRALGLFSAGFGLGALLGPLLGGLLAESLGW 152
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
591-731 2.97e-08

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 55.01  E-value: 2.97e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 591 GEGAYMVYFVSFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSESAMIALLCLFGGVSIASWNALD 670
Cdd:cd06174   30 GLSASQAGLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLLLAFASSLWLLLVGRFLLGLGGGALYPAAA 109
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 194036298 671 VLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAAPILFASAALALGSSLAL 731
Cdd:cd06174  110 ALIAEWFPPKERGRALGLFSAGFGLGALLGPLLGGLLAESLGWRWLFLILAILGLLLALLL 170
2_A_01_02 TIGR00880
Multidrug resistance protein;
205-322 9.20e-09

Multidrug resistance protein;


Pssm-ID: 233166  Cd Length: 141  Bit Score: 54.20  E-value: 9.20e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  205 GMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFL 284
Cdd:TIGR00880   1 GLLLAGYALGQLIYSPLSGLLTDRFGRKPVLLVGLFIFVLSTAMFALSSNITVLIIARFLQGFGAAFALVAGAALIADIY 80
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 194036298  285 AQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGWSF 322
Cdd:TIGR00880  81 PPEERGVALGLMSAGIALGPLLGPPLGGVLAQFLGWRA 118
2_A_01_02 TIGR00880
Multidrug resistance protein;
606-736 1.34e-03

Multidrug resistance protein;


Pssm-ID: 233166  Cd Length: 141  Bit Score: 38.40  E-value: 1.34e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  606 LAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSESAMIALLCLFGGVSIASWNALDVLTVELYPSDKRTTA 685
Cdd:TIGR00880   9 LGQLIYSPLSGLLTDRFGRKPVLLVGLFIFVLSTAMFALSSNITVLIIARFLQGFGAAFALVAGAALIADIYPPEERGVA 88
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 194036298  686 FGFLNALCKLAAVLGIsIFTSFVG--ITKAAPILFASA-ALALGSSLALKLPET 736
Cdd:TIGR00880  89 LGLMSAGIALGPLLGP-PLGGVLAqfLGWRAPFLFLAIlALAAFILLAFLLPET 141
synapt_SV2 TIGR01299
synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger ...
1-742 0e+00

synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by PFAM model pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.


Pssm-ID: 130366 [Multi-domain]  Cd Length: 742  Bit Score: 1394.71  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298    1 MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEEDDDDFPAPADGYYRGEGAQDEEEGGAS 80
Cdd:TIGR01299   1 MEDGFKDRAAFIKGAKDIAKEVKKHAAKKVNKALDRAQDEYSQRSYSRFEDEDDDDDFPAPADGYSRGEAADDEEEGEAS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298   81 SDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLGDGEGPPGGRGEAQRRKEREELAQQYETILRECG 160
Cdd:TIGR01299  81 SDATEGHDEDDEIYEGEYQGIPRAENGGKDEIMADGAPKAGVRDELKDGEGPPGGEGEAERRADEEELAQQYELIIQECG 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  161 HGRFQWTLYFVLGLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLS 240
Cdd:TIGR01299 161 HGRFQWALFFVLGLALMADGVEVFVVGFVLPSAEKDLCIPDSGKGMLGLIVYLGMMVGAFFWGGLADKLGRKQCLLICLS 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  241 VNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGW 320
Cdd:TIGR01299 241 VNGFFAFFSSFVQGYGFFLFCRLLSGFGIGGAIPIVFSYFAEFLAQEKRGEHLSWLCMFWMIGGIYAAAMAWAIIPHYGW 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  321 SFQMGSAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTI 400
Cdd:TIGR01299 321 SFQMGSAYQFHSWRVFVIVCAFPCVFAIGALTFMPESPRFFLENGKHDEAWMILKLIHDTNMRAKGHPEKVFSVNHIKTI 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  401 HQEDELIEIQSDTGTWYQRWGVRALSLGGQVWGNFLSCFGPEYRRITLMMMGVWFTMSFSYYGLTVWFPDMIRHLQAVDY 480
Cdd:TIGR01299 401 HQEDELIEIESDTGTWYQRCFVRALSEGGGIWGNFLRCFNPEVREITIKLMGVWFTLSFGYYGLSVWFPDMIKHLQADDY 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  481 AARTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTD 560
Cdd:TIGR01299 481 AALTKNFPGDKVAHFSFNFTLENQIHRGGEYDNDKFIGLKFKSVSFEDSLFEECTFDDVTSSNTFFKNCTFIDTLFENTD 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  561 LFEYKFVNSRLVNSTFLHNKEGCPLDVTGTGEGAYMVYFVSFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCF 640
Cdd:TIGR01299 561 FEEYKFIDSEFQNCSFLHNKEGCPIDFDGDDEGAYMIYFVNFLGTLAVLPGNIVSALLMDKIGRLRMLAGSMVLSCISCF 640
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  641 FLSFGNSESAMIALLCLFGGVSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAAPILFAS 720
Cdd:TIGR01299 641 FLSFGNSESAMIALLCLFGGLSIAAWNALDVLTVELYPSDKRATAFGFLNALCKAAAVLGILIFGSFVGITKAAPILFAS 720
                         730       740
                  ....*....|....*....|..
gi 194036298  721 AALALGSSLALKLPETRGQVLQ 742
Cdd:TIGR01299 721 AALACGGLLALKLPDTRGQVLM 742
Sugar_tr pfam00083
Sugar (and other) transporter;
199-466 5.88e-21

Sugar (and other) transporter;


Pssm-ID: 249572 [Multi-domain]  Cd Length: 449  Bit Score: 95.06  E-value: 5.88e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  199 LSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQG--YGTFLFCRLLSGVGIGGSIPIV 276
Cdd:pfam00083  42 LSTSLSGLIVSIFSVGCLIGSLFAGKLGDRFGRKPSLLIANVLFVIGALLQGFAPGksFYMLIVGRVIVGLGVGGISVLV 121
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  277 FSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIpHYGWSFQmgsayqfhsWRVFVLVCAFPSVFAIGALTTQPE 356
Cdd:pfam00083 122 PMYISEIAPKKLRGALGSLYQLGITFGILVAAIIGLGLN-KYSNSDG---------WRIPLGLQFVPALLLLIGLLFLPE 191
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  357 SPRFFLENGKHDEAWMVLKqvhdtnmRAKGHPErvfsvtHIKTIHQEDELIEiqsdtgtwyqrwgvRALSLGGQVWGNFL 436
Cdd:pfam00083 192 SPRWLVLKGKLEEARAVLA-------KLRGVSD------VDQEIQEIKDSLE--------------RSVSEEKASWLELF 244
                         250       260       270
                  ....*....|....*....|....*....|....
gi 194036298  437 SCFGPEYRRITLMMMGVW--FT--MSFSYYGLTV 466
Cdd:pfam00083 245 RGKTVRQRLLMGVMLQIFqqLTgiNAIFYYSPTI 278
PRK11551 PRK11551
putative 3-hydroxyphenylpropionic transporter MhpT; Provisional
213-320 2.12e-11

putative 3-hydroxyphenylpropionic transporter MhpT; Provisional


Pssm-ID: 236927 [Multi-domain]  Cd Length: 406  Bit Score: 64.98  E-value: 2.12e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 213 LGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEH 292
Cdd:PRK11551  61 LGLLPGALLGGRLADRIGRKRILIVSVALFGLFSLATAQAWDFPSLLVARLLTGVGLGGALPNLIALTSEAVGPRLRGTA 140
                         90       100
                 ....*....|....*....|....*...
gi 194036298 293 LSWLCMFWMIGGVYAAAMAWAIIPHYGW 320
Cdd:PRK11551 141 VSLMYCGVPFGGALASVIGVLAAGDAAW 168
ProP COG0477
Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino ...
167-374 1.48e-06

Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only]


Pssm-ID: 223553 [Multi-domain]  Cd Length: 338  Bit Score: 49.69  E-value: 1.48e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 167 TLYFVLGLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFA 246
Cdd:COG0477    4 LLALALAALLLGLDLGLLSPALPLLLSTLSLSSGRLLYGLLLSAFFLGYAIGSLLAGPLGDRYGRRKVLIIGLLLFLLGT 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 247 FFSSFV--QGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFL-AQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGWSFQ 323
Cdd:COG0477   84 LLLALApnVGLALLLILRLLQGLGGGGLLPVASALLSEWFpEATERGLAVGLVTLGAGALGLALGPLLAGLLLGALLWGW 163
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|.
gi 194036298 324 MGSAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPRFFLENGKHDEAWMVL 374
Cdd:COG0477  164 RAAFLLAALLGLLLLILVLLLDLLLAAPRLPLAVGLALIELGKLLLLLLIL 214
PHA03169 PHA03169
hypothetical protein; Provisional
69-118 6.16e-03

hypothetical protein; Provisional


Pssm-ID: 223003 [Multi-domain]  Cd Length: 413  Bit Score: 38.41  E-value: 6.16e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|
gi 194036298  69 EGAQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAP 118
Cdd:PHA03169 154 SHNPSPNQQPSSFLQPSHEDSPEEPEPPTSEPEPDSPGPPQSETPTSSPP 203
 
Name Accession Description Interval E-value
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
170-320 9.07e-21

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 93.15  E-value: 9.07e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 170 FVLGLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFS 249
Cdd:cd06174    2 LLLFLGFFLSGLDRGLLSPALPLLAEDLGLSASQAGLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLLL 81
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 194036298 250 SFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGW 320
Cdd:cd06174   82 AFASSLWLLLVGRFLLGLGGGALYPAAAALIAEWFPPKERGRALGLFSAGFGLGALLGPLLGGLLAESLGW 152
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
591-731 2.97e-08

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 55.01  E-value: 2.97e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 591 GEGAYMVYFVSFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSESAMIALLCLFGGVSIASWNALD 670
Cdd:cd06174   30 GLSASQAGLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLLLAFASSLWLLLVGRFLLGLGGGALYPAAA 109
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 194036298 671 VLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAAPILFASAALALGSSLAL 731
Cdd:cd06174  110 ALIAEWFPPKERGRALGLFSAGFGLGALLGPLLGGLLAESLGWRWLFLILAILGLLLALLL 170
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
199-347 1.14e-11

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 65.80  E-value: 1.14e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 199 LSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRR-QCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVF 277
Cdd:cd06174  208 LSAAEAGLLLSLFGLGGILGALLGGLLSDRLGRRrLLLLIGLLLAALGLLLLALAPSLALLLVALLLLGFGLGFAFPALL 287
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 278 SYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGWSfqmgsayqfHSWRVFVLVCAFPSVFA 347
Cdd:cd06174  288 TLASELAPPEARGTASGLFNTFGSLGGALGPLLAGLLLDTGGYG---------GVFLILAALALLAALLL 348
2_A_01_02 TIGR00880
Multidrug resistance protein;
205-322 9.20e-09

Multidrug resistance protein;


Pssm-ID: 233166  Cd Length: 141  Bit Score: 54.20  E-value: 9.20e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  205 GMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFL 284
Cdd:TIGR00880   1 GLLLAGYALGQLIYSPLSGLLTDRFGRKPVLLVGLFIFVLSTAMFALSSNITVLIIARFLQGFGAAFALVAGAALIADIY 80
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 194036298  285 AQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGWSF 322
Cdd:TIGR00880  81 PPEERGVALGLMSAGIALGPLLGPPLGGVLAQFLGWRA 118
2_A_01_02 TIGR00880
Multidrug resistance protein;
606-736 1.34e-03

Multidrug resistance protein;


Pssm-ID: 233166  Cd Length: 141  Bit Score: 38.40  E-value: 1.34e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  606 LAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSESAMIALLCLFGGVSIASWNALDVLTVELYPSDKRTTA 685
Cdd:TIGR00880   9 LGQLIYSPLSGLLTDRFGRKPVLLVGLFIFVLSTAMFALSSNITVLIIARFLQGFGAAFALVAGAALIADIYPPEERGVA 88
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 194036298  686 FGFLNALCKLAAVLGIsIFTSFVG--ITKAAPILFASA-ALALGSSLALKLPET 736
Cdd:TIGR00880  89 LGLMSAGIALGPLLGP-PLGGVLAqfLGWRAPFLFLAIlALAAFILLAFLLPET 141
synapt_SV2 TIGR01299
synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger ...
1-742 0e+00

synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by PFAM model pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.


Pssm-ID: 130366 [Multi-domain]  Cd Length: 742  Bit Score: 1394.71  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298    1 MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEEDDDDFPAPADGYYRGEGAQDEEEGGAS 80
Cdd:TIGR01299   1 MEDGFKDRAAFIKGAKDIAKEVKKHAAKKVNKALDRAQDEYSQRSYSRFEDEDDDDDFPAPADGYSRGEAADDEEEGEAS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298   81 SDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLGDGEGPPGGRGEAQRRKEREELAQQYETILRECG 160
Cdd:TIGR01299  81 SDATEGHDEDDEIYEGEYQGIPRAENGGKDEIMADGAPKAGVRDELKDGEGPPGGEGEAERRADEEELAQQYELIIQECG 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  161 HGRFQWTLYFVLGLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLS 240
Cdd:TIGR01299 161 HGRFQWALFFVLGLALMADGVEVFVVGFVLPSAEKDLCIPDSGKGMLGLIVYLGMMVGAFFWGGLADKLGRKQCLLICLS 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  241 VNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGW 320
Cdd:TIGR01299 241 VNGFFAFFSSFVQGYGFFLFCRLLSGFGIGGAIPIVFSYFAEFLAQEKRGEHLSWLCMFWMIGGIYAAAMAWAIIPHYGW 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  321 SFQMGSAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTI 400
Cdd:TIGR01299 321 SFQMGSAYQFHSWRVFVIVCAFPCVFAIGALTFMPESPRFFLENGKHDEAWMILKLIHDTNMRAKGHPEKVFSVNHIKTI 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  401 HQEDELIEIQSDTGTWYQRWGVRALSLGGQVWGNFLSCFGPEYRRITLMMMGVWFTMSFSYYGLTVWFPDMIRHLQAVDY 480
Cdd:TIGR01299 401 HQEDELIEIESDTGTWYQRCFVRALSEGGGIWGNFLRCFNPEVREITIKLMGVWFTLSFGYYGLSVWFPDMIKHLQADDY 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  481 AARTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTD 560
Cdd:TIGR01299 481 AALTKNFPGDKVAHFSFNFTLENQIHRGGEYDNDKFIGLKFKSVSFEDSLFEECTFDDVTSSNTFFKNCTFIDTLFENTD 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  561 LFEYKFVNSRLVNSTFLHNKEGCPLDVTGTGEGAYMVYFVSFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCF 640
Cdd:TIGR01299 561 FEEYKFIDSEFQNCSFLHNKEGCPIDFDGDDEGAYMIYFVNFLGTLAVLPGNIVSALLMDKIGRLRMLAGSMVLSCISCF 640
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  641 FLSFGNSESAMIALLCLFGGVSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAAPILFAS 720
Cdd:TIGR01299 641 FLSFGNSESAMIALLCLFGGLSIAAWNALDVLTVELYPSDKRATAFGFLNALCKAAAVLGILIFGSFVGITKAAPILFAS 720
                         730       740
                  ....*....|....*....|..
gi 194036298  721 AALALGSSLALKLPETRGQVLQ 742
Cdd:TIGR01299 721 AALACGGLLALKLPDTRGQVLM 742
2A0119 TIGR00898
cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds] ...
198-741 3.04e-34

cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds].


Pssm-ID: 233176 [Multi-domain]  Cd Length: 505  Bit Score: 136.30  E-value: 3.04e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  198 CLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVF 277
Cdd:TIGR00898 123 CEDAWKVDLTQSCFFVGVLLGSFVFGYLSDRFGRKKVLLLSTLVTAVSGVLTAFSPNYTVFLVFRLLVGMGIGGIWVQAV 202
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  278 SYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAiIPHygwsfqmgsayqfhsWRVFVLVCAFPSVFAIGALTTQPES 357
Cdd:TIGR00898 203 VLNTEFLPKKQRAIVGTLIQVFFSLGLVLLPLVAYF-IPD---------------WRWLQLAVSLPTFLFFLLSWFVPES 266
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  358 PRFFLENGKHDEAWMVLKQVHDTNmrAKGHPERVFSVThiktihQEDELIEIQSDTGtwyqrwgvralslggqvwgnFLS 437
Cdd:TIGR00898 267 PRWLISQGRIEEALKILQRIAKIN--GKKLPAEVLSLS------LEKDLSSSKKQYS--------------------FLD 318
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  438 CF-GPEYRRITLMMMGVWFTMSFSYYGLtvwfpdmirhlqavdyaartkvfpgervehvtfnftlenqihrggqyfndkf 516
Cdd:TIGR00898 319 LFrTPNLRKTTLCLMMLWFTTAFSYYGL---------------------------------------------------- 346
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  517 iglrlksvsfedslfeecyfedvtssntffrnctfintvfyntdlfeykfvnsrlvnstflhnkegcPLDVTGTGEGAYM 596
Cdd:TIGR00898 347 -------------------------------------------------------------------VLDLGNLGGNIYL 359
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  597 VYFVSflgTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSE--SAMIALLCLFGGVSIASWNALDVLTV 674
Cdd:TIGR00898 360 DLFIS---GLVELPAKLITLLLIDRLGRRYTMAASLLLAGVALLLLLFVPVDlyFLRTALAVLGKFGITSAFQMVYLYTA 436
                         490       500       510       520       530       540       550
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 194036298  675 ELYPSDKRTTAFGflnaLCKLAAVLGiSIFTSFVGITKAAP-----ILFASAALaLGSSLALKLPETRGQVL 741
Cdd:TIGR00898 437 ELYPTVVRNLGVG----VCSTMARVG-SIISPFLVYLGEKWlflplVLFGGLAL-LAGILTLFLPETKGVPL 502
2A0115 TIGR00895
benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and ...
163-473 1.83e-27

benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].


Pssm-ID: 233175 [Multi-domain]  Cd Length: 398  Bit Score: 114.38  E-value: 1.83e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  163 RFQWTLYFVLGLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVN 242
Cdd:TIGR00895  13 RYQWRAIILSFLIMLMDGYDLAAMGFAAPAISAEWGLDPVQLGFLFSAGLIGMAFGALFFGPLADRIGRRRVLLWSILLF 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  243 SVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGWsf 322
Cdd:TIGR00895  93 SVFTLLCALATNVTQLLILRFLAGLGLGGLMPNLNALVSEYAPKRFRGTAVGLMFCGYPIGAAVGGFLAGWLIPVFGW-- 170
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  323 qmgsayqfHSwrVFVLVCAFPSVFAIGALTTQPESprfflengkhdEAWMVLKqvhdtnmRAKGHPERVFSVTHIKTIHQ 402
Cdd:TIGR00895 171 --------RS--LFYVGGIAPLLLLLLLMRFLPES-----------IDFLVSK-------RPETVRRIVNAIAPQMQAEA 222
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 194036298  403 EDELIEIQSDTGTWyqRWGVRALslggqvwgnflscFGPEYRRITLMMMGVWFTMSFSYYGLTVWFPDMIR 473
Cdd:TIGR00895 223 QSALPEQKATQGTK--RSVFKAL-------------FQGKTARITVLLWLLYFMLLVGVYFLTNWLPKLMV 278
Sugar_tr pfam00083
Sugar (and other) transporter;
199-466 5.88e-21

Sugar (and other) transporter;


Pssm-ID: 249572 [Multi-domain]  Cd Length: 449  Bit Score: 95.06  E-value: 5.88e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  199 LSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQG--YGTFLFCRLLSGVGIGGSIPIV 276
Cdd:pfam00083  42 LSTSLSGLIVSIFSVGCLIGSLFAGKLGDRFGRKPSLLIANVLFVIGALLQGFAPGksFYMLIVGRVIVGLGVGGISVLV 121
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  277 FSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIpHYGWSFQmgsayqfhsWRVFVLVCAFPSVFAIGALTTQPE 356
Cdd:pfam00083 122 PMYISEIAPKKLRGALGSLYQLGITFGILVAAIIGLGLN-KYSNSDG---------WRIPLGLQFVPALLLLIGLLFLPE 191
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  357 SPRFFLENGKHDEAWMVLKqvhdtnmRAKGHPErvfsvtHIKTIHQEDELIEiqsdtgtwyqrwgvRALSLGGQVWGNFL 436
Cdd:pfam00083 192 SPRWLVLKGKLEEARAVLA-------KLRGVSD------VDQEIQEIKDSLE--------------RSVSEEKASWLELF 244
                         250       260       270
                  ....*....|....*....|....*....|....
gi 194036298  437 SCFGPEYRRITLMMMGVW--FT--MSFSYYGLTV 466
Cdd:pfam00083 245 RGKTVRQRLLMGVMLQIFqqLTgiNAIFYYSPTI 278
SP TIGR00879
MFS transporter, sugar porter (SP) family; This model represent the sugar porter subfamily of ...
199-466 3.03e-18

MFS transporter, sugar porter (SP) family; This model represent the sugar porter subfamily of the major facilitator superfamily (pfam00083) [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].


Pssm-ID: 233165 [Multi-domain]  Cd Length: 481  Bit Score: 87.01  E-value: 3.03e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  199 LSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLIS---LSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPI 275
Cdd:TIGR00879  68 YSSSLWGLVVSIFLVGGFIGALFAGWLSDRFGRKKSLLIIallFVIGAILMGLAAFALSVEMLIVGRVLLGIGVGIASAL 147
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  276 VFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAaamawaiiphYGWSFQMGSAYQFHSWRVFVLVCAFPSVFAIGALTTQP 355
Cdd:TIGR00879 148 VPMYLSEIAPKALRGALTSLYQLAITFGILVA----------YGFGSGKVSLNNTLGWRIPLGLQLIPAGLLFLGLFFLP 217
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  356 ESPRFFLENGKHDEAWMVLKQVHDTNMRAKGhpervfsvthiktIHQEDELIEIQSDtgtwyqrwgvRALSLGGQVWGNF 435
Cdd:TIGR00879 218 ESPRWLVGKGRVEEARKSLARLRGTSGEDKE-------------LLDELELIDIKRS----------IEKRSVQPSWGSL 274
                         250       260       270
                  ....*....|....*....|....*....|....*.
gi 194036298  436 LSCFGPEYRRITLMMMGVWFTM-----SFSYYGLTV 466
Cdd:TIGR00879 275 FSSTRRIRRRLFLGVVLQWFQQftginAIMYYSPTI 310
MFS_1 pfam07690
Major Facilitator Superfamily;
195-320 4.10e-15

Major Facilitator Superfamily;


Pssm-ID: 254360 [Multi-domain]  Cd Length: 346  Bit Score: 75.92  E-value: 4.10e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  195 KDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIP 274
Cdd:pfam07690  25 EDLGISPTEIGLLLTAFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLLLLLFASSLWLLLVLRVLQGLGGGALFP 104
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 194036298  275 IVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGW 320
Cdd:pfam07690 105 AAAALIADWFPPEERGRALGLLSAGFGLGAALGPLLGGLLASLFGW 150
PRK11551 PRK11551
putative 3-hydroxyphenylpropionic transporter MhpT; Provisional
213-320 2.12e-11

putative 3-hydroxyphenylpropionic transporter MhpT; Provisional


Pssm-ID: 236927 [Multi-domain]  Cd Length: 406  Bit Score: 64.98  E-value: 2.12e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 213 LGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEH 292
Cdd:PRK11551  61 LGLLPGALLGGRLADRIGRKRILIVSVALFGLFSLATAQAWDFPSLLVARLLTGVGLGGALPNLIALTSEAVGPRLRGTA 140
                         90       100
                 ....*....|....*....|....*...
gi 194036298 293 LSWLCMFWMIGGVYAAAMAWAIIPHYGW 320
Cdd:PRK11551 141 VSLMYCGVPFGGALASVIGVLAAGDAAW 168
Pentapeptide_4 pfam13599
Pentapeptide repeats (9 copies);
513-583 3.93e-11

Pentapeptide repeats (9 copies);


Pssm-ID: 257914 [Multi-domain]  Cd Length: 78  Bit Score: 60.40  E-value: 3.93e-11
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 194036298  513 NDKFIGLRLKSVSFEDSLFEECYFEDVTS-SNTFFRNCTFINTVFYNTDLFEYKFVNSRLVNSTFLHNKEGC 583
Cdd:pfam13599   5 NCSFENCDLKNVNFSNATLKNCNFSNCKLlTNVNFSDCDLRDVDFTEADLKNAKFSNCDLKNANFEGSLKGC 76
2A0112 TIGR00891
putative sialic acid transporter; [Transport and binding proteins, Carbohydrates, organic ...
217-381 1.82e-08

putative sialic acid transporter; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].


Pssm-ID: 233172 [Multi-domain]  Cd Length: 405  Bit Score: 56.04  E-value: 1.82e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  217 VGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWL 296
Cdd:TIGR00891  62 FGALMFGLWGDRYGRRLPMVTSIVLFSAGTLACGFAPGYITMFIARLVIGIGMGGEYGSSAAYVIESWPKHLRNKASGLL 141
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  297 CMFWMIGGVYAAAMAWAIIPHYGwsfqmgsayqfHSWRVFVLVCAFPSVFAIGALTTQPESPRFfleNGKHDEAWMVLKQ 376
Cdd:TIGR00891 142 ISGYAVGAVVAAQVYSLVVPVWG-----------DGWRALFFISILPIIFALWLRKNIPEAEDW---KEKHAGKALVRTM 207

                  ....*
gi 194036298  377 VHDTN 381
Cdd:TIGR00891 208 VDILY 212
MFS_1 pfam07690
Major Facilitator Superfamily;
599-737 4.47e-08

Major Facilitator Superfamily;


Pssm-ID: 254360 [Multi-domain]  Cd Length: 346  Bit Score: 54.35  E-value: 4.47e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  599 FVSFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSESAMIALLCLFGGVSIASWNALDVLTVELYP 678
Cdd:pfam07690  36 LLLTAFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLLLLLFASSLWLLLVLRVLQGLGGGALFPAAAALIADWFP 115
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 194036298  679 SDKRTTAFGFLNALCKLAAVLG--ISIFTSFVGITKAAPILFASAALALGSSLALKLPETR 737
Cdd:pfam07690 116 PEERGRALGLLSAGFGLGAALGplLGGLLASLFGWRAAFLILAILALLAAVLAALLLPRPP 176
2A0109 TIGR00887
phosphate:H+ symporter; This model represents the phosphate uptake symporter subfamily of the ...
214-464 1.09e-07

phosphate:H+ symporter; This model represents the phosphate uptake symporter subfamily of the major facilitator superfamily (pfam00083) [Transport and binding proteins, Anions].


Pssm-ID: 129965 [Multi-domain]  Cd Length: 502  Bit Score: 53.58  E-value: 1.09e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  214 GMMVGAFLWGGLADRLGRRQC------LLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQE 287
Cdd:TIGR00887  68 GTLAGQLFFGWLADKLGRKRVygmeliIMIIATVASGLSPGSSPKSVMATLCFWRFWLGVGIGGDYPLSAIITSEFATKK 147
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  288 KRGEHLSwlCMFWMIG-GVYAAAMAwAIIPHYGWSFQMGSAYQFHS------------WRVFVLVCAFPSVFAIGALTTQ 354
Cdd:TIGR00887 148 WRGAMMA--AVFAMQGfGILAGAIV-ALIVLAGFKHSLEAAADEASctgscvpavdymWRILIGFGAVPALLALYFRLTI 224
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  355 PESPRFFLengkhdeawmvlkqvhDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRWG--VRALSLggqvW 432
Cdd:TIGR00887 225 PETPRYTA----------------DVAKDVEQAASDMSAVLQVKIEAEPDEVEKASTAVEVPKASWSdfFTHFFK----W 284
                         250       260       270
                  ....*....|....*....|....*....|..
gi 194036298  433 GNFLSCFGpeyrritlmMMGVWFTMSFSYYGL 464
Cdd:TIGR00887 285 RHGKHLLG---------TAGSWFLLDIAFYGV 307
2A0106 TIGR00883
metabolite-proton symporter; This model represents the metabolite:H+ symport subfamily of the ...
217-370 1.31e-07

metabolite-proton symporter; This model represents the metabolite:H+ symport subfamily of the major facilitator superfamily (pfam00083), including citrate-H+ symporters, dicarboxylate:H+ symporters, the proline/glycine-betaine transporter ProP, etc [Transport and binding proteins, Unknown substrate].


Pssm-ID: 233168 [Multi-domain]  Cd Length: 394  Bit Score: 53.04  E-value: 1.31e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  217 VGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGT--------FLFCRLLSGVGIGGSIPIVFSYFSEFLAQEK 288
Cdd:TIGR00883  50 LGAIVFGHFGDRIGRKKTLVITLLMMGIGTLLIGLLPSYATigiwapilLLLARLIQGFSLGGEWGGAALYLAEYAPPGK 129
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  289 RGEHLSWLCMfWMIGGVYAAAMAWAIIphygwSFQMG-SAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPRFFLENGKH 367
Cdd:TIGR00883 130 RGFYGSFQQV-GAPVGLLLAALTVLLL-----SYLLGdDALLEWGWRIPFLVSAVLVLIGLYLRRNLEETPVFEKAQEKH 203

                  ...
gi 194036298  368 DEA 370
Cdd:TIGR00883 204 KKK 206
MFS_1 pfam07690
Major Facilitator Superfamily;
141-308 1.36e-07

Major Facilitator Superfamily;


Pssm-ID: 254360 [Multi-domain]  Cd Length: 346  Bit Score: 52.81  E-value: 1.36e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  141 RRKEREELAQQYETILRECGHGRFQWTLYFVLGLALMadgveVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAF 220
Cdd:pfam07690 181 RPKPAEEAPAPLLPAWKLLLRDPVLWLLLALLLFGFA-----FFALLTYLPLYQEVLGLSALLAGLLLGLAGLLGAIGRL 255
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  221 LWGGLADRLGRRQCLLISLSVNSVFA---FFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLC 297
Cdd:pfam07690 256 LLGRLSDRLGRRRRLLLALLLLILAAlglALLSLTESSLWLLLALLLLGFGFGLVFPALNALVSDLAPKEERGTASGLYN 335
                         170
                  ....*....|.
gi 194036298  298 MFWMIGGVYAA 308
Cdd:pfam07690 336 TAGSLGGALGP 346
efflux_Bcr_CflA TIGR00710
drug resistance transporter, Bcr/CflA subfamily; This subfamily of drug efflux proteins, a ...
190-316 1.88e-07

drug resistance transporter, Bcr/CflA subfamily; This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 12 membrane-spanning regions. Members with known activity include Bcr (bicyclomycin resistance protein) in E. coli, Flor (chloramphenicol and florfenicol resistance) in Salmonella typhimurium DT104, and CmlA (chloramphenicol resistance) in Pseudomonas sp. plasmid R1033.


Pssm-ID: 233099 [Multi-domain]  Cd Length: 385  Bit Score: 52.39  E-value: 1.88e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  190 LPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGI 269
Cdd:TIGR00710  28 FPEIAADLSTPASIVQMTLTLYLLGFAAGQLLWGPLSDRYGRRPVLLLGLFIFALSSLGLALSNNIETLLVLRFVQAFGA 107
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 194036298  270 GGSIPIVFSYFSEFLAQEKRG-------------------------EHLSWLCMFW--MIGGVYAAAMAWAIIP 316
Cdd:TIGR00710 108 SAGSVISQALVRDIYPGEELSriysilmpvlalapavapllggyilVWLSWHAIFAflSLAGILLSALIFFILP 181
xylE PRK10077
D-xylose transporter XylE; Provisional
201-380 2.34e-07

D-xylose transporter XylE; Provisional


Pssm-ID: 182225 [Multi-domain]  Cd Length: 479  Bit Score: 52.39  E-value: 2.34e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 201 DSNKGMLGLIV---YLGMMVGAFLWGGLADRLGRRQCLLISlsvnSVFAFFSSFVQGYGTFLFC---------------- 261
Cdd:PRK10077  51 SAANSLLGFCVasaLIGCIIGGALGGYCSNRFGRRDSLKIA----AVLFFISALGSAWPEFGFTsigpdntgyvpefviy 126
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 262 RLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWlCMFWMIGG---VY------AAAMAWAIIPHYGWSFQMGSAyqfhs 332
Cdd:PRK10077 127 RIIGGIGVGLASMLSPMYIAEIAPAHIRGKLVSF-NQFAIIFGqlvVYfvnyfiARSGDASWLNTDGWRYMFASE----- 200
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*...
gi 194036298 333 wrvfvlvcAFPSVFAIGALTTQPESPRFFLENGKHDEAWMVLKQVHDT 380
Cdd:PRK10077 201 --------AIPALLFLMLLYFVPETPRYLMSRGKQEQAEGILRKIMGN 240
ProP COG0477
Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino ...
167-374 1.48e-06

Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only]


Pssm-ID: 223553 [Multi-domain]  Cd Length: 338  Bit Score: 49.69  E-value: 1.48e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 167 TLYFVLGLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFA 246
Cdd:COG0477    4 LLALALAALLLGLDLGLLSPALPLLLSTLSLSSGRLLYGLLLSAFFLGYAIGSLLAGPLGDRYGRRKVLIIGLLLFLLGT 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 247 FFSSFV--QGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFL-AQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGWSFQ 323
Cdd:COG0477   84 LLLALApnVGLALLLILRLLQGLGGGGLLPVASALLSEWFpEATERGLAVGLVTLGAGALGLALGPLLAGLLLGALLWGW 163
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|.
gi 194036298 324 MGSAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPRFFLENGKHDEAWMVL 374
Cdd:COG0477  164 RAAFLLAALLGLLLLILVLLLDLLLAAPRLPLAVGLALIELGKLLLLLLIL 214
AraJ COG2814
Arabinose efflux permease [Carbohydrate transport and metabolism]
213-315 1.76e-06

Arabinose efflux permease [Carbohydrate transport and metabolism]


Pssm-ID: 225371 [Multi-domain]  Cd Length: 394  Bit Score: 49.53  E-value: 1.76e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 213 LGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKR--- 289
Cdd:COG2814   59 LGVALGAPLLALLTGRLERRRLLLGLLALFIVSNLLSALAPSFAVLLLARALAGLAHGVFWSIAAALAARLVPPGKRgra 138
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 194036298 290 ----------------------GEHLSWLCMFWMIGGVYAAAMAWAII 315
Cdd:COG2814  139 lalvftgltlatvlgvplgtflGQLFGWRATFLAIAVLALLALLLLWK 186
COG2270 COG2270
Permeases of the major facilitator superfamily [General function prediction only]
196-299 3.87e-06

Permeases of the major facilitator superfamily [General function prediction only]


Pssm-ID: 225179 [Multi-domain]  Cd Length: 438  Bit Score: 48.46  E-value: 3.87e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 196 DMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPI 275
Cdd:COG2270  282 DLGLSSTELLLIGIALSVVAALGAIIAGFLDERFGSKPVLMIGLVILSIAALYLIFLEGELDFWILGLLVGTSLGGAQAS 361
                         90       100
                 ....*....|....*....|....
gi 194036298 276 VFSYFSEFLAQEKRGEHLSWLCMF 299
Cdd:COG2270  362 SRSYLARLVPKGKEGRFFGLYALT 385
2A0114 TIGR00893
D-galactonate transporter; [Transport and binding proteins, Carbohydrates, organic alcohols, ...
191-346 5.07e-06

D-galactonate transporter; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].


Pssm-ID: 233174 [Multi-domain]  Cd Length: 399  Bit Score: 48.10  E-value: 5.07e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  191 PSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIG 270
Cdd:TIGR00893  18 PMLQEDLGLSAAQYGYVFSAFSWGYVVGQFPGGWLLDRFGARKTLAVFIVIWGVFTGLQAFAGAYVSLYILRVLLGAAEA 97
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 194036298  271 GSIPIVFSYFSEFLAQEKRGEHLSwlcmFWMIGGVYAAAMAWAIiphygwsfqMGSAYQFHSWRVFVLVCAFPSVF 346
Cdd:TIGR00893  98 PFFPGIILIVASWFPASERATAVS----IFNSAQGLGGIIGGPL---------VGWILIHFSWQWAFIIEGVLGII 160
PRK12307 PRK12307
putative sialic acid transporter; Provisional
196-320 6.21e-06

putative sialic acid transporter; Provisional


Pssm-ID: 237051 [Multi-domain]  Cd Length: 426  Bit Score: 48.00  E-value: 6.21e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 196 DMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPI 275
Cdd:PRK12307  47 DLGLTDMEGAFLATAAFIGRPFGGALFGLLADKFGRKPLMMWSIVAYSVGTGLSGLASGVIMLTLSRFIVGMGMAGEYAC 126
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 194036298 276 VFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGW 320
Cdd:PRK12307 127 ASTYAVESWPKHLKSKASAFLVSGFGIGNIIAAYFMPSFAEAYGW 171
2A0115 TIGR00895
benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and ...
190-311 2.35e-05

benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].


Pssm-ID: 233175 [Multi-domain]  Cd Length: 398  Bit Score: 45.81  E-value: 2.35e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  190 LPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLsVNSVFAFFSSFVQGYGT-FLFCRLLSGVG 268
Cdd:TIGR00895 273 LPKLMVELGFSLSLAATGGALFNFGGVIGSIIFGWLADRLGPRVTALLLL-LGAVFAVLVGSTLFSPTlLLLLGAIAGFF 351
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 194036298  269 IGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMA 311
Cdd:TIGR00895 352 VNGGQSGLYALMALFYPTAIRATGVGWAIGIGRLGAIIGPILA 394
UhpC COG2271
Sugar phosphate permease [Carbohydrate transport and metabolism]
199-320 3.46e-05

Sugar phosphate permease [Carbohydrate transport and metabolism]


Pssm-ID: 225180 [Multi-domain]  Cd Length: 448  Bit Score: 45.34  E-value: 3.46e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 199 LSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFS 278
Cdd:COG2271   61 LSKTQLGILGSAFSITYGVSKFVMGVLSDRSNPRYFMAFGLILSAIVNILFGFSPSLFLFAVLWVLNGWFQGMGWPPCAR 140
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 194036298 279 YFSEFLAQEKRGEHLSwlcmFW----MIGGVYAAAMA--WAIIPHYGW 320
Cdd:COG2271  141 TITHWFSRKERGTWWS----IWntshNIGGALAPLVAllAFFAFHGGW 184
MFS_2 pfam13347
MFS/sugar transport protein; This family is part of the major facilitator superfamily of ...
205-351 4.49e-05

MFS/sugar transport protein; This family is part of the major facilitator superfamily of membrane transport proteins.


Pssm-ID: 257676 [Multi-domain]  Cd Length: 423  Bit Score: 45.27  E-value: 4.49e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  205 GMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFV--QGYGTFLFCRLLSGVGIGGSIPIVFSYFSE 282
Cdd:pfam13347 258 SVLLLIGTIAAILGAPLWPWLAKRFGKKRTFLLGMLLAAIGLVLLFFLppGSVWLFLVLVVLIGIGLGLATLLPWAMLAD 337
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  283 -----FLAQEKRGEHLS---WLCMFWMIGGVYAAAMAWAIiphyGWS-FQMGSAYQFHS--WRVFVLVCAFPSVFAIGAL 351
Cdd:pfam13347 338 vvdygEWKTGKRREGIVfslYSFADKLGGALGGAIVGLLL----AFAgYVANATAQSAAalSGIRLLFTLIPAVLALLAL 413
PRK03893 PRK03893
putative sialic acid transporter; Provisional
218-320 7.33e-05

putative sialic acid transporter; Provisional


Pssm-ID: 179668 [Multi-domain]  Cd Length: 496  Bit Score: 44.69  E-value: 7.33e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 218 GAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLC 297
Cdd:PRK03893  71 GGLLLGAMGDRYGRRLAMVISIVLFSVGTLACGFAPGYWTLFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLI 150
                         90       100
                 ....*....|....*....|...
gi 194036298 298 MFWMIGGVYAAAMAWAIIPHYGW 320
Cdd:PRK03893 151 SGFSIGAVVAAQVYSLVVPVWGW 173
COG2270 COG2270
Permeases of the major facilitator superfamily [General function prediction only]
609-735 1.12e-04

Permeases of the major facilitator superfamily [General function prediction only]


Pssm-ID: 225179 [Multi-domain]  Cd Length: 438  Bit Score: 43.84  E-value: 1.12e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 609 LPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSESAMIaLLCLFGGVSIASWNALD-VLTVELYPSDKRTTAFG 687
Cdd:COG2270  302 ALGAIIAGFLDERFGSKPVLMIGLVILSIAALYLIFLEGELDFW-ILGLLVGTSLGGAQASSrSYLARLVPKGKEGRFFG 380
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 194036298 688 FLNALCKLAAVLGISIFTSFVGITK--AAPILFASAALALGSSLALKLPE 735
Cdd:COG2270  381 LYALTGRAASFLGPFLVAVITQITGssRAGVLSIIVLLLIGLLLLLRVKV 430
PRK10473 PRK10473
multidrug efflux system protein MdtL; Provisional
211-305 1.16e-04

multidrug efflux system protein MdtL; Provisional


Pssm-ID: 182486 [Multi-domain]  Cd Length: 392  Bit Score: 43.86  E-value: 1.16e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 211 VYLGMMVGAFLWGG-LADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKR 289
Cdd:PRK10473  46 VYLAGMAAAMLFAGkIADRSGRKPVAIPGAALFIIASLLCSLAETSSLFLAGRFLQGIGAGCCYVVAFAILRDTLDDRRR 125
                         90
                 ....*....|....*.
gi 194036298 290 GEHLSwlcmfwMIGGV 305
Cdd:PRK10473 126 AKVLS------LLNGI 135
NarK COG2223
Nitrate/nitrite transporter [Inorganic ion transport and metabolism]
206-342 2.25e-04

Nitrate/nitrite transporter [Inorganic ion transport and metabolism]


Pssm-ID: 225133 [Multi-domain]  Cd Length: 417  Bit Score: 43.02  E-value: 2.25e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 206 MLGLIVYLGMMVGAF---LWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQ-----------GYGTFLFCRLLSGVGIGG 271
Cdd:COG2223  255 TAGLIAFLFPLIGALarpLGGWLSDRIGGRRVTLAVFVGMALAAALLSLFLtgfghggsfvvFVAVFLALFVFAGLGNGS 334
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 194036298 272 SIPIVFSYFSEFLAQEkrgehLSWLCMFWMIGGVYaaamawaiIPH-YGWSFQMGSAYQ--FHSWRVFVLVCAF 342
Cdd:COG2223  335 VFKMIPVIFPKETGAV-----TGIVGAIGGLGGFF--------LPLaFGVSLDLTGSYTgaFMLLLAFYLVALV 395
SP TIGR00879
MFS transporter, sugar porter (SP) family; This model represent the sugar porter subfamily of ...
209-328 2.97e-04

MFS transporter, sugar porter (SP) family; This model represent the sugar porter subfamily of the major facilitator superfamily (pfam00083) [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].


Pssm-ID: 233165 [Multi-domain]  Cd Length: 481  Bit Score: 42.71  E-value: 2.97e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  209 LIVYLGMMVGAFLWGGLADRLGRRQCLLISlsvnsvfAFFSSFVQGYGTFLFCRLLSGVGIG-GSIPIVFSY-FSEFLAq 286
Cdd:TIGR00879 326 IIVGAVNFAFTFVAIFLVDRFGRRPLLLIG-------AAGMAICLFVLGILGASFVTGSSKSsGNVAIVFILlFIAFFA- 397
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 194036298  287 ekrgehLSWLCMFWMIG------GVYAAAMAWAIIPHYGWSFQMGSAY 328
Cdd:TIGR00879 398 ------MGWGPVPWVIVseifplSLRPKGISIAVAANWLANFIVGFLF 439
efflux_EmrB TIGR00711
drug resistance transporter, EmrB/QacA subfamily; This subfamily of drug efflux proteins, a ...
223-322 6.19e-04

drug resistance transporter, EmrB/QacA subfamily; This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].


Pssm-ID: 129794 [Multi-domain]  Cd Length: 485  Bit Score: 41.60  E-value: 6.19e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  223 GGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMI 302
Cdd:TIGR00711  58 GWLAKRFGTRRLFLISTFAFTLGSLLCGVAPNLELMIIFRVIQGFGGGPLIPLSFSTLLNIYPPEKRGRAMAIWGLTVLV 137
                          90       100
                  ....*....|....*....|
gi 194036298  303 GGVYAAAMAWAIIPHYGWSF 322
Cdd:TIGR00711 138 APALGPTLGGWIIENYHWRW 157
PRK15075 PRK15075
citrate-proton symporter; Provisional
217-348 6.29e-04

citrate-proton symporter; Provisional


Pssm-ID: 237902 [Multi-domain]  Cd Length: 434  Bit Score: 41.47  E-value: 6.29e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 217 VGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTF--------LFCRLLSGVGIGGSIPIVFSYFSEFLAQEK 288
Cdd:PRK15075  71 LGAIVLGAYIDRVGRRKGLIVTLSIMASGTLLIAFVPGYATIglaapllvLLGRLLQGFSAGVELGGVSVYLAEIATPGR 150
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 194036298 289 RGEHLSWLCMFWMIGGVYAAAMAWAI---IPHYgwsfQMGSAYqfhsWRV-FVLVCAF-PSVFAI 348
Cdd:PRK15075 151 KGFYTSWQSASQQVAVVFAALLGYLLnqwLSPA----QMAEWG----WRIpFLIGCLIvPFIFLI 207
PRK11102 PRK11102
bicyclomycin/multidrug efflux system; Provisional
213-266 1.10e-03

bicyclomycin/multidrug efflux system; Provisional


Pssm-ID: 182964 [Multi-domain]  Cd Length: 377  Bit Score: 40.67  E-value: 1.10e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....
gi 194036298 213 LGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSG 266
Cdd:PRK11102  37 LGFAIGQLFYGPMADSFGRKPVILGGTLVFALAAVACALAQTIDQLIYMRFLHG 90
MelB COG2211
Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism]
596-711 1.76e-03

Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism]


Pssm-ID: 225121 [Multi-domain]  Cd Length: 467  Bit Score: 39.92  E-value: 1.76e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 596 MVYFVSFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSC---FFLSFGNSESAMIALLCLFGGVSIAS---WNAL 669
Cdd:COG2211  273 FAYLLLLASGAGLLIGLILWPRLVKKFGKKKLFLIGLLLLAVGYlllYFTPAGSVVLIVVALIIAGVGTGIANplpWAMV 352
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 194036298 670 -DVLTVELYPSDKRTTafGFLNALCKLAAVLGISIFTSFVGIT 711
Cdd:COG2211  353 aDTVDYGEWKTGVRRE--GIVYSGMTFFRKLGLALAGFIPGWI 393
PRK11043 PRK11043
putative transporter; Provisional
214-269 2.25e-03

putative transporter; Provisional


Pssm-ID: 182924 [Multi-domain]  Cd Length: 401  Bit Score: 39.49  E-value: 2.25e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 194036298 214 GMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGI 269
Cdd:PRK11043  53 GFALGQLLWGPLSDRYGRKPVLLAGLSLFALGSLGMLWVESAAQLLVLRFVQAVGV 108
PRK09874 PRK09874
drug efflux system protein MdtG; Provisional
205-319 2.74e-03

drug efflux system protein MdtG; Provisional


Pssm-ID: 182127 [Multi-domain]  Cd Length: 408  Bit Score: 39.52  E-value: 2.74e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 205 GMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVgIGGSIPIVFSYFSEFL 284
Cdd:PRK09874  57 GLVFSITFLFSAIASPFWGGLADRKGRKIMLLRSALGMGIVMVLMGLAQNIWQFLILRALLGL-LGGFVPNANALIATQV 135
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 194036298 285 AQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYG 319
Cdd:PRK09874 136 PRNKSGWALGTLSTGGVSGALLGPLAGGLLADSYG 170
PRK10642 PRK10642
proline/glycine betaine transporter; Provisional
217-333 2.93e-03

proline/glycine betaine transporter; Provisional


Pssm-ID: 182611 [Multi-domain]  Cd Length: 490  Bit Score: 39.31  E-value: 2.93e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298 217 VGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGT--------FLFCRLLSGVGIGGSIPIVFSYFSEFLAQEK 288
Cdd:PRK10642  72 LGGLFFGMLGDKYGRQKILAITIVIMSISTFCIGLIPSYATigiwapilLLLCKMAQGFSVGGEYTGASIFVAEYSPDRK 151
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 194036298 289 RGEHLSWLCMFWMIGGVYAAAMAWAIiphygwSFQMGSAyQFHSW 333
Cdd:PRK10642 152 RGFMGSWLDFGSIAGFVLGAGVVVLI------STIVGEA-NFLDW 189
PRK15402 PRK15402
multidrug efflux system translocase MdfA; Provisional
209-270 2.94e-03

multidrug efflux system translocase MdfA; Provisional


Pssm-ID: 185300 [Multi-domain]  Cd Length: 406  Bit Score: 39.15  E-value: 2.94e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 194036298 209 LIVYL-GMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIG 270
Cdd:PRK15402  54 MTAYLaGGMFLQWLLGPLSDRIGRRPVMLAGVAFFILTCLAILLAQSIEQFTLLRFLQGIGLC 116
PHA03169 PHA03169
hypothetical protein; Provisional
69-118 6.16e-03

hypothetical protein; Provisional


Pssm-ID: 223003 [Multi-domain]  Cd Length: 413  Bit Score: 38.41  E-value: 6.16e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|
gi 194036298  69 EGAQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAP 118
Cdd:PHA03169 154 SHNPSPNQQPSSFLQPSHEDSPEEPEPPTSEPEPDSPGPPQSETPTSSPP 203
Sugar_tr pfam00083
Sugar (and other) transporter;
206-346 6.20e-03

Sugar (and other) transporter;


Pssm-ID: 249572 [Multi-domain]  Cd Length: 449  Bit Score: 38.44  E-value: 6.20e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194036298  206 MLGLIVYLGM-MVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSfvqgyGTFLFCRLLSGVGIgGSIPIVFSYFSEFL 284
Cdd:pfam00083 289 LLVTIIVGVVnFVFTFIAIFLVDRFGRRPLLLLGAAGMAICMLVLG-----VALLGVNSSKAAGI-VAIVFILLFIAFFA 362
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 194036298  285 aqekrgehLSWLCMFWMIG------GVYAAAMAWAIIPHYGWSF-------QMGSAYQFHSWRVFVLVCAFPSVF 346
Cdd:pfam00083 363 --------LGWGPVPWVIVselfplGVRPKAMAIATAANWLANFligflfpIITGAIGGYVFLVFAGLLVLFILF 429
PRK03893 PRK03893
putative sialic acid transporter; Provisional
213-280 9.10e-03

putative sialic acid transporter; Provisional


Pssm-ID: 179668 [Multi-domain]  Cd Length: 496  Bit Score: 37.76  E-value: 9.10e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 194036298 213 LGMMVGAFLWGGLADRLGRRQC----LLIS-LSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIP-IVFSYF 280
Cdd:PRK03893 322 FGAAVGCCVGGFLGDWLGTRKAyvcsLLISqLLIIPVFAIGGANVWVLGLLLFFQQMLGQGISGLLPkLIGGYF 395
emrD PRK11652
multidrug resistance protein D; Provisional
220-270 9.11e-03

multidrug resistance protein D; Provisional


Pssm-ID: 183259 [Multi-domain]  Cd Length: 394  Bit Score: 37.58  E-value: 9.11e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 194036298 220 FLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIG 270
Cdd:PRK11652  61 LFYGPLSDRVGRRPVILVGMSIFILGTLVALFAHSLTVLIAASAIQGLGTG 111
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH