NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|18859249|ref|NP_571187|]
View 

POU domain, class 5, transcription factor 1 [Danio rerio]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
POU smart00352
Found in Pit-Oct-Unc transcription factors;
259-323 1.32e-40

Found in Pit-Oct-Unc transcription factors;


:

Pssm-ID: 197673  Cd Length: 75  Bit Score: 141.04  E-value: 1.32e-40
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 18859249    259 QFAKELKHKRITLGFTQADVGLALGNLYGKMFSQTTICRFEALQLSFKNMCKLKPLLQRWLNEAE 323
Cdd:smart00352  11 AFAKQFKQRRIKLGFTQADVGLALGALYGPAFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEAE 75
Homeobox pfam00046
Homeobox domain;
346-399 1.13e-16

Homeobox domain;


:

Pssm-ID: 278475  Cd Length: 54  Bit Score: 74.46  E-value: 1.13e-16
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 18859249   346 RRTSLEGTVRSALESYFVKCPKPNTLEITHISDDLGLERDVVRVWFCNRRQKGK 399
Cdd:pfam00046   1 KRTTFTPEQLEELEKEFQKNPYPSREEREELAAKLGLTERQVKVWFQNRRAKWK 54
 
Name Accession Description Interval E-value
POU smart00352
Found in Pit-Oct-Unc transcription factors;
259-323 1.32e-40

Found in Pit-Oct-Unc transcription factors;


Pssm-ID: 197673  Cd Length: 75  Bit Score: 141.04  E-value: 1.32e-40
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 18859249    259 QFAKELKHKRITLGFTQADVGLALGNLYGKMFSQTTICRFEALQLSFKNMCKLKPLLQRWLNEAE 323
Cdd:smart00352  11 AFAKQFKQRRIKLGFTQADVGLALGALYGPAFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEAE 75
Pou pfam00157
Pou domain - N-terminal to homeobox domain;
259-323 4.56e-40

Pou domain - N-terminal to homeobox domain;


Pssm-ID: 278582  Cd Length: 69  Bit Score: 139.23  E-value: 4.56e-40
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 18859249   259 QFAKELKHKRITLGFTQADVGLALGNLYGKMFSQTTICRFEALQLSFKNMCKLKPLLQRWLNEAE 323
Cdd:pfam00157   5 EFAEEFKQRRIKLGLTQADVGRALGALYGNVFSQSTICRFEALDLSLKNMCKLKPLLEKWLEEAE 69
Homeobox pfam00046
Homeobox domain;
346-399 1.13e-16

Homeobox domain;


Pssm-ID: 278475  Cd Length: 54  Bit Score: 74.46  E-value: 1.13e-16
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 18859249   346 RRTSLEGTVRSALESYFVKCPKPNTLEITHISDDLGLERDVVRVWFCNRRQKGK 399
Cdd:pfam00046   1 KRTTFTPEQLEELEKEFQKNPYPSREEREELAAKLGLTERQVKVWFQNRRAKWK 54
HOX smart00389
Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key ...
343-399 6.83e-15

Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key developmental processes


Pssm-ID: 197696  Cd Length: 57  Bit Score: 69.20  E-value: 6.83e-15
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 18859249    343 KRKRRTSLEGTVRSALESYFVKCPKPNTLEITHISDDLGLERDVVRVWFCNRRQKGK 399
Cdd:smart00389   1 KRRKRTSFTPEQLEELEKEFQKNPYPSREEREELAKKLGLSERQVKVWFQNRRAKWK 57
homeodomain cd00086
Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic ...
344-400 6.56e-14

Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner.


Pssm-ID: 238039  Cd Length: 59  Bit Score: 66.50  E-value: 6.56e-14
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 18859249 344 RKRRTSLEGTVRSALESYFVKCPKPNTLEITHISDDLGLERDVVRVWFCNRRQKGKR 400
Cdd:cd00086   1 RRKRTRFTPEQLEELEKEFEKNPYPSREEREELAKELGLTERQVKIWFQNRRAKLKR 57
COG5576 COG5576
Homeodomain-containing transcription factor [Transcription];
340-402 2.64e-09

Homeodomain-containing transcription factor [Transcription];


Pssm-ID: 227863 [Multi-domain]  Cd Length: 156  Bit Score: 55.14  E-value: 2.64e-09
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 18859249 340 DTRKRKRRTSLEGTVrsaLESYFVKCPKPNTLEITHISDDLGLERDVVRVWFCNRRQKGKRLA 402
Cdd:COG5576  51 PKSKRRRTTDEQLMV---LEREFEINPYPSSITRIKLSLLLNMPPKSVQIWFQNKRAKEKKKR 110
 
Name Accession Description Interval E-value
POU smart00352
Found in Pit-Oct-Unc transcription factors;
259-323 1.32e-40

Found in Pit-Oct-Unc transcription factors;


Pssm-ID: 197673  Cd Length: 75  Bit Score: 141.04  E-value: 1.32e-40
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 18859249    259 QFAKELKHKRITLGFTQADVGLALGNLYGKMFSQTTICRFEALQLSFKNMCKLKPLLQRWLNEAE 323
Cdd:smart00352  11 AFAKQFKQRRIKLGFTQADVGLALGALYGPAFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEAE 75
Pou pfam00157
Pou domain - N-terminal to homeobox domain;
259-323 4.56e-40

Pou domain - N-terminal to homeobox domain;


Pssm-ID: 278582  Cd Length: 69  Bit Score: 139.23  E-value: 4.56e-40
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 18859249   259 QFAKELKHKRITLGFTQADVGLALGNLYGKMFSQTTICRFEALQLSFKNMCKLKPLLQRWLNEAE 323
Cdd:pfam00157   5 EFAEEFKQRRIKLGLTQADVGRALGALYGNVFSQSTICRFEALDLSLKNMCKLKPLLEKWLEEAE 69
Homeobox pfam00046
Homeobox domain;
346-399 1.13e-16

Homeobox domain;


Pssm-ID: 278475  Cd Length: 54  Bit Score: 74.46  E-value: 1.13e-16
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 18859249   346 RRTSLEGTVRSALESYFVKCPKPNTLEITHISDDLGLERDVVRVWFCNRRQKGK 399
Cdd:pfam00046   1 KRTTFTPEQLEELEKEFQKNPYPSREEREELAAKLGLTERQVKVWFQNRRAKWK 54
HOX smart00389
Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key ...
343-399 6.83e-15

Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key developmental processes


Pssm-ID: 197696  Cd Length: 57  Bit Score: 69.20  E-value: 6.83e-15
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 18859249    343 KRKRRTSLEGTVRSALESYFVKCPKPNTLEITHISDDLGLERDVVRVWFCNRRQKGK 399
Cdd:smart00389   1 KRRKRTSFTPEQLEELEKEFQKNPYPSREEREELAKKLGLSERQVKVWFQNRRAKWK 57
homeodomain cd00086
Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic ...
344-400 6.56e-14

Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner.


Pssm-ID: 238039  Cd Length: 59  Bit Score: 66.50  E-value: 6.56e-14
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 18859249 344 RKRRTSLEGTVRSALESYFVKCPKPNTLEITHISDDLGLERDVVRVWFCNRRQKGKR 400
Cdd:cd00086   1 RRKRTRFTPEQLEELEKEFEKNPYPSREEREELAKELGLTERQVKIWFQNRRAKLKR 57
COG5576 COG5576
Homeodomain-containing transcription factor [Transcription];
340-402 2.64e-09

Homeodomain-containing transcription factor [Transcription];


Pssm-ID: 227863 [Multi-domain]  Cd Length: 156  Bit Score: 55.14  E-value: 2.64e-09
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 18859249 340 DTRKRKRRTSLEGTVrsaLESYFVKCPKPNTLEITHISDDLGLERDVVRVWFCNRRQKGKRLA 402
Cdd:COG5576  51 PKSKRRRTTDEQLMV---LEREFEINPYPSSITRIKLSLLLNMPPKSVQIWFQNKRAKEKKKR 110
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH