NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|189910473|ref|YP_001962028|]
View 

two component response regulator sensor histidine kinase/response regulator subunits [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
696-811 5.61e-36

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


:

Pssm-ID: 238088  Cd Length: 113  Bit Score: 133.47  E-value: 5.61e-36
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  696 IVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRdEGPFELMVLDIMMPGMSGYDVCTVLRESYSlyQLPILFLTA 775
Cdd:cd00156     1 LIVDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLA-EEKPDLILLDIMMPGMDGLELLRRIRKRGP--DIPIIFLTA 77
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 189910473  776 KNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLI 811
Cdd:cd00156    78 HGDDEDAVEALKAGADDYLTKPFSPEELLARIRALL 113
HATPase_c cd00075
Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: ...
547-649 3.12e-33

Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins


:

Pssm-ID: 238030  Cd Length: 103  Bit Score: 125.45  E-value: 3.12e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  547 LQQILFNIIGNAIKFTEK--GRIDVSAEIIEKMAVISIRDTGIGIPKDKFGDIFRSFeqVDASTTRKFGGTGLGLAISKR 624
Cdd:cd00075     1 LQQVLLNLLSNAIKHTPEggGRITISVERDGDHLEIRVEDNGPGIPEEDLERIFERF--SDGSRSRKGGGTGLGLSIVKK 78
                          90       100
                  ....*....|....*....|....*
gi 189910473  625 LVELHGGNIWVESTPAEGSMFSFSL 649
Cdd:cd00075    79 LVELHGGRIEVESEPGGGTTFTITL 103
HisKA cd00082
Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed ...
426-492 3.92e-16

Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase. They subsequently transfer the phosphoryl group to the Asp acceptor residue of a response regulator protein. Two-component signalling systems, consisting of a histidine protein kinase that senses a signal input and a response regulator that mediates the output, are ancient and evolutionarily conserved signaling mechanisms in prokaryotes and eukaryotes.


:

Pssm-ID: 119399  Cd Length: 65  Bit Score: 74.94  E-value: 3.92e-16
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 189910473  426 DKLKDEFLANTSHELKTPLNGIIGIAESMFDGIGGklNQEQRQNLGMIVSSGKRLSSLVDDILDFSK 492
Cdd:cd00082     1 LQAKGEFLANVSHELRTPLTAIRGALELLEEELLD--DEEQREYLERIREEAERLLRLINDLLDLSR 65
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
874-1064 4.21e-44

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


:

Pssm-ID: 254114  Cd Length: 192  Bit Score: 159.38  E-value: 4.21e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   874 SETELGVLIADVSGHGIPAALVSAMLKIAFSTQVRLAKEPSQLLNQINSTLLGKMKGA-FVTASYVYINLETKEMIHARC 952
Cdd:pfam07228    1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGErFATAVLAVYDPETGTLEYANA 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   953 GHPPLIINRRGESKAKLSIPQGKLIGWIPELDIQEDRISIRSGDRIVLYTDGITEATNANREMIGQDNWESMSHRYSGYP 1032
Cdd:pfam07228   81 GHPPPLLLRPDGGVVELLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAERHGLS 160
                          170       180       190
                   ....*....|....*....|....*....|..
gi 189910473  1033 LTESKRLLLETIKEFTGNRsPDDDVTLVILEI 1064
Cdd:pfam07228  161 PEELLDALLEDLLRLGGGE-LEDDITLLVLRV 191
7TMR-DISM_7TM pfam07695
7TM diverse intracellular signalling; This entry represents the transmembrane region of the ...
211-407 1.17e-15

7TM diverse intracellular signalling; This entry represents the transmembrane region of the 7TM-DISM (7TM Receptors with Diverse Intracellular Signalling Modules).


:

Pssm-ID: 254365  Cd Length: 207  Bit Score: 76.90  E-value: 1.17e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   211 FLAGSVFIIALYHFGLFYFRRtDRGNLLFGFAALLLALRTLFTGErFVFNELAPILSWNVCLRIEYFTFYLSPYLFFTFF 290
Cdd:pfam07695    7 LFYGILLALALYNLFLFFSLR-DRSYLYYVLYILSFLLYQLSLNG-LGFQYLWPNSPPWLNNKLLYLFLALLVIFFALLF 84
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   291 --RGFYPDYYPKWMHRSLLFPTLVFISFLLFLPTQIYPELNSYYQIVFLFGILMILQGVFRAAYHRKESGFLFLVGISTV 368
Cdd:pfam07695   85 arSFLELKKYLPRLDRLLLGLALLLLLLLLLAPLFPYTLSLRLAQLLALLFILFLLVLGIIAWRKGYKPARYFLLAWLIL 164
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|...
gi 189910473   369 AIAAFVDLLNANQI----FYSVEAIPIGIFVFILVQSLTLSRR 407
Cdd:pfam07695  165 LIGALIDILSLLGLlpsnFFTLYLLQIGSLLEVLLLSLALADR 207
Glyco_hydro_2_N super family cl18398
Glycosyl hydrolases family 2, sugar binding domain; This family contains beta-galactosidase, ...
57-142 9.09e-04

Glycosyl hydrolases family 2, sugar binding domain; This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold.


The actual alignment was detected with superfamily member pfam02837:

Pssm-ID: 251564  Cd Length: 159  Bit Score: 39.55  E-value: 9.09e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473    57 MHLEGDWEFY-------PRQFLSESERRDFPFQHLTVPGIWNsVLGSG-------EGYGTYRLVLQRPKNLENDQVFgIK 122
Cdd:pfam02837    5 QSLNGGWRFKladnpdgRPEGFYKADFDDSDWEEIPVPSNWE-LQGYDkpvprdyNGVGWYRRTFTVPADWKGKRVF-LR 82
                           90       100
                   ....*....|....*....|
gi 189910473   123 ILDVATASRVYWNGKFLGSS 142
Cdd:pfam02837   83 FEGVDSAAYVWVNGEFVGYH 102
BaeS COG0642
Signal transduction histidine kinase [Signal transduction mechanisms]
317-656 7.14e-59

Signal transduction histidine kinase [Signal transduction mechanisms]


:

Pssm-ID: 223715 [Multi-domain]  Cd Length: 336  Bit Score: 206.53  E-value: 7.14e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  317 LLFLPTQIYPELNSYYQIVFLFGILMILQGVFRAAYHRKESGFLFLVGISTVAIAAFVDLLNANQIFYSVEAIPIGIFVF 396
Cdd:COG0642     2 LALQLALVLTLLLALFVPLALLLIFLPSLAVARNELLLLLLLTLLAALLVALLLLLLLLRRLLRPLLLLADAANALAAGL 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  397 ILVQSLTLSRRFSRAFSEVETLSKRL-LALDKLKDEFLANTSHELKTPLNGIIGIAESMFDGiggkLNQEQRQNLGMIVS 475
Cdd:COG0642    82 TRLVLASLGSELASLAHALNELLERLeRLLRRAKREFLANISHELRTPLTAIRGLLELLLEG----LLDPQRELLEIIEE 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  476 SGKRLSSLVDDILDFSKMKNRD-LDLDLKAIDLHQICDFVLVISRPLYVTKNLTVRNNVPIDfPPILGDEARLQQILFNI 554
Cdd:COG0642   158 EAERLLRLVNDLLDLSRLEAGTkLKLLLELVDLAELLEEVVRLLAPLAQEKGIELAVDLPEL-PYVLGDPERLRQVLVNL 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  555 IGNAIKFTEKGRIDVSAEIIEKMAVISIRDTGIGIPKDKFGDIFRSFEQVDASTTrkfgGTGLGLAISKRLVELHGGNIW 634
Cdd:COG0642   237 LSNAIKYTPGGEITISVRQDDEQVTISVEDTGPGIPEEELERIFEPFFRTDKSRS----GTGLGLAIVKRIVELHGGTIS 312
                         330       340
                  ....*....|....*....|..
gi 189910473  635 VESTPAEGSMFSFSLPLAREGE 656
Cdd:COG0642   313 VESEPGKGTTFTIRLPLAPAAA 334
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
817-1064 1.82e-40

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


:

Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 154.10  E-value: 1.82e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  817 VEEQNKFIAiqnELGLARKLQYSILPEEAPNVVGIKTEFYYEPMDSIGGDFFDFHAISETELGVLIADVSGHGIPAALVS 896
Cdd:COG2208   118 LLEQNNISA---ELEVARQIQQNLLPKALPLFPGIDIEAILVPASEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLM 194
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  897 AMLKIAFSTQVRLA-KEPSQLLNQINSTLLGKMKGA-FVTASYVYINLETKEMIHARCGHPPLIInRRGESKAKLSIPQ- 973
Cdd:COG2208   195 LMPKLALRLLLESGpLDPADVLETLNRVLKQNLEEDmFVTLFLGVYDLDSGELTYSNAGHEPALI-LSADGEIEVEDLTa 273
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  974 -GKLIGWIPELDIQEDRISIRSGDRIVLYTDGITEATNANREMIGQDNWESMSHRYSGYPLTESKRLLLETIKEFTGNRS 1052
Cdd:COG2208   274 lGLPIGLLPDYQYEVASLQLEPGDLLVLYTDGVTEARNSDGEFFGLERLLKILGRLLGQPAEEILEAILESLEELQGDQI 353
                         250
                  ....*....|..
gi 189910473 1053 PDDDVTLVILEI 1064
Cdd:COG2208   354 QDDDITLLVLKV 365
OmpR COG0745
Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding ...
694-811 1.78e-30

Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]


:

Pssm-ID: 223816 [Multi-domain]  Cd Length: 229  Bit Score: 121.25  E-value: 1.78e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEgpFELMVLDIMMPGMSGYDVCTVLRESySLYQLPILFL 773
Cdd:COG0745     2 RILLVEDDPELAELLKEYLEEEGYEVDVAADGEEALEAAREQ--PDLVLLDLMLPDLDGLELCRRLRAK-KGSGPPIIVL 78
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 189910473  774 TAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLI 811
Cdd:COG0745    79 TARDDEEDRVLGLEAGADDYLTKPFSPRELLARLRALL 116
 
Name Accession Description Interval E-value
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
696-811 5.61e-36

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088  Cd Length: 113  Bit Score: 133.47  E-value: 5.61e-36
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  696 IVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRdEGPFELMVLDIMMPGMSGYDVCTVLRESYSlyQLPILFLTA 775
Cdd:cd00156     1 LIVDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLA-EEKPDLILLDIMMPGMDGLELLRRIRKRGP--DIPIIFLTA 77
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 189910473  776 KNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLI 811
Cdd:cd00156    78 HGDDEDAVEALKAGADDYLTKPFSPEELLARIRALL 113
HATPase_c cd00075
Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: ...
547-649 3.12e-33

Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins


Pssm-ID: 238030  Cd Length: 103  Bit Score: 125.45  E-value: 3.12e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  547 LQQILFNIIGNAIKFTEK--GRIDVSAEIIEKMAVISIRDTGIGIPKDKFGDIFRSFeqVDASTTRKFGGTGLGLAISKR 624
Cdd:cd00075     1 LQQVLLNLLSNAIKHTPEggGRITISVERDGDHLEIRVEDNGPGIPEEDLERIFERF--SDGSRSRKGGGTGLGLSIVKK 78
                          90       100
                  ....*....|....*....|....*
gi 189910473  625 LVELHGGNIWVESTPAEGSMFSFSL 649
Cdd:cd00075    79 LVELHGGRIEVESEPGGGTTFTITL 103
HisKA cd00082
Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed ...
426-492 3.92e-16

Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase. They subsequently transfer the phosphoryl group to the Asp acceptor residue of a response regulator protein. Two-component signalling systems, consisting of a histidine protein kinase that senses a signal input and a response regulator that mediates the output, are ancient and evolutionarily conserved signaling mechanisms in prokaryotes and eukaryotes.


Pssm-ID: 119399  Cd Length: 65  Bit Score: 74.94  E-value: 3.92e-16
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 189910473  426 DKLKDEFLANTSHELKTPLNGIIGIAESMFDGIGGklNQEQRQNLGMIVSSGKRLSSLVDDILDFSK 492
Cdd:cd00082     1 LQAKGEFLANVSHELRTPLTAIRGALELLEEELLD--DEEQREYLERIREEAERLLRLINDLLDLSR 65
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
874-1064 4.21e-44

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 159.38  E-value: 4.21e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   874 SETELGVLIADVSGHGIPAALVSAMLKIAFSTQVRLAKEPSQLLNQINSTLLGKMKGA-FVTASYVYINLETKEMIHARC 952
Cdd:pfam07228    1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGErFATAVLAVYDPETGTLEYANA 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   953 GHPPLIINRRGESKAKLSIPQGKLIGWIPELDIQEDRISIRSGDRIVLYTDGITEATNANREMIGQDNWESMSHRYSGYP 1032
Cdd:pfam07228   81 GHPPPLLLRPDGGVVELLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAERHGLS 160
                          170       180       190
                   ....*....|....*....|....*....|..
gi 189910473  1033 LTESKRLLLETIKEFTGNRsPDDDVTLVILEI 1064
Cdd:pfam07228  161 PEELLDALLEDLLRLGGGE-LEDDITLLVLRV 191
HATPase_c smart00387
Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.
542-652 6.67e-38

Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.


Pssm-ID: 214643  Cd Length: 111  Bit Score: 138.94  E-value: 6.67e-38
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473    542 GDEARLQQILFNIIGNAIKFT-EKGRIDVSAEIIEKMAVISIRDTGIGIPKDKFGDIFRSFEQVDaSTTRKFGGTGLGLA 620
Cdd:smart00387    1 GDPDRLRQVLSNLLDNAIKYTpEGGRITVTLERDGDHVEITVEDNGPGIPPEDLEKIFEPFFRTD-KRSRKIGGTGLGLS 79
                            90       100       110
                    ....*....|....*....|....*....|..
gi 189910473    621 ISKRLVELHGGNIWVESTPAEGSMFSFSLPLA 652
Cdd:smart00387   80 IVKKLVELHGGEISVESEPGGGTTFTITLPLE 111
HATPase_c pfam02518
Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; This family represents the ...
542-652 1.33e-34

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; This family represents the structurally related ATPase domains of histidine kinase, DNA gyrase B and HSP90.


Pssm-ID: 251347  Cd Length: 111  Bit Score: 129.36  E-value: 1.33e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   542 GDEARLQQILFNIIGNAIKFT-EKGRIDVSAEIIEKMAVISIRDTGIGIPKDKFGDIFRSFEQVDASTTrKFGGTGLGLA 620
Cdd:pfam02518    1 GDEDRLRQVLSNLLDNAIKHApAGGEIEVTLERDGGRLRITVEDNGIGIPPEDLPKIFEPFFRTDGSRS-KVGGTGLGLS 79
                           90       100       110
                   ....*....|....*....|....*....|..
gi 189910473   621 ISKRLVELHGGNIWVESTPAEGSMFSFSLPLA 652
Cdd:pfam02518   80 IVRKLVELHGGTITVESEPGGGTTFTLTLPLE 111
Response_reg pfam00072
Response regulator receiver domain; This domain receives the signal from the sensor partner in ...
695-808 4.99e-34

Response regulator receiver domain; This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.


Pssm-ID: 249561  Cd Length: 111  Bit Score: 127.69  E-value: 4.99e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   695 VIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRdEGPFELMVLDIMMPGMSGYDVCTVLRESYslYQLPILFLT 774
Cdd:pfam00072    1 VLIVDDDPLIRELLRQLLEKEGYVVAEADDGEEALELLK-EKRPDLILLDIRMPGMDGLELLRRIRRRP--PTTPVIVLT 77
                           90       100       110
                   ....*....|....*....|....*....|....
gi 189910473   775 AKNQIADIIAALEAGGNDYLAKPFDKRELISRAK 808
Cdd:pfam00072   78 AHGDEEDAVEALKAGANDFLSKPFDPEELLAALR 111
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
856-1013 1.22e-32

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 126.69  E-value: 1.22e-32
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473    856 YYEPMDSIGGDFFDFHAISETELGVLIADVSGHGIPAALVSAMLKIAFSTQVRLAKEPSQLLNQINSTLLGKM-KGAFVT 934
Cdd:smart00331    9 YYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYENGeDGMFAT 88
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473    935 ASYVYINLETKEMIHARCGHPPLIInRRGESKAKLSIP-QGKLIGWIPELDIQEDRISIRSGDRIVLYTDGITEATNANR 1013
Cdd:smart00331   89 LFLALYDFAGGTLSYANAGHSPPYL-LRADGGLVEDLDdLGAPLGLEPDVEVDVRELTLEPGDLLLLYTDGLTEARNPER 167
CheY COG0784
FOG: CheY-like receiver [Signal transduction mechanisms]
692-817 8.24e-31

FOG: CheY-like receiver [Signal transduction mechanisms]


Pssm-ID: 223855  Cd Length: 130  Bit Score: 119.18  E-value: 8.24e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  692 KLRVIVVDDEPINRQVLKNHLTLIGCEVREAANG-VDAIRLVRDEGPFELMVLDIMMPGMSGYDVCTVLRESYSlyQLPI 770
Cdd:COG0784     5 GLRVLVVDDEPVNRRLLKRLLEDLGYEVVEAADGeEEALELLRELPQPDLILLDINMPGMDGIELLRRLRARGP--NIPV 82
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 189910473  771 LFLTAKNQIADIIAALEAGGNDYLAKP-FDKRELISRAKNLITLKKAV 817
Cdd:COG0784    83 ILLTAYADEADRERALAAGADDYLTKPiFLEEELLAALRRLLARAAAE 130
HisKA pfam00512
His Kinase A (phospho-acceptor) domain; Dimerization and phospho-acceptor domain of histidine ...
429-495 1.68e-17

His Kinase A (phospho-acceptor) domain; Dimerization and phospho-acceptor domain of histidine kinases.


Pssm-ID: 249920  Cd Length: 66  Bit Score: 79.14  E-value: 1.68e-17
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 189910473   429 KDEFLANTSHELKTPLNGIIGIAESMFDgigGKLNQEQRQNLGMIVSSGKRLSSLVDDILDFSKMKN 495
Cdd:pfam00512    2 KSEFLANLSHELRTPLTAIRGYLELLLD---TELSEEQREYLETILRSAERLLRLINDLLDLSRIEA 65
PRK10610 PRK10610
chemotaxis regulatory protein CheY; Provisional
693-798 2.05e-17

chemotaxis regulatory protein CheY; Provisional


Pssm-ID: 170568  Cd Length: 129  Bit Score: 80.40  E-value: 2.05e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  693 LRVIVVDDEPINRQVLKNHLTLIGCE-VREAANGVDAIRLVRdEGPFELMVLDIMMPGMSGYDVCTVLRESYSLYQLPIL 771
Cdd:PRK10610    6 LKFLVVDDFSTMRRIVRNLLKELGFNnVEEAEDGVDALNKLQ-AGGFGFVISDWNMPNMDGLELLKTIRADGAMSALPVL 84
                          90       100
                  ....*....|....*....|....*..
gi 189910473  772 FLTAKNQIADIIAALEAGGNDYLAKPF 798
Cdd:PRK10610   85 MVTAEAKKENIIAAAQAGASGYVVKPF 111
HisKA smart00388
His Kinase A (phosphoacceptor) domain; Dimerisation and phosphoacceptor domain of histidine ...
429-493 1.37e-16

His Kinase A (phosphoacceptor) domain; Dimerisation and phosphoacceptor domain of histidine kinases.


Pssm-ID: 214644  Cd Length: 66  Bit Score: 76.45  E-value: 1.37e-16
                            10        20        30        40        50        60
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 189910473    429 KDEFLANTSHELKTPLNGIIGIAESMFDgigGKLNQEQRQNLGMIVSSGKRLSSLVDDILDFSKM 493
Cdd:smart00388    2 KREFLANLSHELRTPLTAIRGYLELLLD---TELSEEQREYLETILREAERLLRLINDLLDLSRI 63
7TMR-DISM_7TM pfam07695
7TM diverse intracellular signalling; This entry represents the transmembrane region of the ...
211-407 1.17e-15

7TM diverse intracellular signalling; This entry represents the transmembrane region of the 7TM-DISM (7TM Receptors with Diverse Intracellular Signalling Modules).


Pssm-ID: 254365  Cd Length: 207  Bit Score: 76.90  E-value: 1.17e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   211 FLAGSVFIIALYHFGLFYFRRtDRGNLLFGFAALLLALRTLFTGErFVFNELAPILSWNVCLRIEYFTFYLSPYLFFTFF 290
Cdd:pfam07695    7 LFYGILLALALYNLFLFFSLR-DRSYLYYVLYILSFLLYQLSLNG-LGFQYLWPNSPPWLNNKLLYLFLALLVIFFALLF 84
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   291 --RGFYPDYYPKWMHRSLLFPTLVFISFLLFLPTQIYPELNSYYQIVFLFGILMILQGVFRAAYHRKESGFLFLVGISTV 368
Cdd:pfam07695   85 arSFLELKKYLPRLDRLLLGLALLLLLLLLLAPLFPYTLSLRLAQLLALLFILFLLVLGIIAWRKGYKPARYFLLAWLIL 164
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|...
gi 189910473   369 AIAAFVDLLNANQI----FYSVEAIPIGIFVFILVQSLTLSRR 407
Cdd:pfam07695  165 LIGALIDILSLLGLlpsnFFTLYLLQIGSLLEVLLLSLALADR 207
REC smart00448
cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar ...
693-748 9.49e-13

cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar motors. This domain contains a phosphoacceptor site that is phosphorylated by histidine kinase homologues.


Pssm-ID: 214668  Cd Length: 55  Bit Score: 64.90  E-value: 9.49e-13
                            10        20        30        40        50
                    ....*....|....*....|....*....|....*....|....*....|....*.
gi 189910473    693 LRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRdEGPFELMVLDIMMP 748
Cdd:smart00448    1 MRILVVDDDPLLRELLKALLEKEGYEVDEATDGEEALELLK-EEKPDLILLDIMMP 55
Glyco_hydro_2_N pfam02837
Glycosyl hydrolases family 2, sugar binding domain; This family contains beta-galactosidase, ...
57-142 9.09e-04

Glycosyl hydrolases family 2, sugar binding domain; This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold.


Pssm-ID: 251564  Cd Length: 159  Bit Score: 39.55  E-value: 9.09e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473    57 MHLEGDWEFY-------PRQFLSESERRDFPFQHLTVPGIWNsVLGSG-------EGYGTYRLVLQRPKNLENDQVFgIK 122
Cdd:pfam02837    5 QSLNGGWRFKladnpdgRPEGFYKADFDDSDWEEIPVPSNWE-LQGYDkpvprdyNGVGWYRRTFTVPADWKGKRVF-LR 82
                           90       100
                   ....*....|....*....|
gi 189910473   123 ILDVATASRVYWNGKFLGSS 142
Cdd:pfam02837   83 FEGVDSAAYVWVNGEFVGYH 102
BaeS COG0642
Signal transduction histidine kinase [Signal transduction mechanisms]
317-656 7.14e-59

Signal transduction histidine kinase [Signal transduction mechanisms]


Pssm-ID: 223715 [Multi-domain]  Cd Length: 336  Bit Score: 206.53  E-value: 7.14e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  317 LLFLPTQIYPELNSYYQIVFLFGILMILQGVFRAAYHRKESGFLFLVGISTVAIAAFVDLLNANQIFYSVEAIPIGIFVF 396
Cdd:COG0642     2 LALQLALVLTLLLALFVPLALLLIFLPSLAVARNELLLLLLLTLLAALLVALLLLLLLLRRLLRPLLLLADAANALAAGL 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  397 ILVQSLTLSRRFSRAFSEVETLSKRL-LALDKLKDEFLANTSHELKTPLNGIIGIAESMFDGiggkLNQEQRQNLGMIVS 475
Cdd:COG0642    82 TRLVLASLGSELASLAHALNELLERLeRLLRRAKREFLANISHELRTPLTAIRGLLELLLEG----LLDPQRELLEIIEE 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  476 SGKRLSSLVDDILDFSKMKNRD-LDLDLKAIDLHQICDFVLVISRPLYVTKNLTVRNNVPIDfPPILGDEARLQQILFNI 554
Cdd:COG0642   158 EAERLLRLVNDLLDLSRLEAGTkLKLLLELVDLAELLEEVVRLLAPLAQEKGIELAVDLPEL-PYVLGDPERLRQVLVNL 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  555 IGNAIKFTEKGRIDVSAEIIEKMAVISIRDTGIGIPKDKFGDIFRSFEQVDASTTrkfgGTGLGLAISKRLVELHGGNIW 634
Cdd:COG0642   237 LSNAIKYTPGGEITISVRQDDEQVTISVEDTGPGIPEEELERIFEPFFRTDKSRS----GTGLGLAIVKRIVELHGGTIS 312
                         330       340
                  ....*....|....*....|..
gi 189910473  635 VESTPAEGSMFSFSLPLAREGE 656
Cdd:COG0642   313 VESEPGKGTTFTIRLPLAPAAA 334
TMAO_torS TIGR02956
TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the ...
429-805 9.18e-72

TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072) [Signal transduction, Two-component systems].


Pssm-ID: 234070 [Multi-domain]  Cd Length: 968  Bit Score: 257.40  E-value: 9.18e-72
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   429 KDEFLANTSHELKTPLNGIIGIAESMFDGiggKLNQEQRQNLGMIVSSGKRLSSLVDDILDFSKMKNRDLDLDLKAIDLH 508
Cdd:TIGR02956  464 KSAFLATMSHEIRTPLNGILGTLELLGDT---GLTSQQQQYLQVINRSGESLLDILNDILDYSKIEAGHLSISPRPFDLN 540
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   509 QICDFVLVISRPLYVTKNLTVRNNVPIDFPP-ILGDEARLQQILFNIIGNAIKFTEKGRIDVSAEIIEKMAV-ISIRDTG 586
Cdd:TIGR02956  541 ALLDDVHHLMVSRAQLKGIQLRLNIPEQLPNwWQGDGPRIRQVLINLVGNAIKFTDRGSVVLRVSLNDDSSLlFEVEDTG 620
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   587 IGIPKDKFGDIFRSFEQVDASttRKFGGTGLGLAISKRLVELHGGNIWVESTPAEGSMFSFSLPLAReGEiPMEKPQLKk 666
Cdd:TIGR02956  621 CGIAEEEQATLFDAFTQADGR--RRSGGTGLGLAISQRLVEAMDGELGVESELGVGSCFWFTLPLTR-GK-PAEDSATL- 695
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   667 semwfggdnfefEPIEETQeelegekLRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGpFELMVLDIM 746
Cdd:TIGR02956  696 ------------TVIDLPP-------QRVLLVEDNEVNQMVAQGFLTRLGHKVTLAESGQSALECFHQHA-FDLALLDIN 755
                          330       340       350       360       370       380
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   747 MPGMSGYDVCTVLRESY-SLYQLPILFLTAKNQIADIIAALEAGGNDYLAKPFDKRELIS 805
Cdd:TIGR02956  756 LPDGDGVTLLQQLRAIYgAKNEVKFIAFSAHVFNEDVAQYLAAGFDGFLAKPVVEEQLTA 815
PRK11091 PRK11091
aerobic respiration control sensor protein ArcB; Provisional
429-820 2.30e-63

aerobic respiration control sensor protein ArcB; Provisional


Pssm-ID: 236842 [Multi-domain]  Cd Length: 779  Bit Score: 229.44  E-value: 2.30e-63
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  429 KDEFLANTSHELKTPLNGIIGIAESMFDGiggKLNQEQRQNLGMIVSSGKRLSSLVDDILDFSKMKNRDLDLDLKAIDLH 508
Cdd:PRK11091  283 KTTFISTISHELRTPLNGIVGLSRILLDT---ELTAEQRKYLKTIHVSAITLGNIFNDIIDMDKMERRKLQLDNQPIDFT 359
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  509 QICDFVLVISRPLYVTKNLTVRNNVPIDFPP-ILGDEARLQQILFNIIGNAIKFTEKGRI--DVSAEIiEKMAVISIRDT 585
Cdd:PRK11091  360 DFLADLENLSGLQAEQKGLRFDLEPLLPLPHkVITDGTRLRQILWNLISNAVKFTQQGGVtvRVRYEE-GDMLTFEVEDS 438
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  586 GIGIPKDKFGDIFRSFEQVDASTTRKFG-GTGLGLAISKRLVELHGGNIWVESTPAEGSMFSFSLPL---AREGEIPMEK 661
Cdd:PRK11091  439 GIGIPEDELDKIFAMYYQVKDSHGGKPAtGTGIGLAVSKRLAQAMGGDITVTSEEGKGSCFTLTIHApavAEEVEDAFDE 518
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  662 PQLKksemwfggdnfefepieetqeeleGEKLRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVrDEGPFELM 741
Cdd:PRK11091  519 DDMP------------------------LPALNILLVEDIELNVIVARSVLEKLGNSVDVAMTGKEALEMF-DPDEYDLV 573
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  742 VLDIMMPGMSGYDVCTVLRESYSLYQL-PILFLTAkNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLITLKKAVEEQ 820
Cdd:PRK11091  574 LLDIQLPDMTGLDIARELRERYPREDLpPLVALTA-NVLKDKKEYLDAGMDDVLSKPLSVPALTAMIKKFWDTQDDEEST 652
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
817-1064 1.82e-40

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 154.10  E-value: 1.82e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  817 VEEQNKFIAiqnELGLARKLQYSILPEEAPNVVGIKTEFYYEPMDSIGGDFFDFHAISETELGVLIADVSGHGIPAALVS 896
Cdd:COG2208   118 LLEQNNISA---ELEVARQIQQNLLPKALPLFPGIDIEAILVPASEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLM 194
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  897 AMLKIAFSTQVRLA-KEPSQLLNQINSTLLGKMKGA-FVTASYVYINLETKEMIHARCGHPPLIInRRGESKAKLSIPQ- 973
Cdd:COG2208   195 LMPKLALRLLLESGpLDPADVLETLNRVLKQNLEEDmFVTLFLGVYDLDSGELTYSNAGHEPALI-LSADGEIEVEDLTa 273
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  974 -GKLIGWIPELDIQEDRISIRSGDRIVLYTDGITEATNANREMIGQDNWESMSHRYSGYPLTESKRLLLETIKEFTGNRS 1052
Cdd:COG2208   274 lGLPIGLLPDYQYEVASLQLEPGDLLVLYTDGVTEARNSDGEFFGLERLLKILGRLLGQPAEEILEAILESLEELQGDQI 353
                         250
                  ....*....|..
gi 189910473 1053 PDDDVTLVILEI 1064
Cdd:COG2208   354 QDDDITLLVLKV 365
OmpR COG0745
Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding ...
694-811 1.78e-30

Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]


Pssm-ID: 223816 [Multi-domain]  Cd Length: 229  Bit Score: 121.25  E-value: 1.78e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEgpFELMVLDIMMPGMSGYDVCTVLRESySLYQLPILFL 773
Cdd:COG0745     2 RILLVEDDPELAELLKEYLEEEGYEVDVAADGEEALEAAREQ--PDLVLLDLMLPDLDGLELCRRLRAK-KGSGPPIIVL 78
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 189910473  774 TAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLI 811
Cdd:COG0745    79 TARDDEEDRVLGLEAGADDYLTKPFSPRELLARLRALL 116
orf27 CHL00148
Ycf27; Reviewed
692-811 1.85e-29

Ycf27; Reviewed


Pssm-ID: 214376 [Multi-domain]  Cd Length: 240  Bit Score: 118.67  E-value: 1.85e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  692 KLRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCTVLRESYSLyqlPIL 771
Cdd:CHL00148    6 KEKILVVDDEAYIRKILETRLSIIGYEVITASDGEEALKLFRKEQP-DLVILDVMMPKLDGYGVCQEIRKESDV---PII 81
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 189910473  772 FLTAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLI 811
Cdd:CHL00148   82 MLTALGDVSDRITGLELGADDYVVKPFSPKELEARIRSVL 121
ompR PRK09468
osmolarity response regulator; Provisional
694-808 2.27e-26

osmolarity response regulator; Provisional


Pssm-ID: 181883 [Multi-domain]  Cd Length: 239  Bit Score: 109.68  E-value: 2.27e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEgPFELMVLDIMMPGMSGYDVCTVLRESYSlyQLPILFL 773
Cdd:PRK09468    7 KILVVDDDMRLRALLERYLTEQGFQVRSAANAEQMDRLLTRE-SFHLMVLDLMLPGEDGLSICRRLRSQNN--PTPIIML 83
                          90       100       110
                  ....*....|....*....|....*....|....*
gi 189910473  774 TAKNQIADIIAALEAGGNDYLAKPFDKRELISRAK 808
Cdd:PRK09468   84 TAKGEEVDRIVGLEIGADDYLPKPFNPRELLARIR 118
PhoB TIGR02154
phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response ...
694-827 3.62e-26

phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well [Regulatory functions, DNA interactions, Signal transduction, Two-component systems].


Pssm-ID: 131209 [Multi-domain]  Cd Length: 226  Bit Score: 108.57  E-value: 3.62e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   694 RVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCTVLRESYSLYQLPILFL 773
Cdd:TIGR02154    4 RILVVEDEPAIRELIAYNLEKAGYDVVEAGDGDEALTLINERGP-DLILLDWMLPGTSGIELCRRLRRRPETRAIPIIML 82
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 189910473   774 TAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLitLKKAVEEQNK-FIAIQ 827
Cdd:TIGR02154   83 TARGEEEDRVRGLETGADDYITKPFSPRELLARIKAV--LRRIRPQLSDeVIEVG 135
PRK11361 PRK11361
acetoacetate metabolism regulatory protein AtoC; Provisional
694-1014 6.22e-18

acetoacetate metabolism regulatory protein AtoC; Provisional


Pssm-ID: 183099 [Multi-domain]  Cd Length: 457  Bit Score: 86.83  E-value: 6.22e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCTVLRESYSlyQLPILFL 773
Cdd:PRK11361    6 RILIVDDEDNVRRMLSTAFALQGFETHCANNGRTALHLFADIHP-DVVLMDIRMPEMDGIKALKEMRSHET--RTPVILM 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  774 TAKNQIADIIAALEAGGNDYLAKPFDKRE---LISRAKNLITLKKAVEEQNKfiaiqnelGLARKLQYSILPEEAPNVVG 850
Cdd:PRK11361   83 TAYAEVETAVEALRCGAFDYVIKPFDLDElnlIVQRALQLQSMKKEIRHLHQ--------ALSTSWQWGHILTNSPAMMD 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  851 IKTefyyepmdsiggdffDFHAISETELGVLIADVSGHGipAALVSAmlKIAFSTQ--------VRLAKEPSQLLnqiNS 922
Cdd:PRK11361  155 ICK---------------DTAKIALSQASVLISGESGTG--KELIAR--AIHYNSRrakgpfikVNCAALPESLL---ES 212
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  923 TLLGKMKGAFVTASyvyinlETKEMIHARCGHPPLIINRRGESKAKLsipQGKLigwipeLDIQEDRISIRSGDRIVLYT 1002
Cdd:PRK11361  213 ELFGHEKGAFTGAQ------TLRQGLFERANEGTLLLDEIGEMPLVL---QAKL------LRILQEREFERIGGHQTIKV 277
                         330
                  ....*....|...
gi 189910473 1003 D-GITEATNANRE 1014
Cdd:PRK11361  278 DiRIIAATNRDLQ 290
PLN03029 PLN03029
type-a response regulator protein; Provisional
692-822 2.46e-10

type-a response regulator protein; Provisional


Pssm-ID: 215544 [Multi-domain]  Cd Length: 222  Bit Score: 60.43  E-value: 2.46e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  692 KLRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLV-------------------RDEGPFELMVLDIMMPGMSG 752
Cdd:PLN03029    8 QFHVLAVDDSLIDRKLIEKLLKTSSYQVTTVDSGSKALKFLglheddrsnpdtpsvspnsHQEVEVNLIITDYCMPGMTG 87
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  753 YDVCTVLRESYSLYQLPILFLTAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLITLKKAVEEQNK 822
Cdd:PLN03029   88 YDLLKKIKESSSLRNIPVVIMSSENVPSRITRCLEEGAEEFFLKPVQLSDLNRLKPHMMKTKSKNQKQEN 157
spore_II_E TIGR02865
stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane ...
863-1064 1.45e-06

stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane spanning protein with two separable functions. It plays a role in the switch to polar cell division during sporulation. By means of it protein phosphatase activity, located in the C-terminal region, it activates sigma-F. All proteins that score above the trusted cutoff to this model are found in endospore-forming Gram-positive bacteria. Surprisingly, a sequence from the Cyanobacterium-like (and presumably non-spore-forming) photosynthesizer Heliobacillus mobilis is homologous, and scores between the trusted and noise cutoffs [Cellular processes, Sporulation and germination].


Pssm-ID: 234038 [Multi-domain]  Cd Length: 764  Bit Score: 50.85  E-value: 1.45e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   863 IGGDFFDFHAISETELGVLIADVSGHGIPAA--------LVSAMLKIAFStqvrlakePSQLLNQINSTLLGKMKG-AFV 933
Cdd:TIGR02865  566 VSGDSYSFGKLSAGKYAVAISDGMGSGPEAAqessacvrLLEKFLESGFD--------REVAIKTVNSILSLRSTDeKFS 637
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   934 TASYVYINLETKEMIHARCGHPPLIInRRGESKAKLSIPQGKlIGWIPELDIQEDRISIRSGDRIVLYTDGITEatnANR 1013
Cdd:TIGR02865  638 TLDLSVIDLYTGQAEFVKVGAVPSFI-KRGAKVEVIRSSNLP-IGILDEVDVELVRKKLKNGDLIVMVSDGVLE---GEK 712
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|...
gi 189910473  1014 EMIGQDNW--ESMSHRYSGYPlTESKRLLLETIKEFTGNRsPDDDVTLVILEI 1064
Cdd:TIGR02865  713 EVEGKVLWlvRKLKETNTNDP-EEIAEYLLEKAKELRSGK-IKDDMTVIVAKV 763
 
Name Accession Description Interval E-value
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
696-811 5.61e-36

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088  Cd Length: 113  Bit Score: 133.47  E-value: 5.61e-36
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  696 IVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRdEGPFELMVLDIMMPGMSGYDVCTVLRESYSlyQLPILFLTA 775
Cdd:cd00156     1 LIVDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLA-EEKPDLILLDIMMPGMDGLELLRRIRKRGP--DIPIIFLTA 77
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 189910473  776 KNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLI 811
Cdd:cd00156    78 HGDDEDAVEALKAGADDYLTKPFSPEELLARIRALL 113
HATPase_c cd00075
Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: ...
547-649 3.12e-33

Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins


Pssm-ID: 238030  Cd Length: 103  Bit Score: 125.45  E-value: 3.12e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  547 LQQILFNIIGNAIKFTEK--GRIDVSAEIIEKMAVISIRDTGIGIPKDKFGDIFRSFeqVDASTTRKFGGTGLGLAISKR 624
Cdd:cd00075     1 LQQVLLNLLSNAIKHTPEggGRITISVERDGDHLEIRVEDNGPGIPEEDLERIFERF--SDGSRSRKGGGTGLGLSIVKK 78
                          90       100
                  ....*....|....*....|....*
gi 189910473  625 LVELHGGNIWVESTPAEGSMFSFSL 649
Cdd:cd00075    79 LVELHGGRIEVESEPGGGTTFTITL 103
HisKA cd00082
Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed ...
426-492 3.92e-16

Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase. They subsequently transfer the phosphoryl group to the Asp acceptor residue of a response regulator protein. Two-component signalling systems, consisting of a histidine protein kinase that senses a signal input and a response regulator that mediates the output, are ancient and evolutionarily conserved signaling mechanisms in prokaryotes and eukaryotes.


Pssm-ID: 119399  Cd Length: 65  Bit Score: 74.94  E-value: 3.92e-16
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 189910473  426 DKLKDEFLANTSHELKTPLNGIIGIAESMFDGIGGklNQEQRQNLGMIVSSGKRLSSLVDDILDFSK 492
Cdd:cd00082     1 LQAKGEFLANVSHELRTPLTAIRGALELLEEELLD--DEEQREYLERIREEAERLLRLINDLLDLSR 65
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
874-1064 4.21e-44

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 159.38  E-value: 4.21e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   874 SETELGVLIADVSGHGIPAALVSAMLKIAFSTQVRLAKEPSQLLNQINSTLLGKMKGA-FVTASYVYINLETKEMIHARC 952
Cdd:pfam07228    1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGErFATAVLAVYDPETGTLEYANA 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   953 GHPPLIINRRGESKAKLSIPQGKLIGWIPELDIQEDRISIRSGDRIVLYTDGITEATNANREMIGQDNWESMSHRYSGYP 1032
Cdd:pfam07228   81 GHPPPLLLRPDGGVVELLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAERHGLS 160
                          170       180       190
                   ....*....|....*....|....*....|..
gi 189910473  1033 LTESKRLLLETIKEFTGNRsPDDDVTLVILEI 1064
Cdd:pfam07228  161 PEELLDALLEDLLRLGGGE-LEDDITLLVLRV 191
HATPase_c smart00387
Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.
542-652 6.67e-38

Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.


Pssm-ID: 214643  Cd Length: 111  Bit Score: 138.94  E-value: 6.67e-38
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473    542 GDEARLQQILFNIIGNAIKFT-EKGRIDVSAEIIEKMAVISIRDTGIGIPKDKFGDIFRSFEQVDaSTTRKFGGTGLGLA 620
Cdd:smart00387    1 GDPDRLRQVLSNLLDNAIKYTpEGGRITVTLERDGDHVEITVEDNGPGIPPEDLEKIFEPFFRTD-KRSRKIGGTGLGLS 79
                            90       100       110
                    ....*....|....*....|....*....|..
gi 189910473    621 ISKRLVELHGGNIWVESTPAEGSMFSFSLPLA 652
Cdd:smart00387   80 IVKKLVELHGGEISVESEPGGGTTFTITLPLE 111
HATPase_c pfam02518
Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; This family represents the ...
542-652 1.33e-34

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; This family represents the structurally related ATPase domains of histidine kinase, DNA gyrase B and HSP90.


Pssm-ID: 251347  Cd Length: 111  Bit Score: 129.36  E-value: 1.33e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   542 GDEARLQQILFNIIGNAIKFT-EKGRIDVSAEIIEKMAVISIRDTGIGIPKDKFGDIFRSFEQVDASTTrKFGGTGLGLA 620
Cdd:pfam02518    1 GDEDRLRQVLSNLLDNAIKHApAGGEIEVTLERDGGRLRITVEDNGIGIPPEDLPKIFEPFFRTDGSRS-KVGGTGLGLS 79
                           90       100       110
                   ....*....|....*....|....*....|..
gi 189910473   621 ISKRLVELHGGNIWVESTPAEGSMFSFSLPLA 652
Cdd:pfam02518   80 IVRKLVELHGGTITVESEPGGGTTFTLTLPLE 111
Response_reg pfam00072
Response regulator receiver domain; This domain receives the signal from the sensor partner in ...
695-808 4.99e-34

Response regulator receiver domain; This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.


Pssm-ID: 249561  Cd Length: 111  Bit Score: 127.69  E-value: 4.99e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   695 VIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRdEGPFELMVLDIMMPGMSGYDVCTVLRESYslYQLPILFLT 774
Cdd:pfam00072    1 VLIVDDDPLIRELLRQLLEKEGYVVAEADDGEEALELLK-EKRPDLILLDIRMPGMDGLELLRRIRRRP--PTTPVIVLT 77
                           90       100       110
                   ....*....|....*....|....*....|....
gi 189910473   775 AKNQIADIIAALEAGGNDYLAKPFDKRELISRAK 808
Cdd:pfam00072   78 AHGDEEDAVEALKAGANDFLSKPFDPEELLAALR 111
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
856-1013 1.22e-32

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 126.69  E-value: 1.22e-32
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473    856 YYEPMDSIGGDFFDFHAISETELGVLIADVSGHGIPAALVSAMLKIAFSTQVRLAKEPSQLLNQINSTLLGKM-KGAFVT 934
Cdd:smart00331    9 YYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYENGeDGMFAT 88
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473    935 ASYVYINLETKEMIHARCGHPPLIInRRGESKAKLSIP-QGKLIGWIPELDIQEDRISIRSGDRIVLYTDGITEATNANR 1013
Cdd:smart00331   89 LFLALYDFAGGTLSYANAGHSPPYL-LRADGGLVEDLDdLGAPLGLEPDVEVDVRELTLEPGDLLLLYTDGLTEARNPER 167
CheY COG0784
FOG: CheY-like receiver [Signal transduction mechanisms]
692-817 8.24e-31

FOG: CheY-like receiver [Signal transduction mechanisms]


Pssm-ID: 223855  Cd Length: 130  Bit Score: 119.18  E-value: 8.24e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  692 KLRVIVVDDEPINRQVLKNHLTLIGCEVREAANG-VDAIRLVRDEGPFELMVLDIMMPGMSGYDVCTVLRESYSlyQLPI 770
Cdd:COG0784     5 GLRVLVVDDEPVNRRLLKRLLEDLGYEVVEAADGeEEALELLRELPQPDLILLDINMPGMDGIELLRRLRARGP--NIPV 82
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 189910473  771 LFLTAKNQIADIIAALEAGGNDYLAKP-FDKRELISRAKNLITLKKAV 817
Cdd:COG0784    83 ILLTAYADEADRERALAAGADDYLTKPiFLEEELLAALRRLLARAAAE 130
HisKA pfam00512
His Kinase A (phospho-acceptor) domain; Dimerization and phospho-acceptor domain of histidine ...
429-495 1.68e-17

His Kinase A (phospho-acceptor) domain; Dimerization and phospho-acceptor domain of histidine kinases.


Pssm-ID: 249920  Cd Length: 66  Bit Score: 79.14  E-value: 1.68e-17
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 189910473   429 KDEFLANTSHELKTPLNGIIGIAESMFDgigGKLNQEQRQNLGMIVSSGKRLSSLVDDILDFSKMKN 495
Cdd:pfam00512    2 KSEFLANLSHELRTPLTAIRGYLELLLD---TELSEEQREYLETILRSAERLLRLINDLLDLSRIEA 65
PRK10610 PRK10610
chemotaxis regulatory protein CheY; Provisional
693-798 2.05e-17

chemotaxis regulatory protein CheY; Provisional


Pssm-ID: 170568  Cd Length: 129  Bit Score: 80.40  E-value: 2.05e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  693 LRVIVVDDEPINRQVLKNHLTLIGCE-VREAANGVDAIRLVRdEGPFELMVLDIMMPGMSGYDVCTVLRESYSLYQLPIL 771
Cdd:PRK10610    6 LKFLVVDDFSTMRRIVRNLLKELGFNnVEEAEDGVDALNKLQ-AGGFGFVISDWNMPNMDGLELLKTIRADGAMSALPVL 84
                          90       100
                  ....*....|....*....|....*..
gi 189910473  772 FLTAKNQIADIIAALEAGGNDYLAKPF 798
Cdd:PRK10610   85 MVTAEAKKENIIAAAQAGASGYVVKPF 111
HisKA smart00388
His Kinase A (phosphoacceptor) domain; Dimerisation and phosphoacceptor domain of histidine ...
429-493 1.37e-16

His Kinase A (phosphoacceptor) domain; Dimerisation and phosphoacceptor domain of histidine kinases.


Pssm-ID: 214644  Cd Length: 66  Bit Score: 76.45  E-value: 1.37e-16
                            10        20        30        40        50        60
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 189910473    429 KDEFLANTSHELKTPLNGIIGIAESMFDgigGKLNQEQRQNLGMIVSSGKRLSSLVDDILDFSKM 493
Cdd:smart00388    2 KREFLANLSHELRTPLTAIRGYLELLLD---TELSEEQREYLETILREAERLLRLINDLLDLSRI 63
7TMR-DISM_7TM pfam07695
7TM diverse intracellular signalling; This entry represents the transmembrane region of the ...
211-407 1.17e-15

7TM diverse intracellular signalling; This entry represents the transmembrane region of the 7TM-DISM (7TM Receptors with Diverse Intracellular Signalling Modules).


Pssm-ID: 254365  Cd Length: 207  Bit Score: 76.90  E-value: 1.17e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   211 FLAGSVFIIALYHFGLFYFRRtDRGNLLFGFAALLLALRTLFTGErFVFNELAPILSWNVCLRIEYFTFYLSPYLFFTFF 290
Cdd:pfam07695    7 LFYGILLALALYNLFLFFSLR-DRSYLYYVLYILSFLLYQLSLNG-LGFQYLWPNSPPWLNNKLLYLFLALLVIFFALLF 84
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   291 --RGFYPDYYPKWMHRSLLFPTLVFISFLLFLPTQIYPELNSYYQIVFLFGILMILQGVFRAAYHRKESGFLFLVGISTV 368
Cdd:pfam07695   85 arSFLELKKYLPRLDRLLLGLALLLLLLLLLAPLFPYTLSLRLAQLLALLFILFLLVLGIIAWRKGYKPARYFLLAWLIL 164
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|...
gi 189910473   369 AIAAFVDLLNANQI----FYSVEAIPIGIFVFILVQSLTLSRR 407
Cdd:pfam07695  165 LIGALIDILSLLGLlpsnFFTLYLLQIGSLLEVLLLSLALADR 207
REC smart00448
cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar ...
693-748 9.49e-13

cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar motors. This domain contains a phosphoacceptor site that is phosphorylated by histidine kinase homologues.


Pssm-ID: 214668  Cd Length: 55  Bit Score: 64.90  E-value: 9.49e-13
                            10        20        30        40        50
                    ....*....|....*....|....*....|....*....|....*....|....*.
gi 189910473    693 LRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRdEGPFELMVLDIMMP 748
Cdd:smart00448    1 MRILVVDDDPLLRELLKALLEKEGYEVDEATDGEEALELLK-EEKPDLILLDIMMP 55
Glyco_hydro_2_N pfam02837
Glycosyl hydrolases family 2, sugar binding domain; This family contains beta-galactosidase, ...
57-142 9.09e-04

Glycosyl hydrolases family 2, sugar binding domain; This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold.


Pssm-ID: 251564  Cd Length: 159  Bit Score: 39.55  E-value: 9.09e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473    57 MHLEGDWEFY-------PRQFLSESERRDFPFQHLTVPGIWNsVLGSG-------EGYGTYRLVLQRPKNLENDQVFgIK 122
Cdd:pfam02837    5 QSLNGGWRFKladnpdgRPEGFYKADFDDSDWEEIPVPSNWE-LQGYDkpvprdyNGVGWYRRTFTVPADWKGKRVF-LR 82
                           90       100
                   ....*....|....*....|
gi 189910473   123 ILDVATASRVYWNGKFLGSS 142
Cdd:pfam02837   83 FEGVDSAAYVWVNGEFVGYH 102
BaeS COG0642
Signal transduction histidine kinase [Signal transduction mechanisms]
317-656 7.14e-59

Signal transduction histidine kinase [Signal transduction mechanisms]


Pssm-ID: 223715 [Multi-domain]  Cd Length: 336  Bit Score: 206.53  E-value: 7.14e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  317 LLFLPTQIYPELNSYYQIVFLFGILMILQGVFRAAYHRKESGFLFLVGISTVAIAAFVDLLNANQIFYSVEAIPIGIFVF 396
Cdd:COG0642     2 LALQLALVLTLLLALFVPLALLLIFLPSLAVARNELLLLLLLTLLAALLVALLLLLLLLRRLLRPLLLLADAANALAAGL 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  397 ILVQSLTLSRRFSRAFSEVETLSKRL-LALDKLKDEFLANTSHELKTPLNGIIGIAESMFDGiggkLNQEQRQNLGMIVS 475
Cdd:COG0642    82 TRLVLASLGSELASLAHALNELLERLeRLLRRAKREFLANISHELRTPLTAIRGLLELLLEG----LLDPQRELLEIIEE 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  476 SGKRLSSLVDDILDFSKMKNRD-LDLDLKAIDLHQICDFVLVISRPLYVTKNLTVRNNVPIDfPPILGDEARLQQILFNI 554
Cdd:COG0642   158 EAERLLRLVNDLLDLSRLEAGTkLKLLLELVDLAELLEEVVRLLAPLAQEKGIELAVDLPEL-PYVLGDPERLRQVLVNL 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  555 IGNAIKFTEKGRIDVSAEIIEKMAVISIRDTGIGIPKDKFGDIFRSFEQVDASTTrkfgGTGLGLAISKRLVELHGGNIW 634
Cdd:COG0642   237 LSNAIKYTPGGEITISVRQDDEQVTISVEDTGPGIPEEELERIFEPFFRTDKSRS----GTGLGLAIVKRIVELHGGTIS 312
                         330       340
                  ....*....|....*....|..
gi 189910473  635 VESTPAEGSMFSFSLPLAREGE 656
Cdd:COG0642   313 VESEPGKGTTFTIRLPLAPAAA 334
TMAO_torS TIGR02956
TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the ...
429-805 9.18e-72

TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072) [Signal transduction, Two-component systems].


Pssm-ID: 234070 [Multi-domain]  Cd Length: 968  Bit Score: 257.40  E-value: 9.18e-72
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   429 KDEFLANTSHELKTPLNGIIGIAESMFDGiggKLNQEQRQNLGMIVSSGKRLSSLVDDILDFSKMKNRDLDLDLKAIDLH 508
Cdd:TIGR02956  464 KSAFLATMSHEIRTPLNGILGTLELLGDT---GLTSQQQQYLQVINRSGESLLDILNDILDYSKIEAGHLSISPRPFDLN 540
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   509 QICDFVLVISRPLYVTKNLTVRNNVPIDFPP-ILGDEARLQQILFNIIGNAIKFTEKGRIDVSAEIIEKMAV-ISIRDTG 586
Cdd:TIGR02956  541 ALLDDVHHLMVSRAQLKGIQLRLNIPEQLPNwWQGDGPRIRQVLINLVGNAIKFTDRGSVVLRVSLNDDSSLlFEVEDTG 620
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   587 IGIPKDKFGDIFRSFEQVDASttRKFGGTGLGLAISKRLVELHGGNIWVESTPAEGSMFSFSLPLAReGEiPMEKPQLKk 666
Cdd:TIGR02956  621 CGIAEEEQATLFDAFTQADGR--RRSGGTGLGLAISQRLVEAMDGELGVESELGVGSCFWFTLPLTR-GK-PAEDSATL- 695
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   667 semwfggdnfefEPIEETQeelegekLRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGpFELMVLDIM 746
Cdd:TIGR02956  696 ------------TVIDLPP-------QRVLLVEDNEVNQMVAQGFLTRLGHKVTLAESGQSALECFHQHA-FDLALLDIN 755
                          330       340       350       360       370       380
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   747 MPGMSGYDVCTVLRESY-SLYQLPILFLTAKNQIADIIAALEAGGNDYLAKPFDKRELIS 805
Cdd:TIGR02956  756 LPDGDGVTLLQQLRAIYgAKNEVKFIAFSAHVFNEDVAQYLAAGFDGFLAKPVVEEQLTA 815
PRK11091 PRK11091
aerobic respiration control sensor protein ArcB; Provisional
429-820 2.30e-63

aerobic respiration control sensor protein ArcB; Provisional


Pssm-ID: 236842 [Multi-domain]  Cd Length: 779  Bit Score: 229.44  E-value: 2.30e-63
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  429 KDEFLANTSHELKTPLNGIIGIAESMFDGiggKLNQEQRQNLGMIVSSGKRLSSLVDDILDFSKMKNRDLDLDLKAIDLH 508
Cdd:PRK11091  283 KTTFISTISHELRTPLNGIVGLSRILLDT---ELTAEQRKYLKTIHVSAITLGNIFNDIIDMDKMERRKLQLDNQPIDFT 359
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  509 QICDFVLVISRPLYVTKNLTVRNNVPIDFPP-ILGDEARLQQILFNIIGNAIKFTEKGRI--DVSAEIiEKMAVISIRDT 585
Cdd:PRK11091  360 DFLADLENLSGLQAEQKGLRFDLEPLLPLPHkVITDGTRLRQILWNLISNAVKFTQQGGVtvRVRYEE-GDMLTFEVEDS 438
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  586 GIGIPKDKFGDIFRSFEQVDASTTRKFG-GTGLGLAISKRLVELHGGNIWVESTPAEGSMFSFSLPL---AREGEIPMEK 661
Cdd:PRK11091  439 GIGIPEDELDKIFAMYYQVKDSHGGKPAtGTGIGLAVSKRLAQAMGGDITVTSEEGKGSCFTLTIHApavAEEVEDAFDE 518
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  662 PQLKksemwfggdnfefepieetqeeleGEKLRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVrDEGPFELM 741
Cdd:PRK11091  519 DDMP------------------------LPALNILLVEDIELNVIVARSVLEKLGNSVDVAMTGKEALEMF-DPDEYDLV 573
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  742 VLDIMMPGMSGYDVCTVLRESYSLYQL-PILFLTAkNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLITLKKAVEEQ 820
Cdd:PRK11091  574 LLDIQLPDMTGLDIARELRERYPREDLpPLVALTA-NVLKDKKEYLDAGMDDVLSKPLSVPALTAMIKKFWDTQDDEEST 652
PRK11107 PRK11107
hybrid sensory histidine kinase BarA; Provisional
420-806 9.97e-57

hybrid sensory histidine kinase BarA; Provisional


Pssm-ID: 236848 [Multi-domain]  Cd Length: 919  Bit Score: 211.25  E-value: 9.97e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  420 KRLLALDKLKDEFLANTSHELKTPLNGIIGIAESMFdgiggK--LNQEQRQNLGMIVSSGKRLSSLVDDILDFSKMKNRD 497
Cdd:PRK11107  284 KRAQEAARIKSEFLANMSHELRTPLNGVIGFTRQTL-----KtpLTPTQRDYLQTIERSANNLLAIINDILDFSKLEAGK 358
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  498 LDLDLKAIDLHQICDFVLVISRPLYVTKNL----TVRNNVPIDFppiLGDEARLQQILFNIIGNAIKFTEKGRIDVSAEI 573
Cdd:PRK11107  359 LVLENIPFSLRETLDEVVTLLAHSAHEKGLeltlNIDPDVPDNV---IGDPLRLQQIITNLVGNAIKFTESGNIDILVEL 435
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  574 --IEKMAV---ISIRDTGIGIPKDKFGDIFRSFEQVDASTTRKFGGTGLGLAISKRLVELHGGNIWVESTPAEGSMFSFS 648
Cdd:PRK11107  436 raLSNTKVqleVQIRDTGIGISERQQSQLFQAFRQADASISRRHGGTGLGLVITQKLVNEMGGDISFHSQPNRGSTFWFH 515
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  649 LPL-----------------------------ARE---------------------------------------GEIPME 660
Cdd:PRK11107  516 LPLdlnpnpiidglptdclagkrllyvepnsaAAQatldilsetplevtysptlsqlpeahydilllglpvtfrEPLTML 595
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  661 KPQLKK---------------------SEMWFGGD-------------------NFEFEPIEETQEELEGEKLRVIVVDD 700
Cdd:PRK11107  596 HERLAKaksmtdflilalpcheqvlaeQLKQDGADaclskplshtrllpallepCHHKQPPLLPPTDESRLPLTVMAVDD 675
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  701 EPINrqvlknhLTLIGC-------EVREAANGVDAIRLVRdEGPFELMVLDIMMPGMSGYDVCTVLRESYSLYQLPILFL 773
Cdd:PRK11107  676 NPAN-------LKLIGAlleeqveHVVLCDSGHQAVEQAK-QRPFDLILMDIQMPGMDGIRACELIRQLPHNQNTPIIAV 747
                         490       500       510       520
                  ....*....|....*....|....*....|....*....|..
gi 189910473  774 TA------KNQIadiiaaLEAGGNDYLAKPFDK---RELISR 806
Cdd:PRK11107  748 TAhamageRERL------LSAGMDDYLAKPIDEamlKQVLLR 783
PRK15347 PRK15347
two component system sensor kinase SsrA; Provisional
410-797 3.95e-52

two component system sensor kinase SsrA; Provisional


Pssm-ID: 237951 [Multi-domain]  Cd Length: 921  Bit Score: 197.17  E-value: 3.95e-52
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  410 RAFSEVETLSKRllaldklKDEFLANTSHELKTPLNGIIGIAESMFDGiggKLNQEQRQNLGMIVSSGKRLSSLVDDILD 489
Cdd:PRK15347  386 EAKQRAEQANKR-------KSEHLTTISHEIRTPLNGVLGALELLQNT---PLTAEQMDLADTARQCTLSLLAIINNLLD 455
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  490 FSKMKNRDLDLDLKAIDLHQICDFV-LVISRPLyVTKNLTVRNNVPIDFPPILG-DEARLQQILFNIIGNAIKFTEKGRI 567
Cdd:PRK15347  456 FSRIESGQMTLSLEETALLPLLDQAmLTIQGPA-QSKSLTLRTFVGAHVPLYLHlDSLRLRQILVNLLGNAVKFTETGGI 534
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  568 DVSAEIIEKMAVISIRDTGIGIPKDKFGDIFRSFEQVDASTtrkfGGTGLGLAISKRLVELHGGNIWVESTPAEGSMFSF 647
Cdd:PRK15347  535 RLRVKRHEQQLCFTVEDTGCGIDIQQQQQIFTPFYQADTHS----QGTGLGLTIASSLAKMMGGELTLFSTPGVGSCFSL 610
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  648 SLPLarEGEIPMEK------------PQLKkseMW-----FGGDNFEF-----------------------EPIEETQEE 687
Cdd:PRK15347  611 VLPL--NEYAPPEPlkgelsaplalhRQLS---AWgitcqPGHQNPALldpelaylpgrlydllqqiiqgaPNEPVINLP 685
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  688 LEGEKLRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEgPFELMVLDIMMPGMSGYDvCTVL-RESYSLY 766
Cdd:PRK15347  686 LQPWQLQILLVDDVETNRDIIGMMLVELGQQVTTAASGTEALELGRQH-RFDLVLMDIRMPGLDGLE-TTQLwRDDPNNL 763
                         410       420       430
                  ....*....|....*....|....*....|...
gi 189910473  767 --QLPILFLTAKNQIADIIAALEAGGNDYLAKP 797
Cdd:PRK15347  764 dpDCMIVALTANAAPEEIHRCKKAGMNHYLTKP 796
phoR_proteo TIGR02966
phosphate regulon sensor kinase PhoR; Members of this protein family are the regulatory ...
421-649 2.76e-47

phosphate regulon sensor kinase PhoR; Members of this protein family are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter in most Proteobacteria. Related proteins from Gram-positive organisms are not included in this model. The phoR gene usually is adjacent to the response regulator phoB gene (TIGR02154) [Signal transduction, Two-component systems].


Pssm-ID: 234074 [Multi-domain]  Cd Length: 333  Bit Score: 173.16  E-value: 2.76e-47
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   421 RLLALDKLKDEFLANTSHELKTPLNGIIGIAESMFDGiGGKLNQEQRQNLGMIVSSGKRLSSLVDDILDFSKMKNRDLDL 500
Cdd:TIGR02966  106 RLRRLEQMRRDFVANVSHELRTPLTVLRGYLETLADG-PDEDPEEWNRALEIMLEQSQRMQSLVEDLLTLSRLESAASPL 184
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   501 DLKAID----LHQICDFVLVISRplyvtknltvRNNVPIDF-----PPILGDEARLQQILFNIIGNAIKFT-EKGRIDVS 570
Cdd:TIGR02966  185 EDEPVDmpalLDHLRDEAEALSQ----------GKNHQITFeidggVDVLGDEDELRSAFSNLVSNAIKYTpEGGTITVR 254
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 189910473   571 AEIIEKMAVISIRDTGIGIPKDKFGDIFRSFEQVDASTTRKFGGTGLGLAISKRLVELHGGNIWVESTPAEGSMFSFSL 649
Cdd:TIGR02966  255 WRRDGGGAEFSVTDTGIGIAPEHLPRLTERFYRVDKSRSRDTGGTGLGLAIVKHVLSRHHARLEIESELGKGSTFSFIF 333
PRK11466 PRK11466
hybrid sensory histidine kinase TorS; Provisional
399-766 8.73e-42

hybrid sensory histidine kinase TorS; Provisional


Pssm-ID: 236914 [Multi-domain]  Cd Length: 914  Bit Score: 164.69  E-value: 8.73e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  399 VQSLTLSRRFSRAFSEvetlskrllALDKLKDEFLANTSHELKTPLNGIIGIAESMFDGiggKLNQEQRQNLGMIVSSGK 478
Cdd:PRK11466  423 LQELVIEHRQARAEAE---------KASQAKSAFLAAMSHEIRTPLYGILGTAQLLADN---PALNAQRDDLRAITDSGE 490
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  479 RLSSLVDDILDFSKMK--NRDLDLDLKAIDLHQICDFVLVISRPLYVTKNLTVRNNVPIDFPPIL-GDEARLQQILFNII 555
Cdd:PRK11466  491 SLLTILNDILDYSAIEagGKNVSVSDEPFEPRPLLESTLQLMSGRVKGRPIRLATDIADDLPTALmGDPRRIRQVITNLL 570
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  556 GNAIKFTEKGRIDVSAEIIEKMAVISIRDTGIGIPKDKFGDIFRSFEQVDAsttrKFGGTGLGLAISKRLVELHGGNIWV 635
Cdd:PRK11466  571 SNALRFTDEGSIVLRSRTDGEQWLVEVEDSGCGIDPAKLAEIFQPFVQVSG----KRGGTGLGLTISSRLAQAMGGELSA 646
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  636 ESTPAEGSMFSFSLPLARegeiPMEKPQLKKSEMWfggdnfefepieetqeelEGEKLRVIVVDDEPINRQVLKNHLTLI 715
Cdd:PRK11466  647 TSTPEVGSCFCLRLPLRV----ATAPVPKTVNQAV------------------RLDGLRLLLIEDNPLTQRITAEMLNTS 704
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|.
gi 189910473  716 GCEVREAANGVDAIRLVRDEGPFELMVLDIMMPgmsGYDVCTVLRESYSLY 766
Cdd:PRK11466  705 GAQVVAVGNAAQALETLQNSEPFAAALVDFDLP---DYDGITLARQLAQQY 752
PRK10841 PRK10841
hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional
429-797 1.65e-41

hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional


Pssm-ID: 182772 [Multi-domain]  Cd Length: 924  Bit Score: 163.99  E-value: 1.65e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  429 KDEFLANTSHELKTPLNGIIGiaesMFDGIGGK-LNQE-QRQNLGMIVSSGKRLSsLVDDILDFSKMKNRDLDLDLKAID 506
Cdd:PRK10841  447 KSMFLATVSHELRTPLYGIIG----NLDLLQTKeLPKGvDRLVTAMNNSSSLLLK-IISDILDFSKIESEQLKIEPREFS 521
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  507 LHQICDFVLVISRPLYVTKNLT----VRNNVPIdfpPILGDEARLQQILFNIIGNAIKFTEKGRIDVSAEIIEKMAVISI 582
Cdd:PRK10841  522 PREVINHITANYLPLVVKKRLGlycfIEPDVPV---ALNGDPMRLQQVISNLLSNAIKFTDTGCIVLHVRVDGDYLSFRV 598
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  583 RDTGIGIPKDKFGDIFRSFEQVDASTTRKFGGTGLGLAISKRLVELHGGNIWVESTPAEGSMFSFSLPLAR-EGEIPMEK 661
Cdd:PRK10841  599 RDTGVGIPAKEVVRLFDPFFQVGTGVQRNFQGTGLGLAICEKLINMMDGDISVDSEPGMGSQFTIRIPLYGaQYPQKKGV 678
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  662 PQLKKSEMWF------------------------------GGD-----NFEFEPIE------------------------ 682
Cdd:PRK10841  679 EGLQGKRCWLavrnasleqfletllqrsgiqvqryegqepTPEdvlitDDPVQKKWqgravitfcrrhigipleiapgew 758
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  683 ---------------------------------ETQEELEGEKLRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAI 729
Cdd:PRK10841  759 vhstatphelpallariyrielesddsanalpsTDKAVSDNDDMMILVVDDHPINRRLLADQLGSLGYQCKTANDGVDAL 838
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 189910473  730 RlVRDEGPFELMVLDIMMPGMSGYDVCTVLRESYslYQLPILFLTAkNQIADIIA-ALEAGGNDYLAKP 797
Cdd:PRK10841  839 N-VLSKNHIDIVLTDVNMPNMDGYRLTQRLRQLG--LTLPVIGVTA-NALAEEKQrCLEAGMDSCLSKP 903
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
817-1064 1.82e-40

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 154.10  E-value: 1.82e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  817 VEEQNKFIAiqnELGLARKLQYSILPEEAPNVVGIKTEFYYEPMDSIGGDFFDFHAISETELGVLIADVSGHGIPAALVS 896
Cdd:COG2208   118 LLEQNNISA---ELEVARQIQQNLLPKALPLFPGIDIEAILVPASEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLM 194
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  897 AMLKIAFSTQVRLA-KEPSQLLNQINSTLLGKMKGA-FVTASYVYINLETKEMIHARCGHPPLIInRRGESKAKLSIPQ- 973
Cdd:COG2208   195 LMPKLALRLLLESGpLDPADVLETLNRVLKQNLEEDmFVTLFLGVYDLDSGELTYSNAGHEPALI-LSADGEIEVEDLTa 273
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  974 -GKLIGWIPELDIQEDRISIRSGDRIVLYTDGITEATNANREMIGQDNWESMSHRYSGYPLTESKRLLLETIKEFTGNRS 1052
Cdd:COG2208   274 lGLPIGLLPDYQYEVASLQLEPGDLLVLYTDGVTEARNSDGEFFGLERLLKILGRLLGQPAEEILEAILESLEELQGDQI 353
                         250
                  ....*....|..
gi 189910473 1053 PDDDVTLVILEI 1064
Cdd:COG2208   354 QDDDITLLVLKV 365
VicK COG5002
Signal transduction histidine kinase [Signal transduction mechanisms]
431-650 2.94e-38

Signal transduction histidine kinase [Signal transduction mechanisms]


Pssm-ID: 227335 [Multi-domain]  Cd Length: 459  Bit Score: 149.50  E-value: 2.94e-38
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  431 EFLANTSHELKTPLNGIIGIAESMFDGIGGKLNQEQRqNLGMIVSSGKRLSSLVDDILDFSKMKNRDLDLDLKAIDL--- 507
Cdd:COG5002   227 EFVANVSHELRTPLTSMKSYLEALEEGAWEDKEIAPR-FLRVTLNETERMIRLVNDLLQLSRMDNARYQLNKEWINFtaf 305
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  508 --HQICDFVLVISRPlyvTKNLTVRNnVPIDFPPILGDEARLQQILFNIIGNAIKFT-EKGRIDVSAEIIEKMAVISIRD 584
Cdd:COG5002   306 lnEIINRFEMILKKE---TIARFVRD-IPKQDIWVEIDPDKMTQVLDNIISNALKYSpDGGRITVSVKQRETWVEISISD 381
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 189910473  585 TGIGIPKDKFGDIFRSFEQVDASTTRKFGGTGLGLAISKRLVELHGGNIWVESTPAEGSMFSFSLP 650
Cdd:COG5002   382 QGLGIPKEDLEKIFDRFYRVDKARSRKMGGTGLGLAIAKEIVQAHGGRIWAESEEGKGTTFSFTLP 447
PRK09959 PRK09959
hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional
429-798 3.12e-38

hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional


Pssm-ID: 182169 [Multi-domain]  Cd Length: 1197  Bit Score: 154.12  E-value: 3.12e-38
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  429 KDEFLANTSHELKTPLNGIIGIAESMfdgIGGKLNQEQR-QNLGMIVSSGKRLSSLVDDILDFSKMKNRDLDLDLKAIDL 507
Cdd:PRK09959  712 KSQFLATMSHEIRTPISSIMGFLELL---SGSGLSKEQRvEAISLAYATGQSLLGLIGEILDVDKIESGNYQLQPQWVDI 788
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  508 HQICDFVLVISRPLYVTKN--LTVRNNVPiDFPPILGDEARLQQILFNIIGNAIKFTEKGRIDVSAEII---EKMAVI-- 580
Cdd:PRK09959  789 PTLVQNTCHSFGAIAASKSiaLSCSSTFP-DHYLVKIDPQAFKQVLSNLLSNALKFTTEGAVKITTSLGhidDNHAVIkm 867
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  581 SIRDTGIGIPKDKFGDIFRSFEQVDASttRKFGGTGLGLAISKRLVELHGGNIWVESTPAEGSMFSFSLPLaregEIPME 660
Cdd:PRK09959  868 TIMDSGSGLSQEEQQQLFKRYSQTSAG--RQQTGSGLGLMICKELIKNMQGDLSLESHPGIGTTFTITIPV----EISQQ 941
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  661 KPQLK-KSEmwfggdnfefEPIEETQeelegeKLRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGpFE 739
Cdd:PRK09959  942 VATVEaKAE----------QPITLPE------KLSILIADDHPTNRLLLKRQLNLLGYDVDEATDGVQALHKVSMQH-YD 1004
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 189910473  740 LMVLDIMMPGMSGYDVCTVLRESYSlyQLPILFLTAKNQIADIIAALEAGGNDYLAKPF 798
Cdd:PRK09959 1005 LLITDVNMPNMDGFELTRKLREQNS--SLPIWGLTANAQANEREKGLSCGMNLCLFKPL 1061
PRK09303 PRK09303
adaptive-response sensory kinase; Validated
414-653 4.06e-37

adaptive-response sensory kinase; Validated


Pssm-ID: 236462 [Multi-domain]  Cd Length: 380  Bit Score: 144.71  E-value: 4.06e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  414 EVETLSKRLlaldKLKDEFLANTSHELKTPLNGIiGIA----ESMFDGIGGKLNQEQRQNLGMIVSSGKR-LSSLVDDIL 488
Cdd:PRK09303  140 ENETLLEQL----KFKDRVLAMLAHDLRTPLTAA-SLAletlELGQIDEDTELKPALIEQLQDQARRQLEeIERLITDLL 214
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  489 DFSKMKNRDLDLDLKAIDLHQICDFVLVISRPLYVTKNLTVRNNVPIDFPPILGDEARLQQILFNIIGNAIKFTEK-GRI 567
Cdd:PRK09303  215 EVGRTRWEALRFNPQKLDLGSLCQEVILELEKRWLAKSLEIQTDIPSDLPSVYADQERIRQVLLNLLDNAIKYTPEgGTI 294
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  568 DVSA--EIIEKMAViSIRDTGIGIPKDK----FGDIFRSfeQVDASTTrkfgGTGLGLAISKRLVELHGGNIWVESTPAE 641
Cdd:PRK09303  295 TLSMlhRTTQKVQV-SICDTGPGIPEEEqeriFEDRVRL--PRDEGTE----GYGIGLSVCRRIVRVHYGQIWVDSEPGQ 367
                         250
                  ....*....|..
gi 189910473  642 GSMFSFSLPLAR 653
Cdd:PRK09303  368 GSCFHFTLPVYR 379
COG4251 COG4251
Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal ...
413-654 4.85e-37

Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms]


Pssm-ID: 226702 [Multi-domain]  Cd Length: 750  Bit Score: 148.74  E-value: 4.85e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  413 SEVETLSKRLLALDKLKDEFLANTSHELKTPLNGIIGIAESMFDGIGGKLNQEQRQNLGMIVSSGKRLSSLVDDILDFSK 492
Cdd:COG4251   508 EELAQLRRELERSNAELRAFAYVASHDLQEPLRQISNYAQLLSERYSDALDEEAKEFITFISRLTSLMQQLIDDLLTYSK 587
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  493 mknRDL-DLDLKAIDLHQICDFVLVISRPLYvtknLTVRNNVPID-FPPILGDEARLQQILFNIIGNAIKFTEKG--RID 568
Cdd:COG4251   588 ---LGLtEAPLQPTDVQKVVDKVLLELSQRI----ADTGAEIRIApLPVVAADATQLGQVFQNLIANAIKFGGPEnpDIE 660
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  569 VSAEIIEKMAVISIRDTGIGIPKDKFGDIFRSFEQVdaSTTRKFGGTGLGLAISKRLVELHGGNIWVESTPAEGSMFSFS 648
Cdd:COG4251   661 ISAERQEDEWTFSVRDNGIGIDPAYFERIFVIFQRL--HSRDEYLGTGLGLAICKKIAERHQGRIWVESTPGEGSTFYFT 738

                  ....*.
gi 189910473  649 LPLARE 654
Cdd:COG4251   739 LPVGGE 744
KdpD COG2205
Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms]
412-662 2.00e-34

Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms]


Pssm-ID: 225115 [Multi-domain]  Cd Length: 890  Bit Score: 141.27  E-value: 2.00e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  412 FSEVETLSKRLLALDKLKDEFLANTSHELKTPLNGIIGIAESMFDgIGGKLNQEQRQNL-GMIVSSGKRLSSLVDDILDF 490
Cdd:COG2205   643 LAEEAEQARLAAERERLRSALLASISHDLRTPLTAIMGAAETLLL-DGEALSPEDRAELlSSIREESERLTRLVTNLLDM 721
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  491 SKMKNRDLDLDLKAIDLHQICDFVLVISRPLYVTKNLTVrnNVPIDFPPILGDEARLQQILFNIIGNAIKFTEKG-RIDV 569
Cdd:COG2205   722 TRLQSGGVNLKLDWVLVEEVVGEALQRLRKRFTGHKIVV--SVPVDLPLIHVDSPLIEQVLINLLENALKYAPPGsEIRI 799
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  570 SAEIIEKMAVISIRDTGIGIPKDKFGDIFRSFEQVDASTTRkfGGTGLGLAISKRLVELHGGNIWVESTPAEGSMFSFSL 649
Cdd:COG2205   800 NAGVERENVVFSVIDEGPGIPEGELERIFDKFYRGNKESAT--RGVGLGLAICRGIVEAHGGTISAENNPGGGAIFVFTL 877
                         250
                  ....*....|...
gi 189910473  650 PLAREGEIPMEKP 662
Cdd:COG2205   878 PVEEDPPLEDFEE 890
PRK11360 PRK11360
sensory histidine kinase AtoS; Provisional
390-655 1.45e-30

sensory histidine kinase AtoS; Provisional


Pssm-ID: 236901 [Multi-domain]  Cd Length: 607  Bit Score: 127.39  E-value: 1.45e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  390 PIGifVFILVQSLTLSRRFSRAFSEVEtlskRLLALDKLkdefLANTSHELKTPLNGIIGIAESMFDGIGGKlnqEQRQN 469
Cdd:PRK11360  361 MIG--ALVIFSDLTERKRLQRRVARQE----RLAALGEL----VAGVAHEIRNPLTAIRGYVQIWRQQTSDP---PSQEY 427
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  470 LGMIVSSGKRLSSLVDDILDFSK---MKNRdldldlkAIDLHQICDFVLVISRPLYVTKNLTVRNNVPIDFPPILGDEAR 546
Cdd:PRK11360  428 LSVVLREVDRLNKVIDQLLEFSRpreSQWQ-------PVSLNALVEEVLQLFQTAGVQARVDFETELDNELPPIWADPEL 500
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  547 LQQILFNIIGNAIK-FTEKGRIDVSAE-IIEKMAVISIRDTGIGIPKDKFGDIFRSFeqvdasTTRKFGGTGLGLAISKR 624
Cdd:PRK11360  501 LKQVLLNILINAVQaISARGKIRIRTWqYSDGQVAVSIEDNGCGIDPELLKKIFDPF------FTTKAKGTGLGLALSQR 574
                         250       260       270
                  ....*....|....*....|....*....|.
gi 189910473  625 LVELHGGNIWVESTPAEGSMFSFSLPLAREG 655
Cdd:PRK11360  575 IINAHGGDIEVESEPGVGTTFTLYLPINPQG 605
OmpR COG0745
Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding ...
694-811 1.78e-30

Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]


Pssm-ID: 223816 [Multi-domain]  Cd Length: 229  Bit Score: 121.25  E-value: 1.78e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEgpFELMVLDIMMPGMSGYDVCTVLRESySLYQLPILFL 773
Cdd:COG0745     2 RILLVEDDPELAELLKEYLEEEGYEVDVAADGEEALEAAREQ--PDLVLLDLMLPDLDGLELCRRLRAK-KGSGPPIIVL 78
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 189910473  774 TAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLI 811
Cdd:COG0745    79 TARDDEEDRVLGLEAGADDYLTKPFSPRELLARLRALL 116
orf27 CHL00148
Ycf27; Reviewed
692-811 1.85e-29

Ycf27; Reviewed


Pssm-ID: 214376 [Multi-domain]  Cd Length: 240  Bit Score: 118.67  E-value: 1.85e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  692 KLRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCTVLRESYSLyqlPIL 771
Cdd:CHL00148    6 KEKILVVDDEAYIRKILETRLSIIGYEVITASDGEEALKLFRKEQP-DLVILDVMMPKLDGYGVCQEIRKESDV---PII 81
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 189910473  772 FLTAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLI 811
Cdd:CHL00148   82 MLTALGDVSDRITGLELGADDYVVKPFSPKELEARIRSVL 121
PRK11100 PRK11100
sensory histidine kinase CreC; Provisional
362-653 7.83e-27

sensory histidine kinase CreC; Provisional


Pssm-ID: 236846 [Multi-domain]  Cd Length: 475  Bit Score: 114.17  E-value: 7.83e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  362 LVGISTVA-----IAAFVD-----LLNANQIFYSVEAIPIGIFVFILVQSLTLSRRFSRAFSEVETLSKRLL-------- 423
Cdd:PRK11100  160 IIGVLSVGkpnssMAPFIKrserrILWAGALLLGIALLIGAGVVWWLNRSIRRLTRYADAVTEGKPVPLPKLgsselrel 239
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  424 --ALDKLKDEfLANT----------SHELKTPLNGIIGIAESMFDGiggkLNQEQRQN-LGMIVSSGKRLSSLVDDILDF 490
Cdd:PRK11100  240 aqALESMRVK-LEGKayveqyvqtlTHELKSPLAAIRGAAELLQED----PPPEDRARfTGNILTQSARLQQLIDRLLEL 314
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  491 SKMKNR-DLDlDLKAIDLHQICDFVLVISRPLYVTKNLTVRnnvpIDFPP--ILGDEARLQQILFNIIGNAIKFT-EKGR 566
Cdd:PRK11100  315 ARLEQRqELE-VLEPVALAALLEELVEAREAQAAAKGITLR----LRPDDarVLGDPFLLRQALGNLLDNAIDFSpEGGT 389
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  567 IDVSAEIIEKMAVISIRDTGIGIPK---DKFGDIFRSFEQVDasTTRKfgGTGLGLAISKRLVELHGGNIWVESTPAEGS 643
Cdd:PRK11100  390 ITLSAEVDGEQVALSVEDQGPGIPDyalPRIFERFYSLPRPA--NGRK--STGLGLAFVREVARLHGGEVTLRNRPEGGV 465
                         330
                  ....*....|
gi 189910473  644 MFSFSLPLAR 653
Cdd:PRK11100  466 LATLTLPRHF 475
ompR PRK09468
osmolarity response regulator; Provisional
694-808 2.27e-26

osmolarity response regulator; Provisional


Pssm-ID: 181883 [Multi-domain]  Cd Length: 239  Bit Score: 109.68  E-value: 2.27e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEgPFELMVLDIMMPGMSGYDVCTVLRESYSlyQLPILFL 773
Cdd:PRK09468    7 KILVVDDDMRLRALLERYLTEQGFQVRSAANAEQMDRLLTRE-SFHLMVLDLMLPGEDGLSICRRLRSQNN--PTPIIML 83
                          90       100       110
                  ....*....|....*....|....*....|....*
gi 189910473  774 TAKNQIADIIAALEAGGNDYLAKPFDKRELISRAK 808
Cdd:PRK09468   84 TAKGEEVDRIVGLEIGADDYLPKPFNPRELLARIR 118
PhoB TIGR02154
phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response ...
694-827 3.62e-26

phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well [Regulatory functions, DNA interactions, Signal transduction, Two-component systems].


Pssm-ID: 131209 [Multi-domain]  Cd Length: 226  Bit Score: 108.57  E-value: 3.62e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   694 RVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCTVLRESYSLYQLPILFL 773
Cdd:TIGR02154    4 RILVVEDEPAIRELIAYNLEKAGYDVVEAGDGDEALTLINERGP-DLILLDWMLPGTSGIELCRRLRRRPETRAIPIIML 82
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 189910473   774 TAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLitLKKAVEEQNK-FIAIQ 827
Cdd:TIGR02154   83 TARGEEEDRVRGLETGADDYITKPFSPRELLARIKAV--LRRIRPQLSDeVIEVG 135
PRK10364 PRK10364
sensor protein ZraS; Provisional
406-654 1.22e-25

sensor protein ZraS; Provisional


Pssm-ID: 236674 [Multi-domain]  Cd Length: 457  Bit Score: 110.26  E-value: 1.22e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  406 RRFSRAFSEVETLSKR---LLALDKLKdeflANTSHELKTPLNGIIGIAEsmFDGIGGKLNQEQRQNLGMIVSSGKRLSS 482
Cdd:PRK10364  215 RRYLRSRQLLQDEMKRkekLVALGHLA----AGVAHEIRNPLSSIKGLAK--YFAERAPAGGEAHQLAQVMAKEADRLNR 288
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  483 LVDDILDFSKMKnrdlDLDLKAIDLHQICDFVLVISRPLYVTKNLTVRNNVPIDFPPILGDEARLQQILFNIIGNAIK-F 561
Cdd:PRK10364  289 VVSELLELVKPT----HLALQAVDLNDLINHSLQLVSQDANSREIQLRFTANDTLPEIQADPDRLTQVLLNLYLNAIQaI 364
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  562 TEKGRIDVSAEIIEKMAVISIRDTGIGIPKDKFGDIFrsfeqvDASTTRKFGGTGLGLAISKRLVELHGGNIWVESTPAE 641
Cdd:PRK10364  365 GQHGVISVTASESGAGVKISVTDSGKGIAADQLEAIF------TPYFTTKAEGTGLGLAVVHNIVEQHGGTIQVASQEGK 438
                         250
                  ....*....|...
gi 189910473  642 GSMFSFSLPLARE 654
Cdd:PRK10364  439 GATFTLWLPVNIT 451
PleD COG3706
Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal ...
664-835 1.45e-25

Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms]


Pssm-ID: 226229 [Multi-domain]  Cd Length: 435  Bit Score: 109.72  E-value: 1.45e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  664 LKKSEMWFGGDNFEFEPIEETQEELEGEKLRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVrDEGPFELMVL 743
Cdd:COG3706   104 LKCSIDELRLREETGGELGVSPLLPEDAPKKILVVDDDATQRERLRRILQVEGFRVVEATDGEEALLQL-AELPPDLVLL 182
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  744 DIMMPGMSGYDVCTVLRESYSLYQLPILFLTAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLITLKKAveEQNKF 823
Cdd:COG3706   183 DANMPDMDGLELCTRLRQLERTRDIPIILLSSKDDDELVVRAFELGVNDYITKPIEEGELRARLRRQLRRKRY--ERQLR 260
                         170
                  ....*....|..
gi 189910473  824 IAIQNELGLARK 835
Cdd:COG3706   261 ESLERLQELALV 272
COG3437 COG3437
Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription ...
692-837 2.50e-25

Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms]


Pssm-ID: 225971 [Multi-domain]  Cd Length: 360  Bit Score: 108.60  E-value: 2.50e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  692 KLRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVrDEGPFELMVLDIMMPGMSGYDVCTVLRESYSLYQ-LPI 770
Cdd:COG3437    14 KLTVLLVDDEPDNLEALRQLLRMIGYRVIEAENGEEALKLL-QEEPPDLVLLDVRMPEMDGAEVLNKLKAMSPSTRrIPV 92
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 189910473  771 LFLTAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLITLK-KAVEEQNKFIAIQNeLGLARKLQ 837
Cdd:COG3437    93 ILLTAYADSEDRQRALEAGADDYLSKPISPKELVARVSSHLQLKrNEDFLLDQNLYLEL-QELRRRTE 159
PRK10549 PRK10549
signal transduction histidine-protein kinase BaeS; Provisional
432-654 2.21e-24

signal transduction histidine-protein kinase BaeS; Provisional


Pssm-ID: 182539 [Multi-domain]  Cd Length: 466  Bit Score: 106.64  E-value: 2.21e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  432 FLANTSHELKTPLNGIIGIAESMFDGIGgKLNQEQRQNLGMIVSSgkrLSSLVDDILDFSKMKNRDLDLDLKAIDLHQIC 511
Cdd:PRK10549  243 FMADISHELRTPLAVLRGELEAIQDGVR-KFTPESVASLQAEVGT---LTKLVDDLHQLSLSDEGALAYRKTPVDLVPLL 318
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  512 DFVLVISRPLYVTKNLTVRNNVPiDFPPILGDEARLQQILFNIIGNAIKFT-EKGRIDVSAEIIEKMAVISIRDTGIGIP 590
Cdd:PRK10549  319 EVAGGAFRERFASRGLTLQLSLP-DSATVFGDPDRLMQLFNNLLENSLRYTdSGGSLHISAEQRDKTLRLTFADSAPGVS 397
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 189910473  591 KDKFGDIFRSFEQVDASTTRKFGGTGLGLAISKRLVELHGGNIWVESTPAEGSMFSFSLPLARE 654
Cdd:PRK10549  398 DEQLQKLFERFYRTEGSRNRASGGSGLGLAICLNIVEAHNGRIIAAHSPFGGVSITVELPLERD 461
PRK13837 PRK13837
two-component VirA-like sensor kinase; Provisional
437-803 3.23e-24

two-component VirA-like sensor kinase; Provisional


Pssm-ID: 237526 [Multi-domain]  Cd Length: 828  Bit Score: 108.23  E-value: 3.23e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  437 SHELKTPLNGIIGIAESMFDGIggKLNQEQRQNLGMIVSSGKRLSSLVDDILDFSkmknRDLDLDLKAIDLhqiCDFVLV 516
Cdd:PRK13837  458 AHNFNNILGAILGYAEMALNKL--ARHSRAARYIDEIISAGARARLIIDQILAFG----RKGERNTKPFDL---SELVTE 528
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  517 ISRPLYVTKNLTVRNNVpiDFPP----ILGDEARLQQILFNIIGNAIK-FTEKGRIDVSAEIIE---------------K 576
Cdd:PRK13837  529 IAPLLRVSLPPGVELDF--DQDQepavVEGNPAELQQVLMNLCSNAAQaMDGAGRVDISLSRAKlrapkvlshgvlppgR 606
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  577 MAVISIRDTGIGIPKDKFGDIFRSFeqvdaSTTRKfGGTGLGLAISKRLVELHGGNIWVESTPAEGSMFSFSLPL-AREG 655
Cdd:PRK13837  607 YVLLRVSDTGAGIDEAVLPHIFEPF-----FTTRA-GGTGLGLATVHGIVSAHAGYIDVQSTVGRGTRFDVYLPPsSKVP 680
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  656 EIPMEKPQLKKSEMWFGGDnfefepieetqeelegeklrVIVVDDEPINRQVLKNHLTLIGCE---VREAANGVDAIRlv 732
Cdd:PRK13837  681 VAPQAFFGPGPLPRGRGET--------------------VLLVEPDDATLERYEEKLAALGYEpvgFSTLAAAIAWIS-- 738
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 189910473  733 RDEGPFELMVLDimMPGMSGYDVCTVLRESYSlyQLPILFLT-AKNQIAdiIAALEAGGNDYLAKPFDKREL 803
Cdd:PRK13837  739 KGPERFDLVLVD--DRLLDEEQAAAALHAAAP--TLPIILGGnSKTMAL--SPDLLASVAEILAKPISSRTL 804
pleD PRK09581
response regulator PleD; Reviewed
694-819 1.03e-23

response regulator PleD; Reviewed


Pssm-ID: 236577 [Multi-domain]  Cd Length: 457  Bit Score: 104.21  E-value: 1.03e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCTVLRESYSLYQLPILFL 773
Cdd:PRK09581    4 RILVVDDIPANVKLLEAKLLAEYYTVLTASSGAEAIAICEREQP-DIILLDVMMPGMDGFEVCRRLKSDPATTHIPVVMV 82
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 189910473  774 TAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLITLKKAVEE 819
Cdd:PRK09581   83 TALDDPEDRVRGLEAGADDFLTKPINDVALFARVKSLTRLKMVIDE 128
COG4191 COG4191
Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal ...
404-652 1.16e-23

Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms]


Pssm-ID: 226654 [Multi-domain]  Cd Length: 603  Bit Score: 105.86  E-value: 1.16e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  404 LSRRFSRAFSEVETLSKRLLALDKLKDEFL------------ANTSHELKTPLNGIIGIAES--MFDGIGgKLnQEQRQN 469
Cdd:COG4191   347 LTRANARLQAEIAEREQAEAALRRAQDELVqagklaalgqmsAGIAHELNQPLAAIRTYADNarLLLERG-RT-EEAREN 424
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  470 LGMIVSSGKRLSSLVDDILDFSKMKNRDLdldlKAIDLHQICDFVLVISRPLYVTKNLTVRNNVPIDFPPILGDEARLQQ 549
Cdd:COG4191   425 LERISALTERMAAITAHLKSFARKSRDAA----GPVSLREAIEGALELLRGRLRAAGVELELDLPDAPLWVMANEIRLEQ 500
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  550 ILFNIIGNA---IKFTEKGRIDVSAEIIEKMAVISIRDTGIGIPKDKFGDIFRSFEqvdasTTRKFG-GTGLGLAISKRL 625
Cdd:COG4191   501 VLVNLLQNAldaMAGQEDRRLSIRAQREGGQVVLTVRDNGPGIAPEALPHLFEPFF-----TTKPVGkGLGLGLAISQNI 575
                         250       260
                  ....*....|....*....|....*..
gi 189910473  626 VELHGGNIWVESTPAEGSMFSFSLPLA 652
Cdd:COG4191   576 ARDLGGSLEVANHPEGGASFTIELRRA 602
cztS_silS_copS TIGR01386
heavy metal sensor kinase; Members of this family contain a sensor histidine kinase domain ...
362-650 1.28e-22

heavy metal sensor kinase; Members of this family contain a sensor histidine kinase domain (pfam00512) and a domain found in bacterial signal proteins (pfam00672). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc.


Pssm-ID: 233391 [Multi-domain]  Cd Length: 457  Bit Score: 100.92  E-value: 1.28e-22
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   362 LVGISTVAIAAFVDLLNANQIFYSVEAIPIGIFV--FILVQSLTLSRRFSRAFSEV--ETLSKRL-----------LA-- 424
Cdd:TIGR01386  147 TVALDINAHTHLLDALRKWLILIAVLLVLLTALLgwWITRLGLEPLRRLSAVAARIspESLDQRLdpsrapaelreLAqs 226
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   425 ----LDKLKD------EFLANTSHELKTPLNGIIGIAESMfdgiggkLNQEQRQ-NLGMIVSSG----KRLSSLVDDILD 489
Cdd:TIGR01386  227 fnamLGRLEDafqrlsQFSADLAHELRTPLTNLLGQTQVA-------LSQPRTGeEYREVLESNleelERLSRMVSDMLF 299
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   490 FSKMKNRDLDLDLKAIDLHQICDFVLVISRPLYVTKNLTVRNNVPIDfppILGDEARLQQILFNIIGNAIKFT-EKGRID 568
Cdd:TIGR01386  300 LARADNGQLALERVRLDLAAELAKVAEYFEPLAEERGVRIRVEGEGL---VRGDPQMFRRAISNLLSNALRHTpDGGTIT 376
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   569 VSAEIIEKMAVISIRDTGIGIPKDKFGDIFRSFEQVDASTTRKFGGTGLGLAISKRLVELHGGNIWVESTPAEgSMFSFS 648
Cdd:TIGR01386  377 VRIERRSDEVRVSVSNPGPGIPPEHLSRLFDRFYRVDPARSNSGEGTGLGLAIVRSIMEAHGGRASAESPDGK-TRFILR 455

                   ..
gi 189910473   649 LP 650
Cdd:TIGR01386  456 FP 457
phoR PRK11006
phosphate regulon sensor protein; Provisional
432-650 2.27e-22

phosphate regulon sensor protein; Provisional


Pssm-ID: 182895 [Multi-domain]  Cd Length: 430  Bit Score: 100.08  E-value: 2.27e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  432 FLANTSHELKTPLNGIIGIAESMFD-GIGGKLNQEQrqnLGMIVSSGKRLSSLVDDILDFSKMKNRdldldlKAIDLHQI 510
Cdd:PRK11006  207 FFANVSHELRTPLTVLQGYLEMMQDqPLEGALREKA---LHTMREQTQRMEGLVKQLLTLSKIEAA------PTIDLNEK 277
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  511 CDfVLVISRPLYVTKNLTVRNNVPIDFP-----PILGDEARLQQILFNIIGNAIKFTEKG-RIDVSAEIIEKMAVISIRD 584
Cdd:PRK11006  278 VD-VPMMLRVLEREAQTLSQGKHTITFEvdnslKVFGNEDQLRSAISNLVYNAVNHTPEGtHITVRWQRVPQGAEFSVED 356
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 189910473  585 TGIGIPKDKFGDIFRSFEQVDASTTRKFGGTGLGLAISKRLVELHGGNIWVESTPAEGSMFSFSLP 650
Cdd:PRK11006  357 NGPGIAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHALSHHDSRLEIESEVGKGTRFSFVLP 422
PRK10490 PRK10490
sensor protein KdpD; Provisional
402-657 3.48e-22

sensor protein KdpD; Provisional


Pssm-ID: 236701 [Multi-domain]  Cd Length: 895  Bit Score: 101.65  E-value: 3.48e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  402 LTLSRRFSRAFSEVETlskrllalDKLKDEFLANTSHELKTPLNGIIGIAES-MFD--GIGGKLNQEQRQNLGMIVSSgk 478
Cdd:PRK10490  645 LTLTASEEQARLASER--------EQLRNALLAALSHDLRTPLTVLFGQAEIlTLDlaSEGSPHARQASEIRQQVLNT-- 714
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  479 rlSSLVDDILDFSKMKNRDLDLDLKAIDLHQICDFVLVISRPLYVTKNLTVrnNVPIDFPPILGDEARLQQILFNIIGNA 558
Cdd:PRK10490  715 --TRLVNNLLDMARIQSGGFNLRKEWLTLEEVVGSALQMLEPGLSGHPINL--SLPEPLTLIHVDGPLFERVLINLLENA 790
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  559 IKFT-EKGRIDVSAEIIEKMAVISIRDTGIGIPKDKFGDIFRSFEQVDASTTrkFGGTGLGLAISKRLVELHGGNIWVES 637
Cdd:PRK10490  791 VKYAgAQAEIGIDAHVEGERLQLDVWDNGPGIPPGQEQLIFDKFARGNKESA--IPGVGLGLAICRAIVEVHGGTIWAEN 868
                         250       260
                  ....*....|....*....|
gi 189910473  638 TPAEGSMFSFSLPLAREGEI 657
Cdd:PRK10490  869 RPEGGACFRVTLPLETPPEL 888
NtrB COG3852
Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms]
438-657 6.42e-22

Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms]


Pssm-ID: 226370 [Multi-domain]  Cd Length: 363  Bit Score: 97.83  E-value: 6.42e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  438 HELKTPLNGIIGIAESMFDGIGGKLNQEQRQnlgMIVSSGKRLSSLVDDILDFSKMKnrdlDLDLKAIDLHQICDFVLVI 517
Cdd:COG3852   141 HEIKNPLGGIRGAAQLLERALPDEALRELTQ---LIIEEADRLRNLVDRLEVLGPQR----PGDRVPVNIHEVLERVRAL 213
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  518 SRpLYVTKNLTVRNNVPIDFPPILGDEARLQQILFNIIGNAIKfTEKGRIDVSAEII---------------EKMAV-IS 581
Cdd:COG3852   214 VE-AEFADNVRLIRDYDPSLPEVLGDRDQLIQVFLNLVRNAAQ-ALGGRADEGGEIIlrtrtgiqltiagtrYRLALpLE 291
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 189910473  582 IRDTGIGIPKDKFGDIFRSFeqvdasTTRKFGGTGLGLAISKRLVELHGGNIWVESTPAeGSMFSFSLPLAREGEI 657
Cdd:COG3852   292 VIDNGPGVPPDLQDHLFYPM------VSGREGGTGLGLALAQNLIDQHGGKIEFDSWPG-RTVFRVLLPIRKEAAL 360
cztR_silR_copR TIGR01387
heavy metal response regulator; Members of this family contain a response regulator receiver ...
695-811 2.45e-21

heavy metal response regulator; Members of this family contain a response regulator receiver domain (pfam00072) and an associated transcriptional regulatory region (pfam00486). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc. Most members encoded by genes adjacent to genes for encoding a member of the heavy metal sensor histidine kinase family (TIGRFAMs:TIGR01386), its partner in the two-component response regulator system.


Pssm-ID: 130454 [Multi-domain]  Cd Length: 218  Bit Score: 94.10  E-value: 2.45e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   695 VIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVrDEGPFELMVLDIMMPGMSGYDVCTVLRESYSlyQLPILFLT 774
Cdd:TIGR01387    1 ILVVEDEQKTAEYLQQGLSESGYVVDAASNGRDGLHLA-LKDDYDLIILDVMLPGMDGWQILQTLRRSGK--QTPVLFLT 77
                           90       100       110
                   ....*....|....*....|....*....|....*..
gi 189910473   775 AKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLI 811
Cdd:TIGR01387   78 ARDSVADKVKGLDLGADDYLVKPFSFSELLARVRTLL 114
AtoC COG2204
Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains ...
694-841 1.74e-20

Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]


Pssm-ID: 225114 [Multi-domain]  Cd Length: 464  Bit Score: 94.69  E-value: 1.74e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRdEGPFELMVLDIMMPGMSGYDVCTVLRESYSlyQLPILFL 773
Cdd:COG2204     6 RILVVDDDPDIRELLEQALELAGYEVVTAESAEEALEALS-ESPFDLVLLDIRMPGMDGLELLKEIKSRDP--DLPVIVM 82
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 189910473  774 TAKNQIADIIAALEAGGNDYLAKPFDKRELisraknLITLKKAVEEQNKFIAIQNELGLARKLQYSIL 841
Cdd:COG2204    83 TGHGDIDTAVEALRLGAFDFLEKPFDLDRL------LAIVERALELRELQRENRRSLKRAKSLGGELV 144
PRK11083 PRK11083
DNA-binding response regulator CreB; Provisional
694-808 8.06e-20

DNA-binding response regulator CreB; Provisional


Pssm-ID: 236838 [Multi-domain]  Cd Length: 228  Bit Score: 90.02  E-value: 8.06e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDeGPFELMVLDIMMPGMSGYDVCTVLRESYSlyQLPILFL 773
Cdd:PRK11083    5 TILLVEDEQAIADTLVYALQSEGFTVEWFERGLPALDKLRQ-QPPDLVILDVGLPDISGFELCRQLLAFHP--ALPVIFL 81
                          90       100       110
                  ....*....|....*....|....*....|....*
gi 189910473  774 TAKNQIADIIAALEAGGNDYLAKPFDKRELISRAK 808
Cdd:PRK11083   82 TARSDEVDRLVGLEIGADDYVAKPFSPREVAARVR 116
cpxA PRK09470
two-component sensor protein; Provisional
433-655 1.04e-19

two-component sensor protein; Provisional


Pssm-ID: 236532 [Multi-domain]  Cd Length: 461  Bit Score: 92.30  E-value: 1.04e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  433 LANTSHELKTPLNGIiGIAESMFDGIGGKLNQEQRqnlgmIVSSGKRLSSLVDDILDFSKMKnRDLDLDLKAIDLHQICD 512
Cdd:PRK09470  247 LSDISHELRTPLTRL-QLATALLRRRQGESKELER-----IETEAQRLDSMINDLLVLSRNQ-QKNHLERETFKANSLWS 319
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  513 FVLVISR--PLYVTKNLTVrnNVPIDFPPILGDEARLQQILFNIIGNAIKFTeKGRIDVSAEIIEKMAVISIRDTGIGIP 590
Cdd:PRK09470  320 EVLEDAKfeAEQMGKSLTV--SAPPGPWPINGNPNALASALENIVRNALRYS-HTKIEVAFSVDKDGLTITVDDDGPGVP 396
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 189910473  591 KDKFGDIFRSFEQVDASTTRKFGGTGLGLAISKRLVELHGGNIWVESTPAEGSMFSFSLPLAREG 655
Cdd:PRK09470  397 EEEREQIFRPFYRVDEARDRESGGTGLGLAIVENAIQQHRGWVKAEDSPLGGLRLTIWLPLYKRS 461
CitB COG2197
Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain ...
694-804 2.97e-19

Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]


Pssm-ID: 225107 [Multi-domain]  Cd Length: 211  Bit Score: 87.74  E-value: 2.97e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNHLTLIG-CEVR-EAANGVDAIRLVRdEGPFELMVLDIMMPGMSGYDVCTVLRESYSlyQLPIL 771
Cdd:COG2197     2 KVLIVDDHPLVREGLRQLLELEPdLEVVgEASNGEEALDLAR-ELKPDVVLLDLSMPGMDGLEALKQLRARGP--DIKVV 78
                          90       100       110
                  ....*....|....*....|....*....|...
gi 189910473  772 FLTAKNQIADIIAALEAGGNDYLAKPFDKRELI 804
Cdd:COG2197    79 VLTAHDDPAYVIRALRAGADGYLLKDASPEELV 111
PRK09835 PRK09835
sensor kinase CusS; Provisional
432-650 3.65e-19

sensor kinase CusS; Provisional


Pssm-ID: 182101 [Multi-domain]  Cd Length: 482  Bit Score: 90.60  E-value: 3.65e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  432 FLANTSHELKTPLNGIIGIAEsmfdgIGGKLNQEQRQNLGMIVSSGK---RLSSLVDDILDFSKMKNRDLDLDLKAIDLH 508
Cdd:PRK09835  265 FSADIAHEIRTPITNLITQTE-----IALSQSRSQKELEDVLYSNLEeltRMAKMVSDMLFLAQADNNQLIPEKKMLDLA 339
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  509 QICDFVLVISRPLYVTKNLTVRNNVpiDFPPILGDEARLQQILFNIIGNAIKFTEKG-RIDVSAEIIEKMAVISIRDTGI 587
Cdd:PRK09835  340 DEVGKVFDFFEAWAEERGVELRFVG--DPCQVAGDPLMLRRAISNLLSNALRYTPAGeAITVRCQEVDHQVQLVVENPGT 417
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 189910473  588 GIPKDKFGDIFRSFEQVDASTTRKFGGTGLGLAISKRLVELHGGNIWVESTpAEGSMFSFSLP 650
Cdd:PRK09835  418 PIAPEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVAHKGTVAVTSD-ARGTRFVISLP 479
marine_sort_HK TIGR03785
proteobacterial dedicated sortase system histidine kinase; This histidine kinase protein is ...
404-650 1.64e-18

proteobacterial dedicated sortase system histidine kinase; This histidine kinase protein is paired with an adjacent response regulator (TIGR03787) gene. It co-occurs with a variant sortase enzyme (TIGR03784), usually in the same gene neighborhood, in proteobacterial species most of which are marine, and with an LPXTG motif-containing sortase target conserved protein (TIGR03788). Sortases and LPXTG proteins are far more common in Gram-positive bacteria, where sortase systems mediate attachment to the cell wall or cross-linking of pilin structures. We give this predicted sensor histidine kinase the gene symbol psdS, for Proteobacterial Dedicated Sortase system Sensor histidine kinase.


Pssm-ID: 163497 [Multi-domain]  Cd Length: 703  Bit Score: 89.42  E-value: 1.64e-18
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   404 LSRRFSRAFSEV-------ETLSKRLlaldklkdeflantSHELKTPLngiiGIAESMFDGIG-GKLNQEQRQNLGMIVS 475
Cdd:TIGR03785  467 LSRSFAQMVARLrqythylENMSSRL--------------SHELRTPV----AVVRSSLENLElQALEQEKQKYLERARE 528
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   476 SGKRLSSLVDDILDFSKMKNRDLDLDLKAIDLHQicdfvlVIS------RPLYVTKNLTVrnNVPIDFPPILGDEARLQQ 549
Cdd:TIGR03785  529 GTERLSMILNNMSEATRLEQAIQSAEVEDFDLSE------VLSgcmqgyQMTYPPQRFEL--NIPETPLVMRGSPELIAQ 600
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   550 ILFNIIGNAIKFT-EKGRIDVSAEIIEKMAVISIRDTGIGIPKDKFGDIFRSFEQVDASTTRKFGGTGLGLAISKRLVEL 628
Cdd:TIGR03785  601 MLDKLVDNAREFSpEDGLIEVGLSQNKSHALLTVSNEGPPLPEDMGEQLFDSMVSVRDQGAQDQPHLGLGLYIVRLIADF 680
                          250       260
                   ....*....|....*....|...
gi 189910473   629 HGGNIWVESTP-AEGSMFSFSLP 650
Cdd:TIGR03785  681 HQGRIQAENRQqNDGVVFRISLP 703
PRK11361 PRK11361
acetoacetate metabolism regulatory protein AtoC; Provisional
694-1014 6.22e-18

acetoacetate metabolism regulatory protein AtoC; Provisional


Pssm-ID: 183099 [Multi-domain]  Cd Length: 457  Bit Score: 86.83  E-value: 6.22e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCTVLRESYSlyQLPILFL 773
Cdd:PRK11361    6 RILIVDDEDNVRRMLSTAFALQGFETHCANNGRTALHLFADIHP-DVVLMDIRMPEMDGIKALKEMRSHET--RTPVILM 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  774 TAKNQIADIIAALEAGGNDYLAKPFDKRE---LISRAKNLITLKKAVEEQNKfiaiqnelGLARKLQYSILPEEAPNVVG 850
Cdd:PRK11361   83 TAYAEVETAVEALRCGAFDYVIKPFDLDElnlIVQRALQLQSMKKEIRHLHQ--------ALSTSWQWGHILTNSPAMMD 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  851 IKTefyyepmdsiggdffDFHAISETELGVLIADVSGHGipAALVSAmlKIAFSTQ--------VRLAKEPSQLLnqiNS 922
Cdd:PRK11361  155 ICK---------------DTAKIALSQASVLISGESGTG--KELIAR--AIHYNSRrakgpfikVNCAALPESLL---ES 212
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  923 TLLGKMKGAFVTASyvyinlETKEMIHARCGHPPLIINRRGESKAKLsipQGKLigwipeLDIQEDRISIRSGDRIVLYT 1002
Cdd:PRK11361  213 ELFGHEKGAFTGAQ------TLRQGLFERANEGTLLLDEIGEMPLVL---QAKL------LRILQEREFERIGGHQTIKV 277
                         330
                  ....*....|...
gi 189910473 1003 D-GITEATNANRE 1014
Cdd:PRK11361  278 DiRIIAATNRDLQ 290
PRK10955 PRK10955
DNA-binding transcriptional regulator CpxR; Provisional
694-820 9.41e-18

DNA-binding transcriptional regulator CpxR; Provisional


Pssm-ID: 182864 [Multi-domain]  Cd Length: 232  Bit Score: 83.70  E-value: 9.41e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEgpFELMVLDIMMPGMSGYDVCTVLRESYslyQLPILFL 773
Cdd:PRK10955    3 KILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDDS--IDLLLLDVMMPKKNGIDTLKELRQTH---QTPVIML 77
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*..
gi 189910473  774 TAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLITLKKAVEEQ 820
Cdd:PRK10955   78 TARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHWSEQQ 124
ntrC TIGR01818
nitrogen regulation protein NR(I); This model represents NtrC, a DNA-binding response ...
695-935 1.17e-17

nitrogen regulation protein NR(I); This model represents NtrC, a DNA-binding response regulator that is phosphorylated by NtrB and interacts with sigma-54. NtrC usually controls the expression of glutamine synthase, GlnA, and may be called GlnL, GlnG, etc [Central intermediary metabolism, Nitrogen metabolism, Regulatory functions, DNA interactions, Signal transduction, Two-component systems].


Pssm-ID: 233585 [Multi-domain]  Cd Length: 463  Bit Score: 85.95  E-value: 1.17e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   695 VIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCTVLRESYSlyQLPILFLT 774
Cdd:TIGR01818    1 VWVVDDDRSIRWVLEKALSRAGYEVRTFGNAASVLRALARGQP-DLLITDVRMPGEDGLDLLPQIKKRHP--QLPVIVMT 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   775 AKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLITLKKAveeqnkfiaiQNELGLARKLQYSILP--EEAPnvvgik 852
Cdd:TIGR01818   78 AHSDLDTAVAAYQRGAFEYLPKPFDLDEAVTLVERALAHAQE----------QVALPADAGEAEDSAEliGEAP------ 141
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   853 tefyyePMDSIggdffdFHAI---SETELGVLIADVSGHGipAALVSAMLK----------IAFSTqvrlAKEPSQLlnq 919
Cdd:TIGR01818  142 ------AMQEV------FRAIgrlSRSDITVLINGESGTG--KELVARALHrhsprangpfIALNM----AAIPKDL--- 200
                          250
                   ....*....|....*.
gi 189910473   920 INSTLLGKMKGAFVTA 935
Cdd:TIGR01818  201 IESELFGHEKGAFTGA 216
PRK10604 PRK10604
sensor protein RstB; Provisional
437-651 3.25e-17

sensor protein RstB; Provisional


Pssm-ID: 236724 [Multi-domain]  Cd Length: 433  Bit Score: 84.27  E-value: 3.25e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  437 SHELKTPLNGIIGIAEsMFDGiggkLNQEQRQNLGMIVSsgkRLSSLVDDILDFSKMKNRDLDLDLKAIDLHQ-----IC 511
Cdd:PRK10604  220 AHELRTPLVRLRYRLE-MSDN----LSAAESQALNRDIG---QLEALIEELLTYARLDRPQNELHLSEPDLPAwlsthLA 291
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  512 DFVLVisRPlyvTKNLTVRNNVPIDFppILGDEARLQQILFNIIGNAIKFTEkGRIDVSAEIIEKMAVISIRDTGIGIPK 591
Cdd:PRK10604  292 DIQAV--TP---EKTVRLDTPHQGDY--GALDMRLMERVLDNLLNNALRYAH-SRVRVSLLLDGNQACLIVEDDGPGIPP 363
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  592 DKFGDIFRSFEQVDASTTRKFGGTGLGLAISKRLVELHGGNIWVESTPAEGSMFSFSLPL 651
Cdd:PRK10604  364 EERERVFEPFVRLDPSRDRATGGCGLGLAIVHSIALAMGGSVNCDESELGGARFSFSWPV 423
PRK11517 PRK11517
transcriptional regulatory protein YedW; Provisional
693-808 3.67e-17

transcriptional regulatory protein YedW; Provisional


Pssm-ID: 183172 [Multi-domain]  Cd Length: 223  Bit Score: 81.87  E-value: 3.67e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  693 LRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGpFELMVLDIMMPGMSGYDVCTVLRESYslyQLPILF 772
Cdd:PRK11517    1 MKILLIEDNQRTQEWVTQGLSEAGYVIDAVSDGRDGLYLALKDD-YALIILDIMLPGMDGWQILQTLRTAK---QTPVIC 76
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 189910473  773 LTAKNQIADIIAALEAGGNDYLAKPFDKRELISRAK 808
Cdd:PRK11517   77 LTARDSVDDRVRGLDSGANDYLVKPFSFSELLARVR 112
PRK11173 PRK11173
two-component response regulator; Provisional
694-812 8.39e-17

two-component response regulator; Provisional


Pssm-ID: 183013 [Multi-domain]  Cd Length: 237  Bit Score: 80.83  E-value: 8.39e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEgPFELMVLDIMMPGMSGYDVCTVLRESYSLyqlPILFL 773
Cdd:PRK11173    5 HILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEN-DINLVIMDINLPGKNGLLLARELREQANV---ALMFL 80
                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 189910473  774 TAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLIT 812
Cdd:PRK11173   81 TGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLS 119
NtrY COG5000
Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation ...
438-655 9.70e-17

Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms]


Pssm-ID: 227333 [Multi-domain]  Cd Length: 712  Bit Score: 84.05  E-value: 9.70e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  438 HELKTPLNGIIGIAESMFDGIGGKLNQEQ---RQNLGMIVSSGKRLSSLVDDILDFSKMKnrdlDLDLKAIDLHQICDFV 514
Cdd:COG5000   495 HEIKNPLTPIQLSAERLLRKLGKEIDEDRevfDRCTDTIIRQVEDIKRMVDEFRAFARMP----APKLEKSDLRALLKEV 570
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  515 LVISRPLyvTKNLTVRNNVPIDFPPILGDEARLQQILFNIIGNAIKFTEK--------GRIDVSAEIIEKMAVISIRDTG 586
Cdd:COG5000   571 SFLYEIG--NDHIVFAAEFGGEPLIGMADATLLGQVFGNLLKNAAEAIEAveaeerrtALIRVSLDDADGRIVVDVIDNG 648
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  587 IGIPKDKFGDIFRSFeqvdaSTTRKfGGTGLGLAISKRLVELHGGNIWVESTP-AEGSMFSFSLPLAREG 655
Cdd:COG5000   649 KGFPRENRHRALEPY-----VTTRE-KGTGLGLAIVKKIVEEHGGRLELHNAPdFDGAMIRIKFPLKELG 712
PRK10766 PRK10766
DNA-binding transcriptional regulator TorR; Provisional
694-820 1.82e-16

DNA-binding transcriptional regulator TorR; Provisional


Pssm-ID: 182711 [Multi-domain]  Cd Length: 221  Bit Score: 79.70  E-value: 1.82e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDaIRLVRDEGPFELMVLDIMMPGMSGYdvcTVLRESYSLYQLPILFL 773
Cdd:PRK10766    4 HILVVEDEPVTRARLQGYFEQEGYTVSEAASGAG-MREIMQNQHVDLILLDINLPGEDGL---MLTRELRSRSTVGIILV 79
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|
gi 189910473  774 TAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNL---ITLKKAVEEQ 820
Cdd:PRK10766   80 TGRTDSIDRIVGLEMGADDYVTKPLELRELLVRVKNLlwrISLARQAQPH 129
PRK10710 PRK10710
DNA-binding transcriptional regulator BaeR; Provisional
694-829 2.82e-16

DNA-binding transcriptional regulator BaeR; Provisional


Pssm-ID: 182665 [Multi-domain]  Cd Length: 240  Bit Score: 78.96  E-value: 2.82e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCtvlRESYSLYQLPILFL 773
Cdd:PRK10710   12 RILIVEDEPKLGQLLIDYLQAASYATTLLSHGDEVLPYVRQTPP-DLILLDLMLPGTDGLTLC---REIRRFSDIPIVMV 87
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 189910473  774 TAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKnliTLKKAVEEQNKFIAIQNE 829
Cdd:PRK10710   88 TAKIEEIDRLLGLEIGADDYICKPYSPREVVARVK---TILRRCKPQRELQQQDAE 140
COG4753 COG4753
Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain ...
694-823 3.24e-16

Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms]


Pssm-ID: 227095 [Multi-domain]  Cd Length: 475  Bit Score: 81.25  E-value: 3.24e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNhltLI-----GCE-VREAANGVDAIRLVRDEgPFELMVLDIMMPGMSGYDVCTVLRESYSLYQ 767
Cdd:COG4753     3 KVLIVDDEPLIREGLKS---LIdwealGIEvVGTAANGKEALELIQET-QPDIVITDINMPGMDGLDLIKAIKEQSPDTE 78
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 189910473  768 LPIL-----FLTAKnqiadiiAALEAGGNDYLAKPFDKRELISrakNLITLKKAVEEQNKF 823
Cdd:COG4753    79 FIILsgydeFEYAK-------KAMKLGVKDYLLKPVDKAELEE---ALKKIIGKLEEQQKV 129
PRK15479 PRK15479
transcriptional regulatory protein TctD; Provisional
693-811 3.75e-16

transcriptional regulatory protein TctD; Provisional


Pssm-ID: 185376 [Multi-domain]  Cd Length: 221  Bit Score: 78.61  E-value: 3.75e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  693 LRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGpFELMVLDIMMPGMSGYDVCTVLRESYSlyQLPILF 772
Cdd:PRK15479    1 MRLLLAEDNRELAHWLEKALVQNGFAVDCVFDGLAADHLLQSEM-YALAVLDINMPGMDGLEVLQRLRKRGQ--TLPVLL 77
                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 189910473  773 LTAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLI 811
Cdd:PRK15479   78 LTARSAVADRVKGLNVGADDYLPKPFELEELDARLRALL 116
PRK09836 PRK09836
DNA-binding transcriptional activator CusR; Provisional
693-823 1.02e-15

DNA-binding transcriptional activator CusR; Provisional


Pssm-ID: 182102 [Multi-domain]  Cd Length: 227  Bit Score: 77.27  E-value: 1.02e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  693 LRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRdEGPFELMVLDIMMPGMSGYDVCTVLRESYSlyQLPILF 772
Cdd:PRK09836    1 MKLLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAM-TGDYDLIILDIMLPDVNGWDIVRMLRSANK--GMPILL 77
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
gi 189910473  773 LTAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLITLKKAVEEQNKF 823
Cdd:PRK09836   78 LTALGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRRGAAVIIESQF 128
PEP_his_kin TIGR02916
putative PEP-CTERM system histidine kinase; Members of this protein family have a novel ...
540-650 6.21e-15

putative PEP-CTERM system histidine kinase; Members of this protein family have a novel N-terminal domain, a single predicted membrane-spanning helix, and a predicted cystosolic histidine kinase domain. We designate this protein PrsK, and its companion DNA-binding response regulator protein (TIGR02915) PrsR. These predicted signal-transducing proteins appear to enable enhancer-dependent transcriptional activation. The prsK gene is often associated with exopolysaccharide biosynthesis genes [Protein fate, Protein and peptide secretion and trafficking, Signal transduction, Two-component systems].


Pssm-ID: 234058 [Multi-domain]  Cd Length: 679  Bit Score: 77.84  E-value: 6.21e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   540 ILGDEARLQQILFNIIGNAIKFTE-KGRIDVSAEIIEKMAVISIRDTGIGIPKDKFGD-IFRSFEqvdastTRKFGGTGL 617
Cdd:TIGR02916  573 VRADRERLERVLGHLVQNALEATPgEGRVAIRVERECGAARIEIEDSGCGMSPAFIRErLFKPFD------TTKGAGMGI 646
                           90       100       110
                   ....*....|....*....|....*....|...
gi 189910473   618 GLAISKRLVELHGGNIWVESTPAEGSMFSFSLP 650
Cdd:TIGR02916  647 GVYECRQYVEEIGGRIEVESTPGQGTIFTLVLP 679
PRK13557 PRK13557
histidine kinase; Provisional
437-811 1.97e-14

histidine kinase; Provisional


Pssm-ID: 237425 [Multi-domain]  Cd Length: 540  Bit Score: 75.86  E-value: 1.97e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  437 SHELKTPLNGIIGIAESMFDGI-GGKLNQEQ-RQNLGMIVSSGKRLSSLVDDILDFSKmKNRdldLDLKAIDLHQICD-F 513
Cdd:PRK13557  171 AHDFNNLLQVMSGYLDVIQAALsHPDADRGRmARSVENIRAAAERAATLTQQLLAFAR-KQR---LEGRVLNLNGLVSgM 246
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  514 VLVISRPLyvTKNLTVRNNVPIDFPPILGDEARLQQILFNIIGNAIK-FTEKGRIDVSAEIIE---------------KM 577
Cdd:PRK13557  247 GELAERTL--GDAVTIETDLAPDLWNCRIDPTQAEVALLNVLINARDaMPEGGRVTIRTRNVEiededlamyhglppgRY 324
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  578 AVISIRDTGIGIPKDKFGDIFRSFeqvdaSTTRKFG-GTGLGLAISKRLVELHGGNIWVESTPAEGSMFSFSLPLAREGE 656
Cdd:PRK13557  325 VSIAVTDTGSGMPPEILARVMDPF-----FTTKEEGkGTGLGLSMVYGFAKQSGGAVRIYSEVGEGTTVRLYFPASDQAE 399
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  657 IPMEKPQLKKSEMwfGGDNfefepieetqeelegeklRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEG 736
Cdd:PRK13557  400 NPEQEPKARAIDR--GGTE------------------TILIVDDRPDVAELARMILEDFGYRTLVASNGREALEILDSHP 459
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  737 PFELMVLDIMMPG-MSGYdvcTVLRESYSLY-QLPILFLTAknqIADiiAALE---AGGN--DYLAKPFDKRELISRAKN 809
Cdd:PRK13557  460 EVDLLFTDLIMPGgMNGV---MLAREARRRQpKIKVLLTTG---YAE--ASIErtdAGGSefDILNKPYRRAELARRVRM 531

                  ..
gi 189910473  810 LI 811
Cdd:PRK13557  532 VL 533
PRK10693 PRK10693
response regulator of RpoS; Provisional
720-924 4.00e-13

response regulator of RpoS; Provisional


Pssm-ID: 182652 [Multi-domain]  Cd Length: 303  Bit Score: 70.02  E-value: 4.00e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  720 REAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCTVLRESYSlyQLPILFLTAKNQIADIIAALEAGGNDYLAKPFd 799
Cdd:PRK10693    1 VLAANGVDALELLGGFTP-DLIICDLAMPRMNGIEFVEHLRNRGD--QTPVLVISATENMADIAKALRLGVQDVLLKPV- 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  800 krelisraKNLITLKKAV-------------EEQNKFI----AIQNELGLARKLQYSILPEEAPNVVGIKTEFYYEPMDS 862
Cdd:PRK10693   77 --------KDLNRLREMVfaclypsmfnsrvEEEERLFrdwdALVDNPAAAAKLLKQLQPPVQQVIAHCRVNYRQLVAAD 148
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  863 IGGDFFDFHAISETELGVLIADVS---GHGIPAALV-----SAMLKIAFSTQVRLAKEPSQLLNQINSTL 924
Cdd:PRK10693  149 KPGLVLDIAALSDNDLAFYCLDVTragDNGVLAALLlralfNGLLQEQLAHQNQRLPELGALLKQVNHLL 218
PRK10161 PRK10161
transcriptional regulator PhoB; Provisional
694-819 4.78e-13

transcriptional regulator PhoB; Provisional


Pssm-ID: 182277 [Multi-domain]  Cd Length: 229  Bit Score: 68.98  E-value: 4.78e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCTVLRESYSLYQLPILFL 773
Cdd:PRK10161    4 RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWP-DLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVML 82
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 189910473  774 TAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLI--TLKKAVEE 819
Cdd:PRK10161   83 TARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMrrISPMAVEE 130
PRK11697 PRK11697
putative two-component response-regulatory protein YehT; Provisional
693-826 6.36e-13

putative two-component response-regulatory protein YehT; Provisional


Pssm-ID: 236956 [Multi-domain]  Cd Length: 238  Bit Score: 68.72  E-value: 6.36e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  693 LRVIVVDDEPINRQVLKNHL------TLIGcevrEAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCTVLRESysly 766
Cdd:PRK11697    2 IKVLIVDDEPLAREELRELLqeegdiEIVG----ECSNAIEAIGAIHRLKP-DVVFLDIQMPRISGLELVGMLDPE---- 72
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 189910473  767 QLP-ILFLTAKNQIAdiIAALEAGGNDYLAKPFDKRELisrAKNLITLKKAVEEQNKFIAI 826
Cdd:PRK11697   73 HMPyIVFVTAFDEYA--IKAFEEHAFDYLLKPIDPARL---AKTLARLRQERSPQDVLLPE 128
PRK10651 PRK10651
transcriptional regulator NarL; Provisional
694-804 6.78e-13

transcriptional regulator NarL; Provisional


Pssm-ID: 182619 [Multi-domain]  Cd Length: 216  Bit Score: 68.52  E-value: 6.78e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNHLTLIG--CEVREAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCTVLRESYSLYQlpIL 771
Cdd:PRK10651    8 TILLIDDHPMLRTGVKQLISMAPdiTVVGEASNGEQGIELAESLDP-DLILLDLNMPGMNGLETLDKLREKSLSGR--IV 84
                          90       100       110
                  ....*....|....*....|....*....|...
gi 189910473  772 FLTAKNQIADIIAALEAGGNDYLAKPFDKRELI 804
Cdd:PRK10651   85 VFSVSNHEEDVVTALKRGADGYLLKDMEPEDLL 117
PRK10643 PRK10643
DNA-binding transcriptional regulator BasR; Provisional
693-811 1.32e-12

DNA-binding transcriptional regulator BasR; Provisional


Pssm-ID: 182612 [Multi-domain]  Cd Length: 222  Bit Score: 67.37  E-value: 1.32e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  693 LRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVrDEGPFELMVLDIMMPGMSGYDVCTVLRESYslYQLPILF 772
Cdd:PRK10643    1 MKILIVEDDTLLLQGLILALQTEGYACDCASTAREAEALL-ESGHYSLVVLDLGLPDEDGLHLLRRWRQKK--YTLPVLI 77
                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 189910473  773 LTAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLI 811
Cdd:PRK10643   78 LTARDTLEDRVAGLDVGADDYLVKPFALEELHARIRALI 116
glnL PRK11073
nitrogen regulation protein NR(II); Provisional
437-651 1.93e-12

nitrogen regulation protein NR(II); Provisional


Pssm-ID: 182947 [Multi-domain]  Cd Length: 348  Bit Score: 68.57  E-value: 1.93e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  437 SHELKTPLNGIIGIAESMFDGIGGKLNQEQRQnlgMIVSSGKRLSSLVDDILDFSK--MKNRDldldlkaiDLHQICDFV 514
Cdd:PRK11073  138 AHEIKNPLGGLRGAAQLLSKALPDPALTEYTK---VIIEQADRLRNLVDRLLGPQRpgTHVTE--------SIHKVAERV 206
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  515 --LVisrPLYVTKNLTVRNNVPIDFPPILGDEARLQQILFNIIGNAI--------KFTEKGRIDVSAEIIEK----MAVI 580
Cdd:PRK11073  207 vqLV---SLELPDNVRLIRDYDPSLPELAHDPDQIEQVLLNIVRNALqalgpeggTITLRTRTAFQLTLHGEryrlAARI 283
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 189910473  581 SIRDTGIGIPKDKFGDIFrsFEQVDAsttrKFGGTGLGLAISKRLVELHGGNIWVESTPAEgSMFSFSLPL 651
Cdd:PRK11073  284 DIEDNGPGIPPHLQDTLF--YPMVSG----REGGTGLGLSIARNLIDQHSGKIEFTSWPGH-TEFSVYLPI 347
TtrR COG4566
Response regulator [Signal transduction mechanisms]
695-805 2.03e-12

Response regulator [Signal transduction mechanisms]


Pssm-ID: 226932 [Multi-domain]  Cd Length: 202  Bit Score: 66.54  E-value: 2.03e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  695 VIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGPFELmVLDIMMPGMSGYDVCTVLRESYSlyQLPILFLT 774
Cdd:COG4566     7 VHVVDDDESVRDALAFLLESAGFQVKCFASAEEFLAAAPLDRPGCL-LLDVRMPGMSGLELQDRLAERGI--RLPVIFLT 83
                          90       100       110
                  ....*....|....*....|....*....|.
gi 189910473  775 AKNQIADIIAALEAGGNDYLAKPFDKRELIS 805
Cdd:COG4566    84 GHGDIPMAVQAMKAGAVDFLEKPFSEQDLLD 114
envZ PRK09467
osmolarity sensor protein; Provisional
550-653 2.17e-12

osmolarity sensor protein; Provisional


Pssm-ID: 236531 [Multi-domain]  Cd Length: 435  Bit Score: 69.17  E-value: 2.17e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  550 ILFNIIGNAIKFTeKGRIDVSAEIIEKMAVISIRDTGIGIPKDKFGDIFRSFEQVDasTTRKFGGTGLGLAISKRLVELH 629
Cdd:PRK09467  335 ALANLVVNAARYG-NGWIKVSSGTEGKRAWFQVEDDGPGIPPEQLKHLFQPFTRGD--SARGSSGTGLGLAIVKRIVDQH 411
                          90       100
                  ....*....|....*....|....
gi 189910473  630 GGNIWVESTPAEGSMFSFSLPLAR 653
Cdd:PRK09467  412 NGKVELGNSEEGGLSARAWLPLTT 435
spore_0_A TIGR02875
sporulation transcription factor Spo0A; Spo0A, the stage 0 sporulation protein A, is a ...
692-810 2.37e-12

sporulation transcription factor Spo0A; Spo0A, the stage 0 sporulation protein A, is a transcription factor critical for the initiation of sporulation. It contains a response regulator receiver domain (pfam00072). In Bacillus subtilis, it works together with response regulator Spo0F and the phosphotransferase Spo0B, both of which are missing from at least some sporulating species and thus not part of the endospore forming bacteria minimal gene set. Spo0A, however, is universal among endospore-forming species [Cellular processes, Sporulation and germination].


Pssm-ID: 131922 [Multi-domain]  Cd Length: 262  Bit Score: 67.13  E-value: 2.37e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   692 KLRVIVVDDepiNRQ---VLKNHLT------LIGCevreAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCTVLRES 762
Cdd:TIGR02875    2 KIRIVIADD---NKEfcnLLKEYLAaqpdmeVVGV----AHNGVDALELIKEQQP-DVVVLDIIMPHLDGIGVLEKLNEI 73
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 189910473   763 YSLYQLPILFLTAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNL 810
Cdd:TIGR02875   74 ELSARPRVIMLSAFGQEKITQRAVALGADYYVLKPFDLEILAARIRQL 121
PRK00742 PRK00742
chemotaxis-specific methylesterase; Provisional
692-810 6.67e-12

chemotaxis-specific methylesterase; Provisional


Pssm-ID: 234828 [Multi-domain]  Cd Length: 354  Bit Score: 67.10  E-value: 6.67e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  692 KLRVIVVDDEPINRQVLKNHLT------LIGcevrEAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVctvLRESYSL 765
Cdd:PRK00742    3 KIRVLVVDDSAFMRRLISEILNsdpdieVVG----TAPDGLEAREKIKKLNP-DVITLDVEMPVMDGLDA---LEKIMRL 74
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 189910473  766 YQLPILF---LTAKNqiADI-IAALEAGGNDYLAKPFD---------KRELISRAKNL 810
Cdd:PRK00742   75 RPTPVVMvssLTERG--AEItLRALELGAVDFVTKPFLgislgmdeyKEELAEKVRAA 130
PRK10529 PRK10529
DNA-binding transcriptional activator KdpE; Provisional
695-808 1.81e-11

DNA-binding transcriptional activator KdpE; Provisional


Pssm-ID: 182522 [Multi-domain]  Cd Length: 225  Bit Score: 64.06  E-value: 1.81e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  695 VIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCTVLRESYSLyqlPILFLT 774
Cdd:PRK10529    4 VLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKP-DLIILDLGLPDGDGIEFIRDLRQWSAI---PVIVLS 79
                          90       100       110
                  ....*....|....*....|....*....|....
gi 189910473  775 AKNQIADIIAALEAGGNDYLAKPFDKRELISRAK 808
Cdd:PRK10529   80 ARSEESDKIAALDAGADDYLSKPFGIGELQARLR 113
PRK10403 PRK10403
transcriptional regulator NarP; Provisional
694-849 1.86e-11

transcriptional regulator NarP; Provisional


Pssm-ID: 182431 [Multi-domain]  Cd Length: 215  Bit Score: 63.72  E-value: 1.86e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNHLTL--IGCEVREAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCTVLRESYSLYQlpIL 771
Cdd:PRK10403    8 QVLIVDDHPLMRRGVRQLLELdpGFEVVAEAGDGASAIDLANRLDP-DVILLDLNMKGMSGLDTLNALRRDGVTAQ--II 84
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 189910473  772 FLTAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLITLKKAVEEQNKFIAIQNELGLARKLQYSILPEEAPNVV 849
Cdd:PRK10403   85 ILTVSDASSDVFALIDAGADGYLLKDSDPEVLLEAIRAGAKGSKVFSERVNQYLREREMFGAEEDPFSVLTERELDVL 162
CheB COG2201
Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase ...
692-799 4.90e-11

Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 225111 [Multi-domain]  Cd Length: 350  Bit Score: 64.24  E-value: 4.90e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  692 KLRVIVVDDEPINRQVLKNHLTLIGC--EVREAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDvctVLRESYSLYQLP 769
Cdd:COG2201     1 KIRVLVVDDSALMRKVISDILNSDPDieVVGTARNGREAIDKVKKLKP-DVITLDVEMPVMDGLE---ALRKIMRLRPLP 76
                          90       100       110
                  ....*....|....*....|....*....|...
gi 189910473  770 ILF---LTAKNQIAdIIAALEAGGNDYLAKPFD 799
Cdd:COG2201    77 VIMvssLTEEGAEA-TLEALELGAVDFIAKPSG 108
PRK10816 PRK10816
DNA-binding transcriptional regulator PhoP; Provisional
693-811 4.91e-11

DNA-binding transcriptional regulator PhoP; Provisional


Pssm-ID: 182755 [Multi-domain]  Cd Length: 223  Bit Score: 62.45  E-value: 4.91e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  693 LRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCTVLRESYSlyQLPILF 772
Cdd:PRK10816    1 MRVLVVEDNALLRHHLKVQLQDAGHQVDAAEDAKEADYYLNEHLP-DIAIVDLGLPDEDGLSLIRRWRSNDV--SLPILV 77
                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 189910473  773 LTAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLI 811
Cdd:PRK10816   78 LTARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALM 116
PRK10336 PRK10336
DNA-binding transcriptional regulator QseB; Provisional
693-811 9.99e-11

DNA-binding transcriptional regulator QseB; Provisional


Pssm-ID: 182387 [Multi-domain]  Cd Length: 219  Bit Score: 61.45  E-value: 9.99e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  693 LRVIVVDDEPINRQVLKNHLTLIGCEV---REAANGVDAIRlvrdEGPFELMVLDIMMPGMSGYDVCTVLRESYSlyQLP 769
Cdd:PRK10336    1 MRILLIEDDMLIGDGIKTGLSKMGFSVdwfTQGRQGKEALY----SAPYDAVILDLTLPGMDGRDILREWREKGQ--REP 74
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 189910473  770 ILFLTAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLI 811
Cdd:PRK10336   75 VLILTARDALAERVEGLRLGADDYLCKPFALIEVAARLEALM 116
AmiR COG3707
Response regulator with putative antiterminator output domain [Signal transduction mechanisms]
693-820 1.03e-10

Response regulator with putative antiterminator output domain [Signal transduction mechanisms]


Pssm-ID: 226230 [Multi-domain]  Cd Length: 194  Bit Score: 61.19  E-value: 1.03e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  693 LRVIVVDDEPINRQVLKNHLTLIGCE-VREAANGVDAIRLVRDEGPfELMVLDIMMPGMsgyDVCTVLRESYSLYQLPIL 771
Cdd:COG3707     6 LRVLVADDEALTRMDIREGLLEAGYQrVGEAADGLEAVEVCERLQP-DVVILDIEMPRR---DIIEALLLASENVARPIV 81
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 189910473  772 FLTAKNQIADIIAALEAGGNDYLAKPFDKRELISR--------------AKNLITLKKAVEEQ 820
Cdd:COG3707    82 ALTAYSDPALIEAAIEAGVMAYIVKPLDESRLLPIldvavsrfeerralRRELAKLKDRLEER 144
COG4192 COG4192
Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal ...
400-644 1.06e-10

Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms]


Pssm-ID: 226655 [Multi-domain]  Cd Length: 673  Bit Score: 64.17  E-value: 1.06e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  400 QSLTLSRRFSRAFSEVETLSKRLLALDKLKDEF------------LANTSHELKTPLNgiigiAESMFDGIGGKL----N 463
Cdd:COG4192   410 KTQSLRERNQELQAEVEERQEAEAHLKKTQGELiqaaklavvgqtMTSLAHEINQPLN-----AMSAYLFSARLAleeaP 484
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  464 QEQ-RQNLGMIVSSGKRLSSLVDDILDFSKmkNRDLDLDLKAIDLHQICD--FVLVISRplyvTKNLTVRNNVPIDFPPI 540
Cdd:COG4192   485 SAQaATSLDKIENLTERMGKIVNSLRQFAR--KNSSDESLQPVRLNSVVEqaWELLQTK----HKRRQIKLINPTDDLMV 558
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  541 LGDEARLQQILFNIIGNAIKFTE--KGRIDVSAEIIE-KMAVISIRDTGIGIPKDKFGDIFRSFeqvdasTTRKFGGTGL 617
Cdd:COG4192   559 MGDAVSIEQVLVNLIVNALDASThfAPWIKLIALGTEqEMLRIAIIDNGQGWPHELVDKLLTPF------TTSKEVGLGL 632
                         250       260
                  ....*....|....*....|....*..
gi 189910473  618 GLAISKRLVELHGGNIWVESTPAEGSM 644
Cdd:COG4192   633 GLSISQSLMEQMQGRLALASTLTKNAM 659
glnG PRK10923
nitrogen regulation protein NR(I); Provisional
695-938 1.49e-10

nitrogen regulation protein NR(I); Provisional


Pssm-ID: 182842 [Multi-domain]  Cd Length: 469  Bit Score: 63.35  E-value: 1.49e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  695 VIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCTVLRESYSLyqLPILFLT 774
Cdd:PRK10923    6 VWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLEALASKTP-DVLLSDIRMPGMDGLALLKQIKQRHPM--LPVIIMT 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  775 AKNQIADIIAALEAGGNDYLAKPFDKRE---LISRAKNLITLKKAVEEQNKFIAIQNELGLARKLQysilpeEAPNVVGi 851
Cdd:PRK10923   83 AHSDLDAAVSAYQQGAFDYLPKPFDIDEavaLVERAISHYQEQQQPRNIQVNGPTTDIIGEAPAMQ------DVFRIIG- 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  852 ktefyyepmdsiggdffdfhAISETELGVLIADVSGHGipAALVSAmlkiAFSTQVRLAKEPSQLLNQ-------INSTL 924
Cdd:PRK10923  156 --------------------RLSRSSISVLINGESGTG--KELVAH----ALHRHSPRAKAPFIALNMaaipkdlIESEL 209
                         250
                  ....*....|....
gi 189910473  925 LGKMKGAFVTASYV 938
Cdd:PRK10923  210 FGHEKGAFTGANTI 223
PRK10755 PRK10755
sensor protein BasS/PmrB; Provisional
432-631 1.77e-10

sensor protein BasS/PmrB; Provisional


Pssm-ID: 236751 [Multi-domain]  Cd Length: 356  Bit Score: 62.68  E-value: 1.77e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  432 FLANTSHELKTPLNGI---------IGIAESMfdGIGGKLNQEQR--QNLGMIVSSGKRLSS-------LVDDILDFSKM 493
Cdd:PRK10755  140 FTADVAHELRTPLAGIrlhlellekQHHIDVA--PLIARLDQMMHtvEQLLQLARAGQSFSSghyqtvkLLEDVILPSQD 217
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  494 KNRDLdLDLKaidlHQICDFVLVisrplyvTKNLTVRnnvpidfppilGDEARLQQILFNIIGNAIKFTEKG-RIDVSAE 572
Cdd:PRK10755  218 ELSEM-LEQR----QQTLLLPES-------AADITVQ-----------GDATLLRLLLRNLVENAHRYSPEGsTITIKLS 274
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 189910473  573 IIEKMAVISIRDTGIGIPKDKFGDIFRSFEQVDasttRKFGGTGLGLAISKRLVELHGG 631
Cdd:PRK10755  275 QEDGGAVLAVEDEGPGIDESKCGELSKAFVRMD----SRYGGIGLGLSIVSRITQLHHG 329
CitA COG3290
Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction ...
550-650 1.81e-10

Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms]


Pssm-ID: 225827 [Multi-domain]  Cd Length: 537  Bit Score: 63.46  E-value: 1.81e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  550 ILFNIIGNAIKFT----EKGRIDVSAEIIEKMAVISIRDTGIGIPKDKFGDIFrsfEQVDasTTRKFGGTGLGLAISKRL 625
Cdd:COG3290   431 ILGNLIDNALEALlapeENKEIELSLSDRGDELVIEVADTGPGIPPEVRDKIF---EKGV--STKNTGGRGIGLYLVKQL 505
                          90       100
                  ....*....|....*....|....*
gi 189910473  626 VELHGGNIWVESTPAEGSMFSFSLP 650
Cdd:COG3290   506 VERLGGSIEVESEKGQGTRFSIYIP 530
nifL_nitrog TIGR02938
nitrogen fixation negative regulator NifL; NifL is a modulator of the nitrogen fixation ...
425-642 2.18e-10

nitrogen fixation negative regulator NifL; NifL is a modulator of the nitrogen fixation positive regulator protein NifA, and is therefore a negative regulator. It binds NifA. NifA and NifL are encoded by adjacent genes [Central intermediary metabolism, Nitrogen fixation, Regulatory functions, Protein interactions].


Pssm-ID: 131984 [Multi-domain]  Cd Length: 494  Bit Score: 63.00  E-value: 2.18e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   425 LDKLKDEFLANTsHELKTPLNgIIGIAESMFDGIGGKLNQEQRQNLGMIVSSGKRLSslvddILDFSKMKNRDLDLDLKA 504
Cdd:TIGR02938  273 LEAIRETLSAAI-HRLQGPMN-LISAAISVLQRRGDDAGNPASAAMLQQALSAGREH-----MEALRQVIPQSPQEIVVP 345
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473   505 IDLHQICDFVLVISRPLYVTKNLTVRNNVPIDFPPILGDEARLQQILFNIIGNAI-----KFTEKGRIDVSAEIIEKMAV 579
Cdd:TIGR02938  346 VNLNQILRDVITLSTPRLLAAGIVVDWQPAATLPAILGRELQLRSLFKALVDNAIeamniKGWKRRELSITTALNGDLIV 425
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 189910473   580 ISIRDTGIGIPKDKFGDIFRSFEQVDASTTRkfgGTGLGLAISKRLVELHGGNIWVESTPAEG 642
Cdd:TIGR02938  426 VSILDSGPGIPQDLRYKVFEPFFTTKGGSRK---HIGMGLSVAQEIVADHGGIIDLDDDYSEG 485
PLN03029 PLN03029
type-a response regulator protein; Provisional
692-822 2.46e-10

type-a response regulator protein; Provisional


Pssm-ID: 215544 [Multi-domain]  Cd Length: 222  Bit Score: 60.43  E-value: 2.46e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  692 KLRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLV-------------------RDEGPFELMVLDIMMPGMSG 752
Cdd:PLN03029    8 QFHVLAVDDSLIDRKLIEKLLKTSSYQVTTVDSGSKALKFLglheddrsnpdtpsvspnsHQEVEVNLIITDYCMPGMTG 87
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  753 YDVCTVLRESYSLYQLPILFLTAKNQIADIIAALEAGGNDYLAKPFDKRELISRAKNLITLKKAVEEQNK 822
Cdd:PLN03029   88 YDLLKKIKESSSLRNIPVVIMSSENVPSRITRCLEEGAEEFFLKPVQLSDLNRLKPHMMKTKSKNQKQEN 157
PRK10618 PRK10618
phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional
432-664 6.66e-10

phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional


Pssm-ID: 236726 [Multi-domain]  Cd Length: 894  Bit Score: 61.87  E-value: 6.66e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  432 FLANTSHELKTPLNGIIGIAESMFDGIGGKLNQEQRQNLgmiVSSGKRLSSLVDDILDFSKMKNRDLDLDLKAIDLHQIC 511
Cdd:PRK10618  453 FLQNIGDELKQPLQSLAQLAAQLRQTSDEEQQQPELDQL---AEQSDVLVRLVDNIQLLNMLETQDWKPEQELFSLQDLI 529
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  512 DFVLVISRPLYVTKNLTVRNNVPIDFPPI-LGDEARLQQILFNIIGNAIKFTEKGRIDVSAEIIEKMA---VISIRDTGI 587
Cdd:PRK10618  530 DEVLPEVLPAIKRKGLQLLIHNHLKAEQLrIGDRDALRKILLLLLNYAITTTAYGKITLEVDQDESSPdrlTIRILDTGA 609
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  588 GIPKDKFGDI---FRSFEQVDasttrKFG-GTGLGLAISKRLVELHGGNIWVESTPAEGSMFSFSLPL-AREGEIPMEKP 662
Cdd:PRK10618  610 GVSIKELDNLhfpFLNQTQGD-----RYGkASGLTFFLCNQLCRKLGGHLTIKSREGLGTRYSIHLKMlAADPEVEEEEE 684

                  ..
gi 189910473  663 QL 664
Cdd:PRK10618  685 KL 686
CitB COG4565
Response regulator of citrate/malate metabolism [Transcription / Signal transduction ...
693-798 1.22e-09

Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms]


Pssm-ID: 226931 [Multi-domain]  Cd Length: 224  Bit Score: 58.42  E-value: 1.22e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  693 LRVIVVDDEP----INRQVLKNH--LTLIGCevreAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCTVLRESYslY 766
Cdd:COG4565     1 INVLIIEDDPmvaeIHRRYVKQIpgFSVVGT----AGTLEEAKMIIEEFKP-DLILLDIYMPDGNGIELLPELRSQH--Y 73
                          90       100       110
                  ....*....|....*....|....*....|..
gi 189910473  767 QLPILFLTAKNQIADIIAALEAGGNDYLAKPF 798
Cdd:COG4565    74 PVDVIVITAASDMETIKEALRYGVVDYLIKPF 105
COG3947 COG3947
Response regulator containing CheY-like receiver and SARP domains [Signal transduction ...
693-824 3.42e-09

Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms]


Pssm-ID: 226456 [Multi-domain]  Cd Length: 361  Bit Score: 58.72  E-value: 3.42e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  693 LRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEGPfELMVLDIMMPGMSGYDVCTVLRESYSlyQLPILF 772
Cdd:COG3947     1 PRIIIVDDDAAIVKLLSVILSRAGHEVRSCSHPVEALDLLEVFKP-DLIFLDIVMPYMNGIEFAEQVRDIES--AVPIIF 77
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 189910473  773 LTAKNQIADIiaALEAGGNDYLAKPFDKREL---ISRAKNLITlKKAVEEQNKFI 824
Cdd:COG3947    78 ISSHAEYADD--SFGMNLDDYLPKPVTPEKLnraIDRRLKRVE-LTAEEESGTQI 129
PRK10365 PRK10365
transcriptional regulatory protein ZraR; Provisional
692-799 6.29e-09

transcriptional regulatory protein ZraR; Provisional


Pssm-ID: 182412 [Multi-domain]  Cd Length: 441  Bit Score: 58.12  E-value: 6.29e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  692 KLRVIVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRdEGPFELMVLDIMMPGMSGydvCTVLRESYSLY-QLPI 770
Cdd:PRK10365    5 NIDILVVDDDISHCTILQALLRGWGYNVALANSGRQALEQVR-EQVFDLVLCDVRMAEMDG---IATLKEIKALNpAIPV 80
                          90       100
                  ....*....|....*....|....*....
gi 189910473  771 LFLTAKNQIADIIAALEAGGNDYLAKPFD 799
Cdd:PRK10365   81 LIMTAYSSVETAVEALKTGALDYLIKPLD 109
LytT COG3279
Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms]
693-799 6.81e-09

Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms]


Pssm-ID: 225818 [Multi-domain]  Cd Length: 244  Bit Score: 56.22  E-value: 6.81e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  693 LRVIVVDDEPINRQVLKNHLTLI-GCEVR-EAANGVDAIRLVRDeGPFELMVLDIMMPGMSGYDVCTVLRESYSlyQLPI 770
Cdd:COG3279     2 LKVLIVDDEPLAREELRRILNEIpDIEIVgEAENGEEALQLLQG-LRPDLVFLDIAMPDINGIELAARIRKGDP--RPAI 78
                          90       100
                  ....*....|....*....|....*....
gi 189910473  771 LFLTAKNQIADIIAALEAGgnDYLAKPFD 799
Cdd:COG3279    79 VFVTAHDEYAVAAFEVEAL--DYLLKPIS 105
PRK11086 PRK11086
sensory histidine kinase DcuS; Provisional
550-657 1.21e-08

sensory histidine kinase DcuS; Provisional


Pssm-ID: 236839 [Multi-domain]  Cd Length: 542  Bit Score: 57.62  E-value: 1.21e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  550 ILFNIIGN---AIKFTEKGRIDVSAEIIEKMAVISIRDTGIGIPKDKFGDIF-RSFeqvdaSTtrKFGGTGLGLAISKRL 625
Cdd:PRK11086  437 ILGNLIENaleAVGGEEGGEISVSLHYRNGWLHCEVSDDGPGIAPDEIDAIFdKGY-----ST--KGSNRGVGLYLVKQS 509
                          90       100       110
                  ....*....|....*....|....*....|..
gi 189910473  626 VELHGGNIWVESTPAEGSMFSFSLPLAREGEI 657
Cdd:PRK11086  510 VENLGGSIAVESEPGVGTQFFVQIPWDGERSN 541
pleD PRK09581
response regulator PleD; Reviewed
694-808 1.31e-08

response regulator PleD; Reviewed


Pssm-ID: 236577 [Multi-domain]  Cd Length: 457  Bit Score: 57.22  E-value: 1.31e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  694 RVIVVDDEPINRQVLKNHLTligCEVREAANGVDAIRLVR-DEGPFELMVLDImmpGMSGYD---VCTVLRESYSLYQLP 769
Cdd:PRK09581  157 RILLVDDDVSQAERIANILK---EEFRVVVVSDPSEALFNaAETNYDLVIVSA---NFENYDplrLCSQLRSKERTRYVP 230
                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 189910473  770 ILFLTAKNQIADIIAALEAGGNDYLAKPFDKRELISRAK 808
Cdd:PRK09581  231 ILLLVDEDDDPRLVKALELGVNDYLMRPIDKNELLARVR 269
fixJ PRK09390
response regulator FixJ; Provisional
695-804 1.43e-08

response regulator FixJ; Provisional


Pssm-ID: 181815 [Multi-domain]  Cd Length: 202  Bit Score: 54.62  E-value: 1.43e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  695 VIVVDDEPINRQVLKNHLTLIGCEVR---EAANGVDAIRLVRdegpFELMVLDIMMPGMSGYDVCTVLRESYSLyqLPIL 771
Cdd:PRK09390    6 VHVVDDDEAMRDSLAFLLDSAGFEVRlfeSAQAFLDALPGLR----FGCVVTDVRMPGIDGIELLRRLKARGSP--LPVI 79
                          90       100       110
                  ....*....|....*....|....*....|...
gi 189910473  772 FLTAKNQIADIIAALEAGGNDYLAKPFDKRELI 804
Cdd:PRK09390   80 VMTGHGDVPLAVEAMKLGAVDFIEKPFEDERLI 112
COG4567 COG4567
Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal ...
696-799 1.54e-08

Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription]


Pssm-ID: 226933 [Multi-domain]  Cd Length: 182  Bit Score: 54.35  E-value: 1.54e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  696 IVVDDEPINRQVLKNHLTLIGCEVREAANGVDAIRLVRDEgPFELMVLDIMMPGMSGYDVCTVLRESYSlyQLPILFLTA 775
Cdd:COG4567    13 LLVDDDTPFLRTLARAMERRGFAVVTAESVEEALAAARTA-PPAYAVVDLKLGDGSGLAVIEALRERRA--DMRIVVLTG 89
                          90       100
                  ....*....|....*....|....
gi 189910473  776 KNQIADIIAALEAGGNDYLAKPFD 799
Cdd:COG4567    90 YASIATAVEAVKLGACDYLAKPAD 113
PleD COG3706
Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal ...
718-819 2.30e-08

Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms]


Pssm-ID: 226229 [Multi-domain]  Cd Length: 435  Bit Score: 56.18  E-value: 2.30e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910473  718 EVREAANGVDAIRlVRDEGPFELMVLDIMMPGMSGYDVCTVLRESyslyQLPILFLTAKNQIADIIAALEAGGNDYLAKP 797
Cdd:COG3706    14 EVATAKKGLIALA-ILLDHKPDYKLLDVMMPGM