NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|190684661|ref|NP_035313|]
View 

presenilin-2 [Mus musculus]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Presenilin pfam01080
Presenilin; Mutations in presenilin-1 are a major cause of early onset Alzheimer's ...
76-439 0e+00

Presenilin; Mutations in presenilin-1 are a major cause of early onset Alzheimer's disease. It has been found that presenilin-1 binds to beta-catenin in-vivo. This family also contains SPE proteins from C.elegans.


:

Pssm-ID: 250348  Cd Length: 403  Bit Score: 533.25  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661   76 EEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIVVMTIF 155
Cdd:pfam01080   1 EEESSLKYGAKHVIWLFVPVSLCMLLVVATIKSVSFYEQNNGSLLYTPFHSFTPTTGNKLLDSLINTLIMISVLVVMTFL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661  156 LVVLYKYRCYKFIHGWLIMSSLMLLFLFTYIYLGEVLKTYNVAMDYPTLFLAVWNFGAVGMVCIHWKGPLVLQQAYLIVI 235
Cdd:pfam01080  81 LVVFYKYRFYKIIHGWLILSSLLLLFLFSYIYLQEVFKAYNVPMDYPTVFLLIWNFGVVGMMCIHWKGPLRLQQFYLITN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661  236 SALMALVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIFPALIYSSA-MVWTVGMAKLD------ 308
Cdd:pfam01080 161 SALMALVFIKYLPEWTAWFVLAAISFWDLVAVLTPKGPLRMLVETAQERNEPIFPALIYSSTvVVLTVGSNQEEtnegtp 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661  309 -------------------PSSQGALQLPY---DPEMEEDSYDSFGEPS------YPEAFEAPLPGYPGEELEEEEE--- 357
Cdd:pfam01080 241 stirrtskstrsaanpdsaPTSHSTLELPEkssTPELSDDESDSSETESqsdsslAPEEDAAEQPEVQSNSLPSNEKree 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661  358 ---RGVKLGLGDFIFYSVLVGKAAATGngDWNTTLACFIAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFSTDNLV 434
Cdd:pfam01080 321 eeeRGVKLGLGDFIFYSVLVGKASATG--DWNTTIACFVAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFSTMFFV 398

                  ....*
gi 190684661  435 RPFMD 439
Cdd:pfam01080 399 TPFMD 403
 
Name Accession Description Interval E-value
Presenilin pfam01080
Presenilin; Mutations in presenilin-1 are a major cause of early onset Alzheimer's ...
76-439 0e+00

Presenilin; Mutations in presenilin-1 are a major cause of early onset Alzheimer's disease. It has been found that presenilin-1 binds to beta-catenin in-vivo. This family also contains SPE proteins from C.elegans.


Pssm-ID: 250348  Cd Length: 403  Bit Score: 533.25  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661   76 EEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIVVMTIF 155
Cdd:pfam01080   1 EEESSLKYGAKHVIWLFVPVSLCMLLVVATIKSVSFYEQNNGSLLYTPFHSFTPTTGNKLLDSLINTLIMISVLVVMTFL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661  156 LVVLYKYRCYKFIHGWLIMSSLMLLFLFTYIYLGEVLKTYNVAMDYPTLFLAVWNFGAVGMVCIHWKGPLVLQQAYLIVI 235
Cdd:pfam01080  81 LVVFYKYRFYKIIHGWLILSSLLLLFLFSYIYLQEVFKAYNVPMDYPTVFLLIWNFGVVGMMCIHWKGPLRLQQFYLITN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661  236 SALMALVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIFPALIYSSA-MVWTVGMAKLD------ 308
Cdd:pfam01080 161 SALMALVFIKYLPEWTAWFVLAAISFWDLVAVLTPKGPLRMLVETAQERNEPIFPALIYSSTvVVLTVGSNQEEtnegtp 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661  309 -------------------PSSQGALQLPY---DPEMEEDSYDSFGEPS------YPEAFEAPLPGYPGEELEEEEE--- 357
Cdd:pfam01080 241 stirrtskstrsaanpdsaPTSHSTLELPEkssTPELSDDESDSSETESqsdsslAPEEDAAEQPEVQSNSLPSNEKree 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661  358 ---RGVKLGLGDFIFYSVLVGKAAATGngDWNTTLACFIAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFSTDNLV 434
Cdd:pfam01080 321 eeeRGVKLGLGDFIFYSVLVGKASATG--DWNTTIACFVAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFSTMFFV 398

                  ....*
gi 190684661  435 RPFMD 439
Cdd:pfam01080 399 TPFMD 403
PSN smart00730
Presenilin, signal peptide peptidase, family; Presenilin 1 and presenilin 2 are polytopic ...
136-434 7.13e-75

Presenilin, signal peptide peptidase, family; Presenilin 1 and presenilin 2 are polytopic membrane proteins, whose genes are mutated in some individuals with Alzheimer's disease. Distant homologues, present in eukaryotes and archaea, also contain conserved aspartic acid residues which are predicted to contribute to catalysis. At least one member of this family has been shown to possess signal peptide peptidase activity.


Pssm-ID: 214793  Cd Length: 249  Bit Score: 237.15  E-value: 7.13e-75
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661   136 LNSVLNTLIMISVIVVMTIFLVVLYKYRCYKFIHGWLIMSSLMLLFLFTYIYLGEVLKtynvaMDYPTLFLAVWNFGAVG 215
Cdd:smart00730   1 EYSLLNSLVAIVFPIVATFVLVLLYKFFKYLVIVLVIYFSSLGVLFLYSLLYPLEVFR-----VDYPTLLILLLNFAVVG 75
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661   216 MVCIHWKgpLVLQQAYLIVISALMALVFIKYLP-EWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPI--FPAL 292
Cdd:smart00730  76 FWCIHRK--GAWIQQDLIGISLCMAILFILRLPsEWTAWILLGALFIYDIFAVFGTPGPLRVMVEVATGRDEPIkvFPAL 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661   293 IYSSAMVWtvgmakldpssqgalqlpyDPEMEEDSydsfgepsypeafeaplpgypgeeleeeeeRGVKLGLGDFIFYSV 372
Cdd:smart00730 154 LYVPRLVV-------------------SFEDDEEE------------------------------RFSMLGLGDIVFPGI 184
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 190684661   373 LVGKAAATGN---GDWNTTLACFIAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFSTDNLV 434
Cdd:smart00730 185 LVASAARFDVsvrSDSNYFLACFVAYGIGLILTLVLLALFKKAQPALPYLVPFTLVFYLLTALLR 249
 
Name Accession Description Interval E-value
Presenilin pfam01080
Presenilin; Mutations in presenilin-1 are a major cause of early onset Alzheimer's ...
76-439 0e+00

Presenilin; Mutations in presenilin-1 are a major cause of early onset Alzheimer's disease. It has been found that presenilin-1 binds to beta-catenin in-vivo. This family also contains SPE proteins from C.elegans.


Pssm-ID: 250348  Cd Length: 403  Bit Score: 533.25  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661   76 EEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIVVMTIF 155
Cdd:pfam01080   1 EEESSLKYGAKHVIWLFVPVSLCMLLVVATIKSVSFYEQNNGSLLYTPFHSFTPTTGNKLLDSLINTLIMISVLVVMTFL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661  156 LVVLYKYRCYKFIHGWLIMSSLMLLFLFTYIYLGEVLKTYNVAMDYPTLFLAVWNFGAVGMVCIHWKGPLVLQQAYLIVI 235
Cdd:pfam01080  81 LVVFYKYRFYKIIHGWLILSSLLLLFLFSYIYLQEVFKAYNVPMDYPTVFLLIWNFGVVGMMCIHWKGPLRLQQFYLITN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661  236 SALMALVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIFPALIYSSA-MVWTVGMAKLD------ 308
Cdd:pfam01080 161 SALMALVFIKYLPEWTAWFVLAAISFWDLVAVLTPKGPLRMLVETAQERNEPIFPALIYSSTvVVLTVGSNQEEtnegtp 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661  309 -------------------PSSQGALQLPY---DPEMEEDSYDSFGEPS------YPEAFEAPLPGYPGEELEEEEE--- 357
Cdd:pfam01080 241 stirrtskstrsaanpdsaPTSHSTLELPEkssTPELSDDESDSSETESqsdsslAPEEDAAEQPEVQSNSLPSNEKree 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661  358 ---RGVKLGLGDFIFYSVLVGKAAATGngDWNTTLACFIAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFSTDNLV 434
Cdd:pfam01080 321 eeeRGVKLGLGDFIFYSVLVGKASATG--DWNTTIACFVAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFSTMFFV 398

                  ....*
gi 190684661  435 RPFMD 439
Cdd:pfam01080 399 TPFMD 403
PSN smart00730
Presenilin, signal peptide peptidase, family; Presenilin 1 and presenilin 2 are polytopic ...
136-434 7.13e-75

Presenilin, signal peptide peptidase, family; Presenilin 1 and presenilin 2 are polytopic membrane proteins, whose genes are mutated in some individuals with Alzheimer's disease. Distant homologues, present in eukaryotes and archaea, also contain conserved aspartic acid residues which are predicted to contribute to catalysis. At least one member of this family has been shown to possess signal peptide peptidase activity.


Pssm-ID: 214793  Cd Length: 249  Bit Score: 237.15  E-value: 7.13e-75
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661   136 LNSVLNTLIMISVIVVMTIFLVVLYKYRCYKFIHGWLIMSSLMLLFLFTYIYLGEVLKtynvaMDYPTLFLAVWNFGAVG 215
Cdd:smart00730   1 EYSLLNSLVAIVFPIVATFVLVLLYKFFKYLVIVLVIYFSSLGVLFLYSLLYPLEVFR-----VDYPTLLILLLNFAVVG 75
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661   216 MVCIHWKgpLVLQQAYLIVISALMALVFIKYLP-EWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPI--FPAL 292
Cdd:smart00730  76 FWCIHRK--GAWIQQDLIGISLCMAILFILRLPsEWTAWILLGALFIYDIFAVFGTPGPLRVMVEVATGRDEPIkvFPAL 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190684661   293 IYSSAMVWtvgmakldpssqgalqlpyDPEMEEDSydsfgepsypeafeaplpgypgeeleeeeeRGVKLGLGDFIFYSV 372
Cdd:smart00730 154 LYVPRLVV-------------------SFEDDEEE------------------------------RFSMLGLGDIVFPGI 184
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 190684661   373 LVGKAAATGN---GDWNTTLACFIAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFSTDNLV 434
Cdd:smart00730 185 LVASAARFDVsvrSDSNYFLACFVAYGIGLILTLVLLALFKKAQPALPYLVPFTLVFYLLTALLR 249
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH