NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|182416375|ref|YP_001821441|]
View 

protein serine/threonine phosphatase [Opitutus terrae PB90-1]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
27-288 2.59e-43

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


:

Pssm-ID: 238083  Cd Length: 254  Bit Score: 150.17  E-value: 2.59e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375  27 SGLTHVGRYRQNNEDTFLALHFDGHEvrylgktgeaslagTDFVFAVSDGMGGAKSGEFASRITVDRVTRLLPRGFRLSA 106
Cdd:cd00143    3 AGVSDKGGDRKTNEDAVVIKPNLNNE--------------DGGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSE 68
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375 107 AGLatgfQDLLVELFSAIHNDLLKLGFSYEECAGMGCTLSLCWLTPEWVQFGHIGDSRIYyLPHAGGMTQVTHDHTFVGK 186
Cdd:cd00143   69 EDI----EEALRKAFLRADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAV-LCRNGEAVQLTKDHKPVNE 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375 187 LRRKGEFNERQARTDPR---RNALQQALGAGNQF----IDPQVGAVGHHPGDRFLI-CSDGIVDGLWDREIQEIIRAPAG 258
Cdd:cd00143  144 EERERIEKAGGRVSNGRvpgVLAVTRALGDFDLKpgvsAEPDVTVVKLTEDDDFLIlASDGLWDVLSNQEAVDIVRSELA 223
                        250       260       270
                 ....*....|....*....|....*....|
gi 182416375 259 EGPPRSIAQQLVETAVQNSGRDNTTAIVLE 288
Cdd:cd00143  224 KEDLQEAAQELVDLALRRGSHDNITVVVVR 253
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
27-288 2.59e-43

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 150.17  E-value: 2.59e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375  27 SGLTHVGRYRQNNEDTFLALHFDGHEvrylgktgeaslagTDFVFAVSDGMGGAKSGEFASRITVDRVTRLLPRGFRLSA 106
Cdd:cd00143    3 AGVSDKGGDRKTNEDAVVIKPNLNNE--------------DGGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSE 68
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375 107 AGLatgfQDLLVELFSAIHNDLLKLGFSYEECAGMGCTLSLCWLTPEWVQFGHIGDSRIYyLPHAGGMTQVTHDHTFVGK 186
Cdd:cd00143   69 EDI----EEALRKAFLRADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAV-LCRNGEAVQLTKDHKPVNE 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375 187 LRRKGEFNERQARTDPR---RNALQQALGAGNQF----IDPQVGAVGHHPGDRFLI-CSDGIVDGLWDREIQEIIRAPAG 258
Cdd:cd00143  144 EERERIEKAGGRVSNGRvpgVLAVTRALGDFDLKpgvsAEPDVTVVKLTEDDDFLIlASDGLWDVLSNQEAVDIVRSELA 223
                        250       260       270
                 ....*....|....*....|....*....|
gi 182416375 259 EGPPRSIAQQLVETAVQNSGRDNTTAIVLE 288
Cdd:cd00143  224 KEDLQEAAQELVDLALRRGSHDNITVVVVR 253
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
25-292 2.14e-55

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 182.17  E-value: 2.14e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375  25 RWSGLTHVGRYRQNNEDTFLALHFDGHEVRYLgktgeaslagtdfvFAVSDGMGGAKSGEFASRITVDRVTRLLPRGFRL 104
Cdd:COG0631    9 KVAGLSDVGTVRKHNEDAFLIKPNENGNLLLL--------------FAVADGMGGHAAGEVASKLAVEALARLFDETNFN 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375 105 SaagLATGFQDLLVELFSAIHNDLLKLGFSYEECAGMGCTLSLCWLTPEWVQFGHIGDSRIYYLpHAGGMTQVTHDHTFV 184
Cdd:COG0631   75 S---LNESLEELLKEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLL-RDGELKQLTEDHSLV 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375 185 GKLRRKGEFNERQARTDPRRNALQQALGaGNQFIDPQVGAVGHHPGDRFLICSDGIVDGLWDREIQEIIRapaGEGPPRS 264
Cdd:COG0631  151 NRLEQRGIITPEEARSHPRRNALTRALG-DFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILK---NSETPQE 226
                        250       260
                 ....*....|....*....|....*...
gi 182416375 265 IAQQLVETAVQNSGRDNTTAIVLEMLGS 292
Cdd:COG0631  227 AADKLIELALEGGGPDNITVVLVRLNGE 254
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
27-287 7.53e-25

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 100.14  E-value: 7.53e-25
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375    27 SGLTHVGRYRQNNEDTFLAlHFDGHEvrylgktgeaslagTDFVFAVSDGMGGAKSGEFASRITVDRVTRLLPrgfrlSA 106
Cdd:smart00332  11 YGLSSMQGVRKPMEDAHVI-TPDLSD--------------SGGFFGVFDGHGGSEAAKFLSKNLPEILAEELI-----KE 70
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375   107 AGLATGFQDLLVELFSAIHNDLLKlgfsyEECAGMGCTLSLCWLTPEWVQFGHIGDSRIYYLPhAGGMTQVTHDHTFVGK 186
Cdd:smart00332  71 KDELEDVEEALRKAFLSTDEEILE-----ELEALSGSTAVVALISGNKLYVANVGDSRAVLCR-NGKAVQLTEDHKPSNE 144
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375   187 LRRKgEFNERQARTDPRRNALQQALGA--GNQFIDPQVGAVGHH-------PGDRFLICSDGIVDGLWDREIQEIIRAPA 257
Cdd:smart00332 145 DERA-RIEAAGGFVINGRVNGVLALSRaiGDFFLKPYVSAEPDVtvvelteKDDFLILASDGLWDVLSNQEVVDIVRKHL 223
                          250       260       270
                   ....*....|....*....|....*....|
gi 182416375   258 gEGPPRSIAQQLVETAVQNSGRDNTTAIVL 287
Cdd:smart00332 224 -SKDPKEAAKRLIDLALARGSKDNITVVVV 252
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
70-269 1.60e-21

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 89.68  E-value: 1.60e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375   70 VFAVSDGMGGAKSGEFASRITVDRVTRLLprgfrlsAAGLATGFQDLLVELFSAIHNDLL-KLGFSYEECAG----MGCT 144
Cdd:pfam13672  26 LIAVADGAGSAKYSDVGARLAVEAAVEAL-------RELLDSGELPELEALVRQILNDILaLVRQEAAAQGLeprdYATT 98
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375  145 LSLCWLTPEWVQFGHIGDSRIYYLPHAGGMTQVTHDHtfvgklrrKGEF-NERQARTDPrrnalqqalgagNQFIDPQVG 223
Cdd:pfam13672  99 LLLAVITPGGIVFFQIGDGAIVVRDRDGELQLLSEPD--------SGEYaNETTFLTSP------------DALEEFRIR 158
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 182416375  224 AVGHHPGDRFLICSDGIVDGL-----WDREIQEIIRAPAGEGPPRSIAQQL 269
Cdd:pfam13672 159 RLTLEPGDALALMTDGLSDSLvteepFFPFFAPLLETLEEEGASEQLAEFL 209
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
27-289 3.14e-19

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 86.65  E-value: 3.14e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375  27 SGLTHVGRYRQNNEDTFLALHFDGHEVRYLGKTGEASlaGtdfVFAVSDGMGGAKSGEFASRITVDRVTRLLprgfrlsA 106
Cdd:PRK14559 378 AGRTDVGRQRHHNEDYFGINTRIQKLENPHGRIVQAR--G---LYILCDGMGGHAAGEVASALAVETLQQYF-------Q 445
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375 107 AGLATGFQD---------LLVELFSAIHNDLLKLGfsyeecAG-MGCTLSLCWLTPEWVQFGHIGDSRIYYLPHAGGMTQ 176
Cdd:PRK14559 446 QHWQDELPDeetireaiyLANEAIYDLNQQNARSG------SGrMGTTLVMALVQDTQVAVAHVGDSRLYRVTRKGGLEQ 519
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375 177 VTHDHTfVGKlrrkgefNERQARTDP-----RRNALQ--QALGA-GNQFIDPQVGAVGHHPGDRFLICSDGIVDG----- 243
Cdd:PRK14559 520 LTVDHE-VGQ-------REIQRGVEPqiayaRPDAYQltQALGPrDNSAIQPDIQFLEIEEDTLLLLCSDGLSDNdllet 591
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*...
gi 182416375 244 LWDREIQEII--RAPAGEGpprsiAQQLVETAVQNSGRDNTTAIVLEM 289
Cdd:PRK14559 592 HWQTHLLPLLssSANLDQG-----LNKLIDLANQYNGHDNITAILVRL 634
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
27-288 2.59e-43

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 150.17  E-value: 2.59e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375  27 SGLTHVGRYRQNNEDTFLALHFDGHEvrylgktgeaslagTDFVFAVSDGMGGAKSGEFASRITVDRVTRLLPRGFRLSA 106
Cdd:cd00143    3 AGVSDKGGDRKTNEDAVVIKPNLNNE--------------DGGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSE 68
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375 107 AGLatgfQDLLVELFSAIHNDLLKLGFSYEECAGMGCTLSLCWLTPEWVQFGHIGDSRIYyLPHAGGMTQVTHDHTFVGK 186
Cdd:cd00143   69 EDI----EEALRKAFLRADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAV-LCRNGEAVQLTKDHKPVNE 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375 187 LRRKGEFNERQARTDPR---RNALQQALGAGNQF----IDPQVGAVGHHPGDRFLI-CSDGIVDGLWDREIQEIIRAPAG 258
Cdd:cd00143  144 EERERIEKAGGRVSNGRvpgVLAVTRALGDFDLKpgvsAEPDVTVVKLTEDDDFLIlASDGLWDVLSNQEAVDIVRSELA 223
                        250       260       270
                 ....*....|....*....|....*....|
gi 182416375 259 EGPPRSIAQQLVETAVQNSGRDNTTAIVLE 288
Cdd:cd00143  224 KEDLQEAAQELVDLALRRGSHDNITVVVVR 253
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
25-292 2.14e-55

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 182.17  E-value: 2.14e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375  25 RWSGLTHVGRYRQNNEDTFLALHFDGHEVRYLgktgeaslagtdfvFAVSDGMGGAKSGEFASRITVDRVTRLLPRGFRL 104
Cdd:COG0631    9 KVAGLSDVGTVRKHNEDAFLIKPNENGNLLLL--------------FAVADGMGGHAAGEVASKLAVEALARLFDETNFN 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375 105 SaagLATGFQDLLVELFSAIHNDLLKLGFSYEECAGMGCTLSLCWLTPEWVQFGHIGDSRIYYLpHAGGMTQVTHDHTFV 184
Cdd:COG0631   75 S---LNESLEELLKEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLL-RDGELKQLTEDHSLV 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375 185 GKLRRKGEFNERQARTDPRRNALQQALGaGNQFIDPQVGAVGHHPGDRFLICSDGIVDGLWDREIQEIIRapaGEGPPRS 264
Cdd:COG0631  151 NRLEQRGIITPEEARSHPRRNALTRALG-DFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILK---NSETPQE 226
                        250       260
                 ....*....|....*....|....*...
gi 182416375 265 IAQQLVETAVQNSGRDNTTAIVLEMLGS 292
Cdd:COG0631  227 AADKLIELALEGGGPDNITVVLVRLNGE 254
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
27-287 7.53e-25

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 100.14  E-value: 7.53e-25
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375    27 SGLTHVGRYRQNNEDTFLAlHFDGHEvrylgktgeaslagTDFVFAVSDGMGGAKSGEFASRITVDRVTRLLPrgfrlSA 106
Cdd:smart00332  11 YGLSSMQGVRKPMEDAHVI-TPDLSD--------------SGGFFGVFDGHGGSEAAKFLSKNLPEILAEELI-----KE 70
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375   107 AGLATGFQDLLVELFSAIHNDLLKlgfsyEECAGMGCTLSLCWLTPEWVQFGHIGDSRIYYLPhAGGMTQVTHDHTFVGK 186
Cdd:smart00332  71 KDELEDVEEALRKAFLSTDEEILE-----ELEALSGSTAVVALISGNKLYVANVGDSRAVLCR-NGKAVQLTEDHKPSNE 144
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375   187 LRRKgEFNERQARTDPRRNALQQALGA--GNQFIDPQVGAVGHH-------PGDRFLICSDGIVDGLWDREIQEIIRAPA 257
Cdd:smart00332 145 DERA-RIEAAGGFVINGRVNGVLALSRaiGDFFLKPYVSAEPDVtvvelteKDDFLILASDGLWDVLSNQEVVDIVRKHL 223
                          250       260       270
                   ....*....|....*....|....*....|
gi 182416375   258 gEGPPRSIAQQLVETAVQNSGRDNTTAIVL 287
Cdd:smart00332 224 -SKDPKEAAKRLIDLALARGSKDNITVVVV 252
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
70-269 1.60e-21

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 89.68  E-value: 1.60e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375   70 VFAVSDGMGGAKSGEFASRITVDRVTRLLprgfrlsAAGLATGFQDLLVELFSAIHNDLL-KLGFSYEECAG----MGCT 144
Cdd:pfam13672  26 LIAVADGAGSAKYSDVGARLAVEAAVEAL-------RELLDSGELPELEALVRQILNDILaLVRQEAAAQGLeprdYATT 98
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375  145 LSLCWLTPEWVQFGHIGDSRIYYLPHAGGMTQVTHDHtfvgklrrKGEF-NERQARTDPrrnalqqalgagNQFIDPQVG 223
Cdd:pfam13672  99 LLLAVITPGGIVFFQIGDGAIVVRDRDGELQLLSEPD--------SGEYaNETTFLTSP------------DALEEFRIR 158
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 182416375  224 AVGHHPGDRFLICSDGIVDGL-----WDREIQEIIRAPAGEGPPRSIAQQL 269
Cdd:pfam13672 159 RLTLEPGDALALMTDGLSDSLvteepFFPFFAPLLETLEEEGASEQLAEFL 209
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
27-282 6.59e-13

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 65.85  E-value: 6.59e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375   27 SGLTHVGRYRQNNEDTflalHFDGhevrylGKTGEASLAGTDFVFAVSDGMGGAKSGEFASRI--TVDRVTRLLPrGFRL 104
Cdd:pfam00481   3 VGGTRMQGWRKSMEDA----HIDG------KNLNSSSGKDSWSFFAVFDGHGGSEAAKYAGKHlhTILALRRSFL-TLRK 71
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375  105 SAAGLATGFQDLLVELFSAIHNdllklgfsyEECAGMGCTLSLCWLTPEWVQFGHIGDSRIYYLPHAGGMTQVTHDHTFV 184
Cdd:pfam00481  72 LEDALRESFLETDEELRSDAAN---------HEDLSSGSTAVVALIRGNKLYVANVGDSRAVLCRNGGAIKQLTEDHKPS 142
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375  185 GKLRRK------GEFNERQartdpRRN---ALQQALGAGnqFIDPQVGAVGHHP---------GDRFLI-CSDGIVDGLW 245
Cdd:pfam00481 143 DEDERRriraagGFVSRNG-----RVNgvlAVSRAFGDF--DLKPGEQPVSAEPditshkiteDDEFLIlACDGLWDVLS 215
                         250       260       270
                  ....*....|....*....|....*....|....*...
gi 182416375  246 DREIQEIIRAPAGEGP-PRSIAQQLVETAVQNSGRDNT 282
Cdd:pfam00481 216 DQEVVDIVRSNLSDGGdPMEAAEKLVDEAIAYGSEDNI 253
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
69-271 1.64e-09

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 55.05  E-value: 1.64e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375    69 FVFAVSDGMGGAKSGEFASRITVDRVTRLLPRGFRLSaaglatgfqDLLVELFSAIHNdllklgfsyEECAGMGCTLSLC 148
Cdd:smart00331  31 LLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLS---------QILERLNRAIYE---------NGEDGMFATLFLA 92
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375   149 WLTPE--WVQFGHIGDSRIYYLPHAGGMTQVTHDHTFVgklrrkgefnerqartdprrnalqqaLGAGNQFiDPQVGAVG 226
Cdd:smart00331  93 LYDFAggTLSYANAGHSPPYLLRADGGLVEDLDDLGAP--------------------------LGLEPDV-EVDVRELT 145
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*
gi 182416375   227 HHPGDRFLICSDGIVDGLWDREIQEIIRAPAGEgPPRSIAQQLVE 271
Cdd:smart00331 146 LEPGDLLLLYTDGLTEARNPERLEELLEELLGS-PPAEIAQRILE 189
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
27-289 3.14e-19

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 86.65  E-value: 3.14e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375  27 SGLTHVGRYRQNNEDTFLALHFDGHEVRYLGKTGEASlaGtdfVFAVSDGMGGAKSGEFASRITVDRVTRLLprgfrlsA 106
Cdd:PRK14559 378 AGRTDVGRQRHHNEDYFGINTRIQKLENPHGRIVQAR--G---LYILCDGMGGHAAGEVASALAVETLQQYF-------Q 445
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375 107 AGLATGFQD---------LLVELFSAIHNDLLKLGfsyeecAG-MGCTLSLCWLTPEWVQFGHIGDSRIYYLPHAGGMTQ 176
Cdd:PRK14559 446 QHWQDELPDeetireaiyLANEAIYDLNQQNARSG------SGrMGTTLVMALVQDTQVAVAHVGDSRLYRVTRKGGLEQ 519
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182416375 177 VTHDHTfVGKlrrkgefNERQARTDP-----RRNALQ--QALGA-GNQFIDPQVGAVGHHPGDRFLICSDGIVDG----- 243
Cdd:PRK14559 520 LTVDHE-VGQ-------REIQRGVEPqiayaRPDAYQltQALGPrDNSAIQPDIQFLEIEEDTLLLLCSDGLSDNdllet 591
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*...
gi 182416375 244 LWDREIQEII--RAPAGEGpprsiAQQLVETAVQNSGRDNTTAIVLEM 289
Cdd:PRK14559 592 HWQTHLLPLLssSANLDQG-----LNKLIDLANQYNGHDNITAILVRL 634
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH