NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|18858397|ref|NP_571895|]
View 

cadherin 1, type 1, E-cadherin (epithelial) precursor [Danio rerio]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
252-357 5.92e-25

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


:

Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 100.85  E-value: 5.92e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397 252 PFNGNVPEALEKGEVFMTVTATDADDkenTDNADISYVIISQDPPspkpNMFAINPVSGGISVLeKGLDREQWFRYTLVI 331
Cdd:cd11304   1 SYEVSVPENAPPGTVVLTVSATDPDS---GENGEVTYSIVSGNED----GLFSIDPSTGEITTA-KPLDREEQSSYTLTV 72
                        90       100
                ....*....|....*....|....*.
gi 18858397 332 TATDMNGEGLSTTGTAVITVTDSNDN 357
Cdd:cd11304  73 TATDGGGPPLSSTATVTITVLDVNDN 98
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
365-469 3.72e-21

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


:

Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 90.07  E-value: 3.72e-21
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397 365 SYTASVPENQ-VGVEVAKLPVTDGDEPEStaWSTKYQIIAGDKGGFFNIStgpsRLEGIITTVKPLDYEKTKQYILSVIV 443
Cdd:cd11304   1 SYEVSVPENApPGTVVLTVSATDPDSGEN--GEVTYSIVSGNEDGLFSID----PSTGEITTAKPLDREEQSSYTLTVTA 74
                        90       100
                ....*....|....*....|....*.
gi 18858397 444 VNDDkfvGPLPTSTATVTVNVKDVNE 469
Cdd:cd11304  75 TDGG---GPPLSSTATVTITVLDVND 97
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
483-577 1.12e-16

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


:

Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 76.97  E-value: 1.12e-16
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397 483 PENLPVGSNLIPFTAIDPDTEKKQNITYRI-GNDPSDWLNI-TGSGQIQVKNALDRESSNVkdgkYKALILALDNDVEsP 560
Cdd:cd11304   7 PENAPPGTVVLTVSATDPDSGENGEVTYSIvSGNEDGLFSIdPSTGEITTAKPLDREEQSS----YTLTVTATDGGGP-P 81
                        90
                ....*....|....*..
gi 18858397 561 ATGTGTLVIELQDVNDN 577
Cdd:cd11304  82 LSSTATVTITVLDVNDN 98
Cadherin_C pfam01049
Cadherin cytoplasmic region; Cadherins are vital in cell-cell adhesion during tissue ...
715-862 8.76e-56

Cadherin cytoplasmic region; Cadherins are vital in cell-cell adhesion during tissue differentiation. Cadherins are linked to the cytoskeleton by catenins. Catenins bind to the cytoplasmic tail of the cadherin. Cadherins cluster to form foci of homophilic binding units. A key determinant to the strength of the binding that it is mediated by cadherins is the juxtamembrane region of the cadherin. This region induces clustering and also binds to the protein p120ctn.


:

Pssm-ID: 250323  Cd Length: 144  Bit Score: 189.05  E-value: 8.76e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397   715 RRKSNSKKEPLLPEDDVRDNIYYYDEEGGGEDDQD-FDLSVLHRGLDNRPEVFRNDVAPtfmpapQYRPRPANPEEIGTF 793
Cdd:pfam01049   2 RRKKEPEKLIISEEDDIRENIVNYDDEGGGEEDTDaYDISALRNPLDPEPEKIPPLISA------QPRYRPPDPGDVGDF 75
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 18858397   794 IDDNLKAADNDPTAPPYDSLLVFDYEGGGSDAGSLSSLNTSSSGNDQDYDFLNEWGPRFKKLADMYGGG 862
Cdd:pfam01049  76 IHEKLPEADNDPTAPPYDSLLTYAYEGRGSVAGSLSSLNSSSSDGDQDYDYLSDWGPRFKKLADLYGGG 144
Cadherin_pro pfam08758
Cadherin prodomain like; Cadherins are a family of proteins that mediate calcium dependent ...
29-117 5.25e-35

Cadherin prodomain like; Cadherins are a family of proteins that mediate calcium dependent cell-cell adhesion. They are activated through cleavage of a prosequence in the late Golgi. This domain corresponds to the folded region of the prosequence, and is termed the prodomain. The prodomain shows structural resemblance to the cadherin domain, but lacks all the features known to be important for cadherin-cadherin interactions.


:

Pssm-ID: 255020  Cd Length: 90  Bit Score: 129.31  E-value: 5.25e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397    29 CTPGFELEEFVFKVHRNhLHSGKRLGKVTFNNCDGRTRTLFQSIDKRFEINTDGTVTLKRQVTLHEGHKVFSVHAWDSSG 108
Cdd:pfam08758   2 CKPGFSEEVYTFLVPRR-LEEGQPLGRVKFNDCKGRRRIQYESSDPDFKVNEDGTVYAKRSVTLHSEQKSFLVHAWDSET 80
                          90
                  ....*....|
gi 18858397   109 MK-HTASVRV 117
Cdd:pfam08758  81 REmAEVKVTL 90
CA_like super family cl15786
Cadherin repeat-like domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
144-244 1.92e-19

Cadherin repeat-like domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. This family also includes the cadherin-like repeats of extracellular alpha-dystroglycan.


The actual alignment was detected with superfamily member cd00031:

Pssm-ID: 265784  Cd Length: 98  Bit Score: 85.09  E-value: 1.92e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397 144 IPPISVSENSKGPfpMRLVQIKSDYAIETRLAYKITGEGADlDPKGIFTIDRLSGWVSVTQLLDREKKASYKLRAHANGV 223
Cdd:cd00031   1 IPDGSAVEGRSRG--SFRVSIPTDLIASSGEIIKISAAGKE-ALPSWLHWEPHSGILEGLEKLDREDKGVHYISVSAASL 77
                        90       100
                ....*....|....*....|.
gi 18858397 224 DADVTEKPMDIIVTVTDQNDN 244
Cdd:cd00031  78 GANVPQTSSVFSIEVYDENDN 98
CA_like super family cl15786
Cadherin repeat-like domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
591-670 6.15e-03

Cadherin repeat-like domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. This family also includes the cadherin-like repeats of extracellular alpha-dystroglycan.


The actual alignment was detected with superfamily member pfam00028:

Pssm-ID: 265784  Cd Length: 92  Bit Score: 36.13  E-value: 6.15e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397   591 RESAPV-----LLSITDKDLPPFAGPFKVEPQGDTSKNWSVfFNETGHflnIKPQSQL---EQGEYKVVLRVADREGESQ 662
Cdd:pfam00028   6 PENAPVgtevlTVTATDADLGPNGRIFYSILGGGPGGWFRI-DPDTGD---LSTTKPLdreSIGEYELTVLATDSGSPPL 81

                  ....*...
gi 18858397   663 ENIIQASV 670
Cdd:pfam00028  82 SSTTTVTI 89
 
Name Accession Description Interval E-value
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
252-357 5.92e-25

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 100.85  E-value: 5.92e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397 252 PFNGNVPEALEKGEVFMTVTATDADDkenTDNADISYVIISQDPPspkpNMFAINPVSGGISVLeKGLDREQWFRYTLVI 331
Cdd:cd11304   1 SYEVSVPENAPPGTVVLTVSATDPDS---GENGEVTYSIVSGNED----GLFSIDPSTGEITTA-KPLDREEQSSYTLTV 72
                        90       100
                ....*....|....*....|....*.
gi 18858397 332 TATDMNGEGLSTTGTAVITVTDSNDN 357
Cdd:cd11304  73 TATDGGGPPLSSTATVTITVLDVNDN 98
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
365-469 3.72e-21

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 90.07  E-value: 3.72e-21
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397 365 SYTASVPENQ-VGVEVAKLPVTDGDEPEStaWSTKYQIIAGDKGGFFNIStgpsRLEGIITTVKPLDYEKTKQYILSVIV 443
Cdd:cd11304   1 SYEVSVPENApPGTVVLTVSATDPDSGEN--GEVTYSIVSGNEDGLFSID----PSTGEITTAKPLDREEQSSYTLTVTA 74
                        90       100
                ....*....|....*....|....*.
gi 18858397 444 VNDDkfvGPLPTSTATVTVNVKDVNE 469
Cdd:cd11304  75 TDGG---GPPLSSTATVTITVLDVND 97
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
483-577 1.12e-16

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 76.97  E-value: 1.12e-16
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397 483 PENLPVGSNLIPFTAIDPDTEKKQNITYRI-GNDPSDWLNI-TGSGQIQVKNALDRESSNVkdgkYKALILALDNDVEsP 560
Cdd:cd11304   7 PENAPPGTVVLTVSATDPDSGENGEVTYSIvSGNEDGLFSIdPSTGEITTAKPLDREEQSS----YTLTVTATDGGGP-P 81
                        90
                ....*....|....*..
gi 18858397 561 ATGTGTLVIELQDVNDN 577
Cdd:cd11304  82 LSSTATVTITVLDVNDN 98
Cadherin_C pfam01049
Cadherin cytoplasmic region; Cadherins are vital in cell-cell adhesion during tissue ...
715-862 8.76e-56

Cadherin cytoplasmic region; Cadherins are vital in cell-cell adhesion during tissue differentiation. Cadherins are linked to the cytoskeleton by catenins. Catenins bind to the cytoplasmic tail of the cadherin. Cadherins cluster to form foci of homophilic binding units. A key determinant to the strength of the binding that it is mediated by cadherins is the juxtamembrane region of the cadherin. This region induces clustering and also binds to the protein p120ctn.


Pssm-ID: 250323  Cd Length: 144  Bit Score: 189.05  E-value: 8.76e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397   715 RRKSNSKKEPLLPEDDVRDNIYYYDEEGGGEDDQD-FDLSVLHRGLDNRPEVFRNDVAPtfmpapQYRPRPANPEEIGTF 793
Cdd:pfam01049   2 RRKKEPEKLIISEEDDIRENIVNYDDEGGGEEDTDaYDISALRNPLDPEPEKIPPLISA------QPRYRPPDPGDVGDF 75
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 18858397   794 IDDNLKAADNDPTAPPYDSLLVFDYEGGGSDAGSLSSLNTSSSGNDQDYDFLNEWGPRFKKLADMYGGG 862
Cdd:pfam01049  76 IHEKLPEADNDPTAPPYDSLLTYAYEGRGSVAGSLSSLNSSSSDGDQDYDYLSDWGPRFKKLADLYGGG 144
Cadherin_pro pfam08758
Cadherin prodomain like; Cadherins are a family of proteins that mediate calcium dependent ...
29-117 5.25e-35

Cadherin prodomain like; Cadherins are a family of proteins that mediate calcium dependent cell-cell adhesion. They are activated through cleavage of a prosequence in the late Golgi. This domain corresponds to the folded region of the prosequence, and is termed the prodomain. The prodomain shows structural resemblance to the cadherin domain, but lacks all the features known to be important for cadherin-cadherin interactions.


Pssm-ID: 255020  Cd Length: 90  Bit Score: 129.31  E-value: 5.25e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397    29 CTPGFELEEFVFKVHRNhLHSGKRLGKVTFNNCDGRTRTLFQSIDKRFEINTDGTVTLKRQVTLHEGHKVFSVHAWDSSG 108
Cdd:pfam08758   2 CKPGFSEEVYTFLVPRR-LEEGQPLGRVKFNDCKGRRRIQYESSDPDFKVNEDGTVYAKRSVTLHSEQKSFLVHAWDSET 80
                          90
                  ....*....|
gi 18858397   109 MK-HTASVRV 117
Cdd:pfam08758  81 REmAEVKVTL 90
Cadherin_pro smart01055
Cadherin prodomain like; Cadherins are a family of proteins that mediate calcium dependent ...
29-117 1.39e-28

Cadherin prodomain like; Cadherins are a family of proteins that mediate calcium dependent cell-cell adhesion. They are activated through cleavage of a prosequence in the late Golgi. This domain corresponds to the folded region of the prosequence, and is termed the prodomain. The prodomain shows structural resemblance to the cadherin domain, but lacks all the features known to be important for cadherin-cadherin interactions.


Pssm-ID: 214999  Cd Length: 87  Bit Score: 110.83  E-value: 1.39e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397     29 CTPGFELEEFVFKVHRnHLHSGKRLGKVTFNNCDGRTRTLFQSIDKRFEINTDGTVTLKRQVTLHEGHKVFSVHAWDSSG 108
Cdd:smart01055   1 CKPGFSEEKYTFHVPS-HLEAGQPLGRVNFEECLGSARLQFESSDPDFRVLEDGTVYATRPVSLSSEKKSFTVLAWDSQG 79

                   ....*....
gi 18858397    109 mKHTASVRV 117
Cdd:smart01055  80 -QEKKEIKV 87
CA smart00112
Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. ...
271-359 7.06e-21

Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.


Pssm-ID: 214520  Cd Length: 81  Bit Score: 88.56  E-value: 7.06e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397    271 TATDADDKENtdnADISYVIISQDPPspkpNMFAINPVSGGISVLeKGLDREQWFRYTLVITATDMNGEGLSTTGTAVIT 350
Cdd:smart00112   1 SATDADSGEN---GKVTYSILSGNDD----GLFSIDPETGEITTT-KPLDREEQPEYTLTVEATDGGGPPLSSTATVTIT 72

                   ....*....
gi 18858397    351 VTDSNDNAP 359
Cdd:smart00112  73 VLDVNDNAP 81
CA_like cd00031
Cadherin repeat-like domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
144-244 1.92e-19

Cadherin repeat-like domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. This family also includes the cadherin-like repeats of extracellular alpha-dystroglycan.


Pssm-ID: 206635  Cd Length: 98  Bit Score: 85.09  E-value: 1.92e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397 144 IPPISVSENSKGPfpMRLVQIKSDYAIETRLAYKITGEGADlDPKGIFTIDRLSGWVSVTQLLDREKKASYKLRAHANGV 223
Cdd:cd00031   1 IPDGSAVEGRSRG--SFRVSIPTDLIASSGEIIKISAAGKE-ALPSWLHWEPHSGILEGLEKLDREDKGVHYISVSAASL 77
                        90       100
                ....*....|....*....|.
gi 18858397 224 DADVTEKPMDIIVTVTDQNDN 244
Cdd:cd00031  78 GANVPQTSSVFSIEVYDENDN 98
Cadherin pfam00028
Cadherin domain;
253-352 2.08e-18

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 81.97  E-value: 2.08e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397   253 FNGNVPEALEKGEVFMTVTATDADdkeNTDNADISYVIISQDPPspkpNMFAINPVSGGISVLeKGLDREQWFRYTLVIT 332
Cdd:pfam00028   1 YSASVPENAPVGTEVLTVTATDAD---LGPNGRIFYSILGGGPG----GWFRIDPDTGDLSTT-KPLDRESIGEYELTVL 72
                          90       100
                  ....*....|....*....|
gi 18858397   333 ATDMNGEGLSTTGTAVITVT 352
Cdd:pfam00028  73 ATDSGSPPLSSTTTVTITVL 92
Cadherin pfam00028
Cadherin domain;
366-464 1.37e-17

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 79.66  E-value: 1.37e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397   366 YTASVPENQ-VGVEVAKLPVTDGDEPesTAWSTKYQIIAGDKGGFFNISTGPsrleGIITTVKPLDYEKTKQYILSVIVV 444
Cdd:pfam00028   1 YSASVPENApVGTEVLTVTATDADLG--PNGRIFYSILGGGPGGWFRIDPDT----GDLSTTKPLDRESIGEYELTVLAT 74
                          90       100
                  ....*....|....*....|
gi 18858397   445 NDDkfvGPLPTSTATVTVNV 464
Cdd:pfam00028  75 DSG---SPPLSSTTTVTITV 91
CA smart00112
Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. ...
384-471 7.05e-15

Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.


Pssm-ID: 214520  Cd Length: 81  Bit Score: 71.61  E-value: 7.05e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397    384 VTDGDEPEStaWSTKYQIIAGDKGGFFNISTGPsrleGIITTVKPLDYEKTKQYILSVIVVNDDkfvGPLPTSTATVTVN 463
Cdd:smart00112   2 ATDADSGEN--GKVTYSILSGNDDGLFSIDPET----GEITTTKPLDREEQPEYTLTVEATDGG---GPPLSSTATVTIT 72

                   ....*...
gi 18858397    464 VKDVNEPP 471
Cdd:smart00112  73 VLDVNDNA 80
CA smart00112
Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. ...
496-579 1.09e-13

Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.


Pssm-ID: 214520  Cd Length: 81  Bit Score: 68.14  E-value: 1.09e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397    496 TAIDPDTEKKQNITYRI-GNDPSDWLNI-TGSGQIQVKNALDRESSNVkdgkYKALILALDNDvESPATGTGTLVIELQD 573
Cdd:smart00112   1 SATDADSGENGKVTYSIlSGNDDGLFSIdPETGEITTTKPLDREEQPE----YTLTVEATDGG-GPPLSSTATVTITVLD 75

                   ....*.
gi 18858397    574 VNDNAP 579
Cdd:smart00112  76 VNDNAP 81
Cadherin pfam00028
Cadherin domain;
483-572 1.22e-13

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 68.10  E-value: 1.22e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397   483 PENLPVGSNLIPFTAIDPDTEKKQNITYRI-GNDPSDWLNI-TGSGQIQVKNALDRESSnvkdGKYKALILALDNDVEsP 560
Cdd:pfam00028   6 PENAPVGTEVLTVTATDADLGPNGRIFYSIlGGGPGGWFRIdPDTGDLSTTKPLDRESI----GEYELTVLATDSGSP-P 80
                          90
                  ....*....|..
gi 18858397   561 ATGTGTLVIELQ 572
Cdd:pfam00028  81 LSSTTTVTITVL 92
Cadherin pfam00028
Cadherin domain;
145-239 1.46e-12

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 65.02  E-value: 1.46e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397   145 PPISVSENSK-GPFPMRLVQIKSDYAIETRLAYKITGEGadldPKGIFTIDRLSGWVSVTQLLDREKKASYKLRAHAngV 223
Cdd:pfam00028   1 YSASVPENAPvGTEVLTVTATDADLGPNGRIFYSILGGG----PGGWFRIDPDTGDLSTTKPLDRESIGEYELTVLA--T 74
                          90
                  ....*....|....*...
gi 18858397   224 DADVT--EKPMDIIVTVT 239
Cdd:pfam00028  75 DSGSPplSSTTTVTITVL 92
CA smart00112
Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. ...
173-246 1.26e-11

Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.


Pssm-ID: 214520  Cd Length: 81  Bit Score: 61.98  E-value: 1.26e-11
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 18858397    173 RLAYKITGEgadlDPKGIFTIDRLSGWVSVTQLLDREKKASYKLRAHANGVDADVTEKPMDIIVTVTDQNDNKP 246
Cdd:smart00112  12 KVTYSILSG----NDDGLFSIDPETGEITTTKPLDREEQPEYTLTVEATDGGGPPLSSTATVTITVLDVNDNAP 81
Cadherin pfam00028
Cadherin domain;
591-670 6.15e-03

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 36.13  E-value: 6.15e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397   591 RESAPV-----LLSITDKDLPPFAGPFKVEPQGDTSKNWSVfFNETGHflnIKPQSQL---EQGEYKVVLRVADREGESQ 662
Cdd:pfam00028   6 PENAPVgtevlTVTATDADLGPNGRIFYSILGGGPGGWFRI-DPDTGD---LSTTKPLdreSIGEYELTVLATDSGSPPL 81

                  ....*...
gi 18858397   663 ENIIQASV 670
Cdd:pfam00028  82 SSTTTVTI 89
 
Name Accession Description Interval E-value
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
252-357 5.92e-25

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 100.85  E-value: 5.92e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397 252 PFNGNVPEALEKGEVFMTVTATDADDkenTDNADISYVIISQDPPspkpNMFAINPVSGGISVLeKGLDREQWFRYTLVI 331
Cdd:cd11304   1 SYEVSVPENAPPGTVVLTVSATDPDS---GENGEVTYSIVSGNED----GLFSIDPSTGEITTA-KPLDREEQSSYTLTV 72
                        90       100
                ....*....|....*....|....*.
gi 18858397 332 TATDMNGEGLSTTGTAVITVTDSNDN 357
Cdd:cd11304  73 TATDGGGPPLSSTATVTITVLDVNDN 98
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
365-469 3.72e-21

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 90.07  E-value: 3.72e-21
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397 365 SYTASVPENQ-VGVEVAKLPVTDGDEPEStaWSTKYQIIAGDKGGFFNIStgpsRLEGIITTVKPLDYEKTKQYILSVIV 443
Cdd:cd11304   1 SYEVSVPENApPGTVVLTVSATDPDSGEN--GEVTYSIVSGNEDGLFSID----PSTGEITTAKPLDREEQSSYTLTVTA 74
                        90       100
                ....*....|....*....|....*.
gi 18858397 444 VNDDkfvGPLPTSTATVTVNVKDVNE 469
Cdd:cd11304  75 TDGG---GPPLSSTATVTITVLDVND 97
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
483-577 1.12e-16

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 76.97  E-value: 1.12e-16
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397 483 PENLPVGSNLIPFTAIDPDTEKKQNITYRI-GNDPSDWLNI-TGSGQIQVKNALDRESSNVkdgkYKALILALDNDVEsP 560
Cdd:cd11304   7 PENAPPGTVVLTVSATDPDSGENGEVTYSIvSGNEDGLFSIdPSTGEITTAKPLDREEQSS----YTLTVTATDGGGP-P 81
                        90
                ....*....|....*..
gi 18858397 561 ATGTGTLVIELQDVNDN 577
Cdd:cd11304  82 LSSTATVTITVLDVNDN 98
Cadherin_C pfam01049
Cadherin cytoplasmic region; Cadherins are vital in cell-cell adhesion during tissue ...
715-862 8.76e-56

Cadherin cytoplasmic region; Cadherins are vital in cell-cell adhesion during tissue differentiation. Cadherins are linked to the cytoskeleton by catenins. Catenins bind to the cytoplasmic tail of the cadherin. Cadherins cluster to form foci of homophilic binding units. A key determinant to the strength of the binding that it is mediated by cadherins is the juxtamembrane region of the cadherin. This region induces clustering and also binds to the protein p120ctn.


Pssm-ID: 250323  Cd Length: 144  Bit Score: 189.05  E-value: 8.76e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397   715 RRKSNSKKEPLLPEDDVRDNIYYYDEEGGGEDDQD-FDLSVLHRGLDNRPEVFRNDVAPtfmpapQYRPRPANPEEIGTF 793
Cdd:pfam01049   2 RRKKEPEKLIISEEDDIRENIVNYDDEGGGEEDTDaYDISALRNPLDPEPEKIPPLISA------QPRYRPPDPGDVGDF 75
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 18858397   794 IDDNLKAADNDPTAPPYDSLLVFDYEGGGSDAGSLSSLNTSSSGNDQDYDFLNEWGPRFKKLADMYGGG 862
Cdd:pfam01049  76 IHEKLPEADNDPTAPPYDSLLTYAYEGRGSVAGSLSSLNSSSSDGDQDYDYLSDWGPRFKKLADLYGGG 144
Cadherin_pro pfam08758
Cadherin prodomain like; Cadherins are a family of proteins that mediate calcium dependent ...
29-117 5.25e-35

Cadherin prodomain like; Cadherins are a family of proteins that mediate calcium dependent cell-cell adhesion. They are activated through cleavage of a prosequence in the late Golgi. This domain corresponds to the folded region of the prosequence, and is termed the prodomain. The prodomain shows structural resemblance to the cadherin domain, but lacks all the features known to be important for cadherin-cadherin interactions.


Pssm-ID: 255020  Cd Length: 90  Bit Score: 129.31  E-value: 5.25e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397    29 CTPGFELEEFVFKVHRNhLHSGKRLGKVTFNNCDGRTRTLFQSIDKRFEINTDGTVTLKRQVTLHEGHKVFSVHAWDSSG 108
Cdd:pfam08758   2 CKPGFSEEVYTFLVPRR-LEEGQPLGRVKFNDCKGRRRIQYESSDPDFKVNEDGTVYAKRSVTLHSEQKSFLVHAWDSET 80
                          90
                  ....*....|
gi 18858397   109 MK-HTASVRV 117
Cdd:pfam08758  81 REmAEVKVTL 90
Cadherin_pro smart01055
Cadherin prodomain like; Cadherins are a family of proteins that mediate calcium dependent ...
29-117 1.39e-28

Cadherin prodomain like; Cadherins are a family of proteins that mediate calcium dependent cell-cell adhesion. They are activated through cleavage of a prosequence in the late Golgi. This domain corresponds to the folded region of the prosequence, and is termed the prodomain. The prodomain shows structural resemblance to the cadherin domain, but lacks all the features known to be important for cadherin-cadherin interactions.


Pssm-ID: 214999  Cd Length: 87  Bit Score: 110.83  E-value: 1.39e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397     29 CTPGFELEEFVFKVHRnHLHSGKRLGKVTFNNCDGRTRTLFQSIDKRFEINTDGTVTLKRQVTLHEGHKVFSVHAWDSSG 108
Cdd:smart01055   1 CKPGFSEEKYTFHVPS-HLEAGQPLGRVNFEECLGSARLQFESSDPDFRVLEDGTVYATRPVSLSSEKKSFTVLAWDSQG 79

                   ....*....
gi 18858397    109 mKHTASVRV 117
Cdd:smart01055  80 -QEKKEIKV 87
CA smart00112
Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. ...
271-359 7.06e-21

Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.


Pssm-ID: 214520  Cd Length: 81  Bit Score: 88.56  E-value: 7.06e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397    271 TATDADDKENtdnADISYVIISQDPPspkpNMFAINPVSGGISVLeKGLDREQWFRYTLVITATDMNGEGLSTTGTAVIT 350
Cdd:smart00112   1 SATDADSGEN---GKVTYSILSGNDD----GLFSIDPETGEITTT-KPLDREEQPEYTLTVEATDGGGPPLSSTATVTIT 72

                   ....*....
gi 18858397    351 VTDSNDNAP 359
Cdd:smart00112  73 VLDVNDNAP 81
CA_like cd00031
Cadherin repeat-like domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
144-244 1.92e-19

Cadherin repeat-like domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. This family also includes the cadherin-like repeats of extracellular alpha-dystroglycan.


Pssm-ID: 206635  Cd Length: 98  Bit Score: 85.09  E-value: 1.92e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397 144 IPPISVSENSKGPfpMRLVQIKSDYAIETRLAYKITGEGADlDPKGIFTIDRLSGWVSVTQLLDREKKASYKLRAHANGV 223
Cdd:cd00031   1 IPDGSAVEGRSRG--SFRVSIPTDLIASSGEIIKISAAGKE-ALPSWLHWEPHSGILEGLEKLDREDKGVHYISVSAASL 77
                        90       100
                ....*....|....*....|.
gi 18858397 224 DADVTEKPMDIIVTVTDQNDN 244
Cdd:cd00031  78 GANVPQTSSVFSIEVYDENDN 98
Cadherin pfam00028
Cadherin domain;
253-352 2.08e-18

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 81.97  E-value: 2.08e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397   253 FNGNVPEALEKGEVFMTVTATDADdkeNTDNADISYVIISQDPPspkpNMFAINPVSGGISVLeKGLDREQWFRYTLVIT 332
Cdd:pfam00028   1 YSASVPENAPVGTEVLTVTATDAD---LGPNGRIFYSILGGGPG----GWFRIDPDTGDLSTT-KPLDRESIGEYELTVL 72
                          90       100
                  ....*....|....*....|
gi 18858397   333 ATDMNGEGLSTTGTAVITVT 352
Cdd:pfam00028  73 ATDSGSPPLSSTTTVTITVL 92
Cadherin pfam00028
Cadherin domain;
366-464 1.37e-17

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 79.66  E-value: 1.37e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397   366 YTASVPENQ-VGVEVAKLPVTDGDEPesTAWSTKYQIIAGDKGGFFNISTGPsrleGIITTVKPLDYEKTKQYILSVIVV 444
Cdd:pfam00028   1 YSASVPENApVGTEVLTVTATDADLG--PNGRIFYSILGGGPGGWFRIDPDT----GDLSTTKPLDRESIGEYELTVLAT 74
                          90       100
                  ....*....|....*....|
gi 18858397   445 NDDkfvGPLPTSTATVTVNV 464
Cdd:pfam00028  75 DSG---SPPLSSTTTVTITV 91
CA smart00112
Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. ...
384-471 7.05e-15

Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.


Pssm-ID: 214520  Cd Length: 81  Bit Score: 71.61  E-value: 7.05e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397    384 VTDGDEPEStaWSTKYQIIAGDKGGFFNISTGPsrleGIITTVKPLDYEKTKQYILSVIVVNDDkfvGPLPTSTATVTVN 463
Cdd:smart00112   2 ATDADSGEN--GKVTYSILSGNDDGLFSIDPET----GEITTTKPLDREEQPEYTLTVEATDGG---GPPLSSTATVTIT 72

                   ....*...
gi 18858397    464 VKDVNEPP 471
Cdd:smart00112  73 VLDVNDNA 80
CA smart00112
Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. ...
496-579 1.09e-13

Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.


Pssm-ID: 214520  Cd Length: 81  Bit Score: 68.14  E-value: 1.09e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397    496 TAIDPDTEKKQNITYRI-GNDPSDWLNI-TGSGQIQVKNALDRESSNVkdgkYKALILALDNDvESPATGTGTLVIELQD 573
Cdd:smart00112   1 SATDADSGENGKVTYSIlSGNDDGLFSIdPETGEITTTKPLDREEQPE----YTLTVEATDGG-GPPLSSTATVTITVLD 75

                   ....*.
gi 18858397    574 VNDNAP 579
Cdd:smart00112  76 VNDNAP 81
Cadherin pfam00028
Cadherin domain;
483-572 1.22e-13

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 68.10  E-value: 1.22e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397   483 PENLPVGSNLIPFTAIDPDTEKKQNITYRI-GNDPSDWLNI-TGSGQIQVKNALDRESSnvkdGKYKALILALDNDVEsP 560
Cdd:pfam00028   6 PENAPVGTEVLTVTATDADLGPNGRIFYSIlGGGPGGWFRIdPDTGDLSTTKPLDRESI----GEYELTVLATDSGSP-P 80
                          90
                  ....*....|..
gi 18858397   561 ATGTGTLVIELQ 572
Cdd:pfam00028  81 LSSTTTVTITVL 92
Cadherin pfam00028
Cadherin domain;
145-239 1.46e-12

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 65.02  E-value: 1.46e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397   145 PPISVSENSK-GPFPMRLVQIKSDYAIETRLAYKITGEGadldPKGIFTIDRLSGWVSVTQLLDREKKASYKLRAHAngV 223
Cdd:pfam00028   1 YSASVPENAPvGTEVLTVTATDADLGPNGRIFYSILGGG----PGGWFRIDPDTGDLSTTKPLDRESIGEYELTVLA--T 74
                          90
                  ....*....|....*...
gi 18858397   224 DADVT--EKPMDIIVTVT 239
Cdd:pfam00028  75 DSGSPplSSTTTVTITVL 92
CA smart00112
Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. ...
173-246 1.26e-11

Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.


Pssm-ID: 214520  Cd Length: 81  Bit Score: 61.98  E-value: 1.26e-11
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 18858397    173 RLAYKITGEgadlDPKGIFTIDRLSGWVSVTQLLDREKKASYKLRAHANGVDADVTEKPMDIIVTVTDQNDNKP 246
Cdd:smart00112  12 KVTYSILSG----NDDGLFSIDPETGEITTTKPLDREEQPEYTLTVEATDGGGPPLSSTATVTITVLDVNDNAP 81
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
147-244 2.93e-11

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 61.18  E-value: 2.93e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397 147 ISVSENSkgPFPMRLVQIK---SDYAIETRLAYKITGEgadlDPKGIFTIDRLSGWVSVTQLLDREKKASYKLRAHANGV 223
Cdd:cd11304   4 VSVPENA--PPGTVVLTVSatdPDSGENGEVTYSIVSG----NEDGLFSIDPSTGEITTAKPLDREEQSSYTLTVTATDG 77
                        90       100
                ....*....|....*....|.
gi 18858397 224 DADVTEKPMDIIVTVTDQNDN 244
Cdd:cd11304  78 GGPPLSSTATVTITVLDVNDN 98
CA_like cd00031
Cadherin repeat-like domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
255-357 1.42e-03

Cadherin repeat-like domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. This family also includes the cadherin-like repeats of extracellular alpha-dystroglycan.


Pssm-ID: 206635  Cd Length: 98  Bit Score: 38.09  E-value: 1.42e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397 255 GNVPEAlEKGEVFMTVTATDADdKENTDNADISyviiSQDPPSPkPNMFAINPVSGGISVLEKgLDREQWFRYTLVITAT 334
Cdd:cd00031   4 GSAVEG-RSRGSFRVSIPTDLI-ASSGEIIKIS----AAGKEAL-PSWLHWEPHSGILEGLEK-LDREDKGVHYISVSAA 75
                        90       100
                ....*....|....*....|...
gi 18858397 335 DMNGEGLSTTGTAVITVTDSNDN 357
Cdd:cd00031  76 SLGANVPQTSSVFSIEVYDENDN 98
Cadherin pfam00028
Cadherin domain;
591-670 6.15e-03

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 36.13  E-value: 6.15e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18858397   591 RESAPV-----LLSITDKDLPPFAGPFKVEPQGDTSKNWSVfFNETGHflnIKPQSQL---EQGEYKVVLRVADREGESQ 662
Cdd:pfam00028   6 PENAPVgtevlTVTATDADLGPNGRIFYSILGGGPGGWFRI-DPDTGD---LSTTKPLdreSIGEYELTVLATDSGSPPL 81

                  ....*...
gi 18858397   663 ENIIQASV 670
Cdd:pfam00028  82 SSTTTVTI 89
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH