NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|18859379|ref|NP_571704|]
View 

solute carrier family 40 member 1 [Danio rerio]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
FPN1 pfam06963
Ferroportin1 (FPN1); This family represents a conserved region approximately 100 residues long ...
19-522 0e+00

Ferroportin1 (FPN1); This family represents a conserved region approximately 100 residues long within eukaryotic Ferroportin1 (FPN1), a protein that may play a role in iron export from the cell. This family may represent a number of transmembrane regions in Ferroportin1.


:

Pssm-ID: 253992  Cd Length: 432  Bit Score: 548.44  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859379    19 KSAKFLIYVGHALSTWGDRMWNFAVAVFLVELYGNSLLLTAVYGLVVAGSVLLLGAIIGDWVDKNPRLKVAQTSLVVQNS 98
Cdd:pfam06963   1 SSALIRLYVSHFLSTWGDRMWEFAVPLFLAELFPGSLLLAAVYGLVESLSALVLGPIVGQLVDRLPRLKAIRLSLLLQNL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859379    99 AVILCGALLMAVFQFKQQLSSmyDGWLLTTCYIMVISIANIANLASTAMSITIQRDWVVVVAGDDRSKLADMNATVRIID 178
Cdd:pfam06963  81 SVAVSGALFIALFVVLSLSSQ--ASPLLIPLFAVTVLLAAVAKLASTANTVAIERDWVVVISGGLPVVLAKMNATLRRID 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859379   179 QLTNILAPMLVGQIMAFGSHFIGCGFISGWNLFSMCLEYFLLWKVYQKTPALAFKAGQKDSDDQELKHlniqkeigntes 258
Cdd:pfam06963 159 LFCKLLAPLLVGLLLSFVSLRAAAGFLLVWNLVSVVVEYFLLASVYKSVPALSRKAEVRTSRDEEAGS------------ 226
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859379   259 pveasqlmtESSEPKKDTGCCYQMAEPIRTFKDGWVAYYNQSIFFAGMSLAFLYMTVLGFDCITTGYAYTQGLNGSVLSL 338
Cdd:pfam06963 227 ---------ELQEPANRPSIVKRVKEYVKTQRDGWREYVRQPVFLASFALSLLYFTVLSFGTLMTTYLLHQGLSPSVIGG 297
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859379   339 LMGASAVSGICGTVAFTWIRKKCGLIRTGFIAGVTQLSCLTLCVASVFAPGSPFdlsvspfkevlrhlfgdsgslrespt 418
Cdd:pfam06963 298 MRGGSAVTGLAGTFAYPFLEKRIGLLRTGLWSLWWQLSCLALAVASVFLPGSPM-------------------------- 351
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859379   419 fiptteppiqanvtvfeeappveSYMSVGLLFAGVIAARVGLWSFDLTVTQLIQENVIESERGVINGVQNSMNYLLDLLH 498
Cdd:pfam06963 352 -----------------------SALSAFLLFGGVALSRIGLWSFDLAVTQLMQEGVPESERNVVGGVQNSLQSLFDLLK 408
                         490       500
                  ....*....|....*....|....
gi 18859379   499 FIMVILAPNPEAFGLLVIISVSFV 522
Cdd:pfam06963 409 FALTIIAPDPEQFGYLVLISYGAV 432
 
Name Accession Description Interval E-value
FPN1 pfam06963
Ferroportin1 (FPN1); This family represents a conserved region approximately 100 residues long ...
19-522 0e+00

Ferroportin1 (FPN1); This family represents a conserved region approximately 100 residues long within eukaryotic Ferroportin1 (FPN1), a protein that may play a role in iron export from the cell. This family may represent a number of transmembrane regions in Ferroportin1.


Pssm-ID: 253992  Cd Length: 432  Bit Score: 548.44  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859379    19 KSAKFLIYVGHALSTWGDRMWNFAVAVFLVELYGNSLLLTAVYGLVVAGSVLLLGAIIGDWVDKNPRLKVAQTSLVVQNS 98
Cdd:pfam06963   1 SSALIRLYVSHFLSTWGDRMWEFAVPLFLAELFPGSLLLAAVYGLVESLSALVLGPIVGQLVDRLPRLKAIRLSLLLQNL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859379    99 AVILCGALLMAVFQFKQQLSSmyDGWLLTTCYIMVISIANIANLASTAMSITIQRDWVVVVAGDDRSKLADMNATVRIID 178
Cdd:pfam06963  81 SVAVSGALFIALFVVLSLSSQ--ASPLLIPLFAVTVLLAAVAKLASTANTVAIERDWVVVISGGLPVVLAKMNATLRRID 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859379   179 QLTNILAPMLVGQIMAFGSHFIGCGFISGWNLFSMCLEYFLLWKVYQKTPALAFKAGQKDSDDQELKHlniqkeigntes 258
Cdd:pfam06963 159 LFCKLLAPLLVGLLLSFVSLRAAAGFLLVWNLVSVVVEYFLLASVYKSVPALSRKAEVRTSRDEEAGS------------ 226
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859379   259 pveasqlmtESSEPKKDTGCCYQMAEPIRTFKDGWVAYYNQSIFFAGMSLAFLYMTVLGFDCITTGYAYTQGLNGSVLSL 338
Cdd:pfam06963 227 ---------ELQEPANRPSIVKRVKEYVKTQRDGWREYVRQPVFLASFALSLLYFTVLSFGTLMTTYLLHQGLSPSVIGG 297
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859379   339 LMGASAVSGICGTVAFTWIRKKCGLIRTGFIAGVTQLSCLTLCVASVFAPGSPFdlsvspfkevlrhlfgdsgslrespt 418
Cdd:pfam06963 298 MRGGSAVTGLAGTFAYPFLEKRIGLLRTGLWSLWWQLSCLALAVASVFLPGSPM-------------------------- 351
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859379   419 fiptteppiqanvtvfeeappveSYMSVGLLFAGVIAARVGLWSFDLTVTQLIQENVIESERGVINGVQNSMNYLLDLLH 498
Cdd:pfam06963 352 -----------------------SALSAFLLFGGVALSRIGLWSFDLAVTQLMQEGVPESERNVVGGVQNSLQSLFDLLK 408
                         490       500
                  ....*....|....*....|....
gi 18859379   499 FIMVILAPNPEAFGLLVIISVSFV 522
Cdd:pfam06963 409 FALTIIAPDPEQFGYLVLISYGAV 432
 
Name Accession Description Interval E-value
FPN1 pfam06963
Ferroportin1 (FPN1); This family represents a conserved region approximately 100 residues long ...
19-522 0e+00

Ferroportin1 (FPN1); This family represents a conserved region approximately 100 residues long within eukaryotic Ferroportin1 (FPN1), a protein that may play a role in iron export from the cell. This family may represent a number of transmembrane regions in Ferroportin1.


Pssm-ID: 253992  Cd Length: 432  Bit Score: 548.44  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859379    19 KSAKFLIYVGHALSTWGDRMWNFAVAVFLVELYGNSLLLTAVYGLVVAGSVLLLGAIIGDWVDKNPRLKVAQTSLVVQNS 98
Cdd:pfam06963   1 SSALIRLYVSHFLSTWGDRMWEFAVPLFLAELFPGSLLLAAVYGLVESLSALVLGPIVGQLVDRLPRLKAIRLSLLLQNL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859379    99 AVILCGALLMAVFQFKQQLSSmyDGWLLTTCYIMVISIANIANLASTAMSITIQRDWVVVVAGDDRSKLADMNATVRIID 178
Cdd:pfam06963  81 SVAVSGALFIALFVVLSLSSQ--ASPLLIPLFAVTVLLAAVAKLASTANTVAIERDWVVVISGGLPVVLAKMNATLRRID 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859379   179 QLTNILAPMLVGQIMAFGSHFIGCGFISGWNLFSMCLEYFLLWKVYQKTPALAFKAGQKDSDDQELKHlniqkeigntes 258
Cdd:pfam06963 159 LFCKLLAPLLVGLLLSFVSLRAAAGFLLVWNLVSVVVEYFLLASVYKSVPALSRKAEVRTSRDEEAGS------------ 226
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859379   259 pveasqlmtESSEPKKDTGCCYQMAEPIRTFKDGWVAYYNQSIFFAGMSLAFLYMTVLGFDCITTGYAYTQGLNGSVLSL 338
Cdd:pfam06963 227 ---------ELQEPANRPSIVKRVKEYVKTQRDGWREYVRQPVFLASFALSLLYFTVLSFGTLMTTYLLHQGLSPSVIGG 297
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859379   339 LMGASAVSGICGTVAFTWIRKKCGLIRTGFIAGVTQLSCLTLCVASVFAPGSPFdlsvspfkevlrhlfgdsgslrespt 418
Cdd:pfam06963 298 MRGGSAVTGLAGTFAYPFLEKRIGLLRTGLWSLWWQLSCLALAVASVFLPGSPM-------------------------- 351
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18859379   419 fiptteppiqanvtvfeeappveSYMSVGLLFAGVIAARVGLWSFDLTVTQLIQENVIESERGVINGVQNSMNYLLDLLH 498
Cdd:pfam06963 352 -----------------------SALSAFLLFGGVALSRIGLWSFDLAVTQLMQEGVPESERNVVGGVQNSLQSLFDLLK 408
                         490       500
                  ....*....|....*....|....
gi 18859379   499 FIMVILAPNPEAFGLLVIISVSFV 522
Cdd:pfam06963 409 FALTIIAPDPEQFGYLVLISYGAV 432
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH