NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|17978491|ref|NP_510966|]
View 

CD97 antigen isoform 1 preproprotein [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
209-245 1.10e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.56  E-value: 1.10e-07
                        10        20        30
                ....*....|....*....|....*....|....*..
gi 17978491 209 DVDECSSGqHQCDSSTVCFNTVGSYSCRCRPGWKPRH 245
Cdd:cd00054   1 DIDECASG-NPCQNGGTCVNTVGSYRCSCPPGYTGRN 36
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
116-148 1.65e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.17  E-value: 1.65e-07
                        10        20        30
                ....*....|....*....|....*....|...
gi 17978491 116 DVDECQQNPrLCKSYGTCVNTLGSYTCQCLPGF 148
Cdd:cd00054   1 DIDECASGN-PCQNGGTCVNTVGSYRCSCPPGY 32
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
160-193 4.62e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 47.63  E-value: 4.62e-07
                        10        20        30
                ....*....|....*....|....*....|....
gi 17978491 160 DVNECTSGqNPCHSSTHCLNNVGSYQCRCRPGWQ 193
Cdd:cd00054   1 DIDECASG-NPCQNGGTCVNTVGSYRCSCPPGYT 33
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
64-98 1.31e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 43.39  E-value: 1.31e-05
                        10        20        30
                ....*....|....*....|....*....|....*
gi 17978491  64 DINECATPSkvSCGKFSDCWNTEGSYDCVCSPGYE 98
Cdd:cd00054   1 DIDECASGN--PCQNGGTCVNTVGSYRCSCPPGYT 33
7tm_2 pfam00002
7 transmembrane receptor (Secretin family); This family is known as Family B, the ...
544-782 9.45e-81

7 transmembrane receptor (Secretin family); This family is known as Family B, the secretin-receptor family or family 2 of the G-protein-coupled receptors (GCPRs).They have been described in many animal species, but not in plants, fungi or prokaryotes. Three distinct sub-families are recognized. Subfamily B1 contains classical hormone receptors, such as receptors for secretin and glucagon, that are all involved in cAMP-mediated signalling pathways. Subfamily B2 contains receptors with long extracellular N-termini, such as the leukocyte cell-surface antigen CD97; calcium-independent receptors for latrotoxin, and brain-specific angiogenesis inhibitors amongst others. Subfamily B3 includes Methuselah and other Drosophila proteins. Other than the typical seven-transmembrane region, characteristic structural features include an amino-terminal extracellular domain involved in ligand binding, and an intracellular loop (IC3) required for specific G-protein coupling.


:

Pssm-ID: 249498  Cd Length: 239  Bit Score: 261.39  E-value: 9.45e-81
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491   544 DWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICLFVGSTIFLAGIENEGGQVGLR--CRLVAGLLHY 621
Cdd:pfam00002   1 ALLLKVIYTVGYSLSLVALLLAIAIFLLFRKLRCTRNYIHLNLFASFILRAILFLVGDAVLFNKVGSDcvCKVVAVFLHY 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491   622 CFLAAFCWMSLEGLELYFLVVRVFQGQGLSTRWLCLIGYGVPLLIVGVSAAIYsKGYGRPRyCWLDFEQGFLWSFLGPVT 701
Cdd:pfam00002  81 FFLANFFWMLVEGLYLYTLLVEVFFSERKYLWWYLLIGWGVPAVVVGIWAIVR-KGYGNEG-CWLSNNGGFWWIIKGPVL 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491   702 FIILCNAVIFVTTVWKLTQKFSeiNPDMKKLKKAR-ALTITAIAQLFLLGCTWVFGLFIFDDR-SLVLTYVFTILNCLQG 779
Cdd:pfam00002 159 LVILVNFIFFINIVRILVQKLR--SPDMGETDQYRkRLAKSTLVLLPLLGITWVLFLFAPNDDvSVVFLYLFAILNSFQG 236

                  ...
gi 17978491   780 AFL 782
Cdd:pfam00002 237 FFV 239
GPS pfam01825
Latrophilin/CL-1-like GPS domain; Domain present in latrophilin/CL-1, sea urchin REJ and ...
492-537 3.16e-13

Latrophilin/CL-1-like GPS domain; Domain present in latrophilin/CL-1, sea urchin REJ and polycystin.


:

Pssm-ID: 250896  Cd Length: 43  Bit Score: 65.84  E-value: 3.16e-13
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*.
gi 17978491   492 ELLCAFWKSDsdrGGHWATEGCQVLGSKNGSTTCQCSHLSSFAILM 537
Cdd:pfam01825   1 NPQCVFWDEG---TGGWSTDGCRVVSSNPTHTVCSCNHLTSFAVLM 43
 
Name Accession Description Interval E-value
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
209-245 1.10e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.56  E-value: 1.10e-07
                        10        20        30
                ....*....|....*....|....*....|....*..
gi 17978491 209 DVDECSSGqHQCDSSTVCFNTVGSYSCRCRPGWKPRH 245
Cdd:cd00054   1 DIDECASG-NPCQNGGTCVNTVGSYRCSCPPGYTGRN 36
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
116-148 1.65e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.17  E-value: 1.65e-07
                        10        20        30
                ....*....|....*....|....*....|...
gi 17978491 116 DVDECQQNPrLCKSYGTCVNTLGSYTCQCLPGF 148
Cdd:cd00054   1 DIDECASGN-PCQNGGTCVNTVGSYRCSCPPGY 32
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
160-193 4.62e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 47.63  E-value: 4.62e-07
                        10        20        30
                ....*....|....*....|....*....|....
gi 17978491 160 DVNECTSGqNPCHSSTHCLNNVGSYQCRCRPGWQ 193
Cdd:cd00054   1 DIDECASG-NPCQNGGTCVNTVGSYRCSCPPGYT 33
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
64-98 1.31e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 43.39  E-value: 1.31e-05
                        10        20        30
                ....*....|....*....|....*....|....*
gi 17978491  64 DINECATPSkvSCGKFSDCWNTEGSYDCVCSPGYE 98
Cdd:cd00054   1 DIDECASGN--PCQNGGTCVNTVGSYRCSCPPGYT 33
7tm_2 pfam00002
7 transmembrane receptor (Secretin family); This family is known as Family B, the ...
544-782 9.45e-81

7 transmembrane receptor (Secretin family); This family is known as Family B, the secretin-receptor family or family 2 of the G-protein-coupled receptors (GCPRs).They have been described in many animal species, but not in plants, fungi or prokaryotes. Three distinct sub-families are recognized. Subfamily B1 contains classical hormone receptors, such as receptors for secretin and glucagon, that are all involved in cAMP-mediated signalling pathways. Subfamily B2 contains receptors with long extracellular N-termini, such as the leukocyte cell-surface antigen CD97; calcium-independent receptors for latrotoxin, and brain-specific angiogenesis inhibitors amongst others. Subfamily B3 includes Methuselah and other Drosophila proteins. Other than the typical seven-transmembrane region, characteristic structural features include an amino-terminal extracellular domain involved in ligand binding, and an intracellular loop (IC3) required for specific G-protein coupling.


Pssm-ID: 249498  Cd Length: 239  Bit Score: 261.39  E-value: 9.45e-81
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491   544 DWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICLFVGSTIFLAGIENEGGQVGLR--CRLVAGLLHY 621
Cdd:pfam00002   1 ALLLKVIYTVGYSLSLVALLLAIAIFLLFRKLRCTRNYIHLNLFASFILRAILFLVGDAVLFNKVGSDcvCKVVAVFLHY 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491   622 CFLAAFCWMSLEGLELYFLVVRVFQGQGLSTRWLCLIGYGVPLLIVGVSAAIYsKGYGRPRyCWLDFEQGFLWSFLGPVT 701
Cdd:pfam00002  81 FFLANFFWMLVEGLYLYTLLVEVFFSERKYLWWYLLIGWGVPAVVVGIWAIVR-KGYGNEG-CWLSNNGGFWWIIKGPVL 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491   702 FIILCNAVIFVTTVWKLTQKFSeiNPDMKKLKKAR-ALTITAIAQLFLLGCTWVFGLFIFDDR-SLVLTYVFTILNCLQG 779
Cdd:pfam00002 159 LVILVNFIFFINIVRILVQKLR--SPDMGETDQYRkRLAKSTLVLLPLLGITWVLFLFAPNDDvSVVFLYLFAILNSFQG 236

                  ...
gi 17978491   780 AFL 782
Cdd:pfam00002 237 FFV 239
GPS pfam01825
Latrophilin/CL-1-like GPS domain; Domain present in latrophilin/CL-1, sea urchin REJ and ...
492-537 3.16e-13

Latrophilin/CL-1-like GPS domain; Domain present in latrophilin/CL-1, sea urchin REJ and polycystin.


Pssm-ID: 250896  Cd Length: 43  Bit Score: 65.84  E-value: 3.16e-13
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*.
gi 17978491   492 ELLCAFWKSDsdrGGHWATEGCQVLGSKNGSTTCQCSHLSSFAILM 537
Cdd:pfam01825   1 NPQCVFWDEG---TGGWSTDGCRVVSSNPTHTVCSCNHLTSFAVLM 43
GPS smart00303
G-protein-coupled receptor proteolytic site domain; Present in latrophilin/CL-1, sea urchin ...
492-542 5.48e-13

G-protein-coupled receptor proteolytic site domain; Present in latrophilin/CL-1, sea urchin REJ and polycystin.


Pssm-ID: 197639  Cd Length: 49  Bit Score: 65.10  E-value: 5.48e-13
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|.
gi 17978491    492 ELLCAFWKSDSdrgGHWATEGCQVLGSKNGSTTCQCSHLSSFAILMAHYDV 542
Cdd:smart00303   2 NPICVFWDESS---GEWSTRGCELLETNGTHTTCSCNHLTTFAVLMDVPPI 49
EGF_CA pfam07645
Calcium-binding EGF domain;
160-207 7.29e-12

Calcium-binding EGF domain;


Pssm-ID: 254326  Cd Length: 42  Bit Score: 61.59  E-value: 7.29e-12
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 17978491   160 DVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWqpipgsPNGPNNTVC 207
Cdd:pfam07645   1 DVDECADGTHNCPANTVCVNTIGSFECVCPDGY------ENNEDGTNC 42
EGF_CA pfam07645
Calcium-binding EGF domain;
209-243 3.56e-11

Calcium-binding EGF domain;


Pssm-ID: 254326  Cd Length: 42  Bit Score: 59.67  E-value: 3.56e-11
                          10        20        30
                  ....*....|....*....|....*....|....*
gi 17978491   209 DVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKP 243
Cdd:pfam07645   1 DVDECADGTHNCPANTVCVNTIGSFECVCPDGYEN 35
EGF_CA smart00179
Calcium-binding EGF-like domain;
116-148 9.72e-08

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 49.55  E-value: 9.72e-08
                           10        20        30
                   ....*....|....*....|....*....|...
gi 17978491    116 DVDECQQNPrLCKSYGTCVNTLGSYTCQCLPGF 148
Cdd:smart00179   1 DIDECASGN-PCQNGGTCVNTVGSYRCECPPGY 32
EGF_CA smart00179
Calcium-binding EGF-like domain;
160-193 1.31e-07

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 49.55  E-value: 1.31e-07
                           10        20        30
                   ....*....|....*....|....*....|....
gi 17978491    160 DVNECTSGqNPCHSSTHCLNNVGSYQCRCRPGWQ 193
Cdd:smart00179   1 DIDECASG-NPCQNGGTCVNTVGSYRCECPPGYT 33
EGF_CA smart00179
Calcium-binding EGF-like domain;
209-245 1.57e-07

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 49.17  E-value: 1.57e-07
                           10        20        30
                   ....*....|....*....|....*....|....*..
gi 17978491    209 DVDECSSGqHQCDSSTVCFNTVGSYSCRCRPGWKPRH 245
Cdd:smart00179   1 DIDECASG-NPCQNGGTCVNTVGSYRCECPPGYTDGR 36
EGF_CA pfam07645
Calcium-binding EGF domain;
64-99 7.64e-07

Calcium-binding EGF domain;


Pssm-ID: 254326  Cd Length: 42  Bit Score: 47.34  E-value: 7.64e-07
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 17978491    64 DINECATPSKVsCGKFSDCWNTEGSYDCVCSPGYEP 99
Cdd:pfam07645   1 DVDECADGTHN-CPANTVCVNTIGSFECVCPDGYEN 35
EGF_CA smart00179
Calcium-binding EGF-like domain;
64-98 2.59e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 45.70  E-value: 2.59e-06
                           10        20        30
                   ....*....|....*....|....*....|....*
gi 17978491     64 DINECATPSkvSCGKFSDCWNTEGSYDCVCSPGYE 98
Cdd:smart00179   1 DIDECASGN--PCQNGGTCVNTVGSYRCECPPGYT 33
EGF_CA pfam07645
Calcium-binding EGF domain;
116-158 5.75e-06

Calcium-binding EGF domain;


Pssm-ID: 254326  Cd Length: 42  Bit Score: 44.64  E-value: 5.75e-06
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|...
gi 17978491   116 DVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFkFIPEDPKVC 158
Cdd:pfam07645   1 DVDECADGTHNCPANTVCVNTIGSFECVCPDGY-ENNEDGTNC 42
Plasmod_Pvs28 pfam06247
Plasmodium ookinete surface protein Pvs28; This family consists of several ookinete surface ...
42-191 1.22e-06

Plasmodium ookinete surface protein Pvs28; This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium. Pvs25 and Pvs28 are expressed on the surface of ookinetes. These proteins are potential candidates for vaccine and induce antibodies that block the infectivity of Plasmodium vivax in immunised animals.


Pssm-ID: 253638 [Multi-domain]  Cd Length: 196  Bit Score: 48.59  E-value: 1.22e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491    42 CRCNPGFSSFSEiittptETCDDINECATPSKV--SCGKFSDCWNT-----EGSYDCVCSPGYEpvsgaktfknESENTC 114
Cdd:pfam06247  22 CKCNEGYVLKNE------NTCEEKVKCDKLENVnkVCGEYATCINQankaeEKALKCGCINGYT----------LSQGVC 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491   115 QdvdecqqnPRLCKSY----GTCV---NTLGSYTCQCLPGfkFIPEDPKVCTDVNEcTSGQNPCHSSTHCLNNVGSYQCR 187
Cdd:pfam06247  86 V--------PNKCNNKvcgsGKCIvdpANPNNTTCSCNIG--KVPDQNGKCTKTGE-TKCSLKCKENEECKLVGGYYECV 154

                  ....
gi 17978491   188 CRPG 191
Cdd:pfam06247 155 CKEG 158
ProP COG0477
Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino ...
608-785 6.95e-03

Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only]


Pssm-ID: 223553 [Multi-domain]  Cd Length: 338  Bit Score: 38.13  E-value: 6.95e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491 608 VGLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGqglstrwlcLIGYGVPLLIVGVSAAIYSKGYGRPRY-CWL 686
Cdd:COG0477  66 YGRRKVLIIGLLLFLLGTLLLALAPNVGLALLLILRLLQG---------LGGGGLLPVASALLSEWFPEATERGLAvGLV 136
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491 687 DFEQGFLWSFLGPVTFIILCNAV-----------IFVTTVWKLTQKFSEINPDMKKLKKARALTITAIAQLFLLGCTWVF 755
Cdd:COG0477 137 TLGAGALGLALGPLLAGLLLGALlwgwraafllaALLGLLLLILVLLLDLLLAAPRLPLAVGLALIELGKLLLLLLILLL 216
                       170       180       190
                ....*....|....*....|....*....|
gi 17978491 756 GLFIFddrsLVLTYVFTILNCLQGAFLYLL 785
Cdd:COG0477 217 GGLVL----LLLGLYLSAAGFGLRALLLGL 242
 
Name Accession Description Interval E-value
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
209-245 1.10e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.56  E-value: 1.10e-07
                        10        20        30
                ....*....|....*....|....*....|....*..
gi 17978491 209 DVDECSSGqHQCDSSTVCFNTVGSYSCRCRPGWKPRH 245
Cdd:cd00054   1 DIDECASG-NPCQNGGTCVNTVGSYRCSCPPGYTGRN 36
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
116-148 1.65e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.17  E-value: 1.65e-07
                        10        20        30
                ....*....|....*....|....*....|...
gi 17978491 116 DVDECQQNPrLCKSYGTCVNTLGSYTCQCLPGF 148
Cdd:cd00054   1 DIDECASGN-PCQNGGTCVNTVGSYRCSCPPGY 32
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
160-193 4.62e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 47.63  E-value: 4.62e-07
                        10        20        30
                ....*....|....*....|....*....|....
gi 17978491 160 DVNECTSGqNPCHSSTHCLNNVGSYQCRCRPGWQ 193
Cdd:cd00054   1 DIDECASG-NPCQNGGTCVNTVGSYRCSCPPGYT 33
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
64-98 1.31e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 43.39  E-value: 1.31e-05
                        10        20        30
                ....*....|....*....|....*....|....*
gi 17978491  64 DINECATPSkvSCGKFSDCWNTEGSYDCVCSPGYE 98
Cdd:cd00054   1 DIDECASGN--PCQNGGTCVNTVGSYRCSCPPGYT 33
7tm_2 pfam00002
7 transmembrane receptor (Secretin family); This family is known as Family B, the ...
544-782 9.45e-81

7 transmembrane receptor (Secretin family); This family is known as Family B, the secretin-receptor family or family 2 of the G-protein-coupled receptors (GCPRs).They have been described in many animal species, but not in plants, fungi or prokaryotes. Three distinct sub-families are recognized. Subfamily B1 contains classical hormone receptors, such as receptors for secretin and glucagon, that are all involved in cAMP-mediated signalling pathways. Subfamily B2 contains receptors with long extracellular N-termini, such as the leukocyte cell-surface antigen CD97; calcium-independent receptors for latrotoxin, and brain-specific angiogenesis inhibitors amongst others. Subfamily B3 includes Methuselah and other Drosophila proteins. Other than the typical seven-transmembrane region, characteristic structural features include an amino-terminal extracellular domain involved in ligand binding, and an intracellular loop (IC3) required for specific G-protein coupling.


Pssm-ID: 249498  Cd Length: 239  Bit Score: 261.39  E-value: 9.45e-81
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491   544 DWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICLFVGSTIFLAGIENEGGQVGLR--CRLVAGLLHY 621
Cdd:pfam00002   1 ALLLKVIYTVGYSLSLVALLLAIAIFLLFRKLRCTRNYIHLNLFASFILRAILFLVGDAVLFNKVGSDcvCKVVAVFLHY 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491   622 CFLAAFCWMSLEGLELYFLVVRVFQGQGLSTRWLCLIGYGVPLLIVGVSAAIYsKGYGRPRyCWLDFEQGFLWSFLGPVT 701
Cdd:pfam00002  81 FFLANFFWMLVEGLYLYTLLVEVFFSERKYLWWYLLIGWGVPAVVVGIWAIVR-KGYGNEG-CWLSNNGGFWWIIKGPVL 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491   702 FIILCNAVIFVTTVWKLTQKFSeiNPDMKKLKKAR-ALTITAIAQLFLLGCTWVFGLFIFDDR-SLVLTYVFTILNCLQG 779
Cdd:pfam00002 159 LVILVNFIFFINIVRILVQKLR--SPDMGETDQYRkRLAKSTLVLLPLLGITWVLFLFAPNDDvSVVFLYLFAILNSFQG 236

                  ...
gi 17978491   780 AFL 782
Cdd:pfam00002 237 FFV 239
GPS pfam01825
Latrophilin/CL-1-like GPS domain; Domain present in latrophilin/CL-1, sea urchin REJ and ...
492-537 3.16e-13

Latrophilin/CL-1-like GPS domain; Domain present in latrophilin/CL-1, sea urchin REJ and polycystin.


Pssm-ID: 250896  Cd Length: 43  Bit Score: 65.84  E-value: 3.16e-13
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*.
gi 17978491   492 ELLCAFWKSDsdrGGHWATEGCQVLGSKNGSTTCQCSHLSSFAILM 537
Cdd:pfam01825   1 NPQCVFWDEG---TGGWSTDGCRVVSSNPTHTVCSCNHLTSFAVLM 43
GPS smart00303
G-protein-coupled receptor proteolytic site domain; Present in latrophilin/CL-1, sea urchin ...
492-542 5.48e-13

G-protein-coupled receptor proteolytic site domain; Present in latrophilin/CL-1, sea urchin REJ and polycystin.


Pssm-ID: 197639  Cd Length: 49  Bit Score: 65.10  E-value: 5.48e-13
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|.
gi 17978491    492 ELLCAFWKSDSdrgGHWATEGCQVLGSKNGSTTCQCSHLSSFAILMAHYDV 542
Cdd:smart00303   2 NPICVFWDESS---GEWSTRGCELLETNGTHTTCSCNHLTTFAVLMDVPPI 49
EGF_CA pfam07645
Calcium-binding EGF domain;
160-207 7.29e-12

Calcium-binding EGF domain;


Pssm-ID: 254326  Cd Length: 42  Bit Score: 61.59  E-value: 7.29e-12
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 17978491   160 DVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWqpipgsPNGPNNTVC 207
Cdd:pfam07645   1 DVDECADGTHNCPANTVCVNTIGSFECVCPDGY------ENNEDGTNC 42
EGF_CA pfam07645
Calcium-binding EGF domain;
209-243 3.56e-11

Calcium-binding EGF domain;


Pssm-ID: 254326  Cd Length: 42  Bit Score: 59.67  E-value: 3.56e-11
                          10        20        30
                  ....*....|....*....|....*....|....*
gi 17978491   209 DVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKP 243
Cdd:pfam07645   1 DVDECADGTHNCPANTVCVNTIGSFECVCPDGYEN 35
EGF_CA smart00179
Calcium-binding EGF-like domain;
116-148 9.72e-08

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 49.55  E-value: 9.72e-08
                           10        20        30
                   ....*....|....*....|....*....|...
gi 17978491    116 DVDECQQNPrLCKSYGTCVNTLGSYTCQCLPGF 148
Cdd:smart00179   1 DIDECASGN-PCQNGGTCVNTVGSYRCECPPGY 32
EGF_CA smart00179
Calcium-binding EGF-like domain;
160-193 1.31e-07

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 49.55  E-value: 1.31e-07
                           10        20        30
                   ....*....|....*....|....*....|....
gi 17978491    160 DVNECTSGqNPCHSSTHCLNNVGSYQCRCRPGWQ 193
Cdd:smart00179   1 DIDECASG-NPCQNGGTCVNTVGSYRCECPPGYT 33
EGF_CA smart00179
Calcium-binding EGF-like domain;
209-245 1.57e-07

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 49.17  E-value: 1.57e-07
                           10        20        30
                   ....*....|....*....|....*....|....*..
gi 17978491    209 DVDECSSGqHQCDSSTVCFNTVGSYSCRCRPGWKPRH 245
Cdd:smart00179   1 DIDECASG-NPCQNGGTCVNTVGSYRCECPPGYTDGR 36
EGF_CA pfam07645
Calcium-binding EGF domain;
64-99 7.64e-07

Calcium-binding EGF domain;


Pssm-ID: 254326  Cd Length: 42  Bit Score: 47.34  E-value: 7.64e-07
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 17978491    64 DINECATPSKVsCGKFSDCWNTEGSYDCVCSPGYEP 99
Cdd:pfam07645   1 DVDECADGTHN-CPANTVCVNTIGSFECVCPDGYEN 35
EGF_CA smart00179
Calcium-binding EGF-like domain;
64-98 2.59e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 45.70  E-value: 2.59e-06
                           10        20        30
                   ....*....|....*....|....*....|....*
gi 17978491     64 DINECATPSkvSCGKFSDCWNTEGSYDCVCSPGYE 98
Cdd:smart00179   1 DIDECASGN--PCQNGGTCVNTVGSYRCECPPGYT 33
EGF_CA pfam07645
Calcium-binding EGF domain;
116-158 5.75e-06

Calcium-binding EGF domain;


Pssm-ID: 254326  Cd Length: 42  Bit Score: 44.64  E-value: 5.75e-06
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|...
gi 17978491   116 DVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFkFIPEDPKVC 158
Cdd:pfam07645   1 DVDECADGTHNCPANTVCVNTIGSFECVCPDGY-ENNEDGTNC 42
ABC2_membrane_4 pfam12730
ABC-2 family transporter protein; This family is related to the ABC-2 membrane transporter ...
654-789 7.76e-06

ABC-2 family transporter protein; This family is related to the ABC-2 membrane transporter family pfam01061.


Pssm-ID: 257255  Cd Length: 230  Bit Score: 46.60  E-value: 7.76e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491   654 WLCLIgygVPLLIVGVSAAIYSKGYGRPRYCWLDFEQGFLW--SFLGPVTFIILCNAVI---FVTTVWKLTqkFSeINPD 728
Cdd:pfam12730  14 LLLLI---LPLLLALLALLLFGLNIGTLLSSSSLLLSSFSFllALFLPLLIAILASLLVsreFKNGTIKLL--LS-LPIS 87
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 17978491   729 MKKLKKARALT---ITAIAQLFLLGCTWVFGLFI-FDDRSLVLTYVFTILNCLQGAFLYLLHCLL 789
Cdd:pfam12730  88 RKKIFLAKLLVlliLSLLASLLLLLLSLIAGLLLgGSGFSLSLLLGALLLLLLLSLLALLLILLI 152
EGF cd00053
Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large ...
119-148 3.22e-04

Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium.


Pssm-ID: 238010  Cd Length: 36  Bit Score: 39.38  E-value: 3.22e-04
                        10        20        30
                ....*....|....*....|....*....|
gi 17978491 119 ECQQnPRLCKSYGTCVNTLGSYTCQCLPGF 148
Cdd:cd00053   1 ECAA-SNPCSNGGTCVNTPGSYRCVCPPGY 29
Yip1 pfam04893
Yip1 domain; The Yip1 integral membrane domain contains four transmembrane alpha helices. The ...
588-750 3.51e-04

Yip1 domain; The Yip1 integral membrane domain contains four transmembrane alpha helices. The domain is characterized by the motifs DLYGP and GY. The Yip1 protein is a golgi protein involved in vesicular transport that interacts with GTPases.


Pssm-ID: 252862  Cd Length: 171  Bit Score: 40.88  E-value: 3.51e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491   588 ICLFVGSTIFLAGIENEGGQVGLRCRLVAGLLHYCFLAAFCWMSLEGLeLYFLVVRVFQGQGLSTRWLCLIGYG-VPLLI 666
Cdd:pfam04893  34 LLGLLLSLLLGWLLGSGETIQKLTGGSALGSIIGGYLGLLLGLFLLAL-LLHLIAKLFGGTGSFKQTLSLVGYAlLPLIL 112
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491   667 VGVSAAIYSkgYGRPRYCWLDFEQGFLWSflgpvtFIILCNAVIFVTtvwkltqkfseinpdmkKLKKARALTITAIAQL 746
Cdd:pfam04893 113 GGLIAIVLS--LLLGALLLLVGLLALIWS------LYLLYLGLKAAH-----------------GLSKLKALLVALLLFL 167

                  ....
gi 17978491   747 FLLG 750
Cdd:pfam04893 168 LLIV 171
EGF cd00053
Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large ...
163-193 4.78e-04

Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium.


Pssm-ID: 238010  Cd Length: 36  Bit Score: 39.00  E-value: 4.78e-04
                        10        20        30
                ....*....|....*....|....*....|.
gi 17978491 163 ECTSgQNPCHSSTHCLNNVGSYQCRCRPGWQ 193
Cdd:cd00053   1 ECAA-SNPCSNGGTCVNTPGSYRCVCPPGYT 30
cEGF pfam12662
Complement Clr-like EGF-like; cEGF, or complement Clr-like EGF, domains have six conserved ...
139-163 1.14e-03

Complement Clr-like EGF-like; cEGF, or complement Clr-like EGF, domains have six conserved cysteine residues disulfide-bonded into the characteristic pattern 'ababcc'. They are found in blood coagulation proteins such as fibrillin, Clr and Cls, thrombomodulin, and the LDL receptor. The core fold of the EGF domain consists of two small beta-hairpins packed against each other. Two major structural variants have been identified based on the structural context of the C-terminal cysteine residue of disulfide 'c' in the C-terminal hairpin: hEGFs and cEGFs. In cEGFs the C-terminal thiol resides on the C-terminal beta-sheet, resulting in long loop-lengths between the cysteine residues of disulfide 'c', typically C[10+]XC. These longer loop-lengths may have arisen by selective cysteine loss from a four-disulfide EGF template such as laminin or integrin. Tandem cEGF domains have five linking residues between terminal cysteines of adjacent domains. cEGF domains may or may not bind calcium in the linker region. cEGF domains with the consensus motif CXN4X[F,Y]XCXC are hydroxylated exclusively on the asparagine residue.


Pssm-ID: 257201  Cd Length: 24  Bit Score: 37.82  E-value: 1.14e-03
                          10        20
                  ....*....|....*....|....*
gi 17978491   139 SYTCQCLPGFKFIPeDPKVCTDVNE 163
Cdd:pfam12662   1 SYTCSCPPGYQLSG-DGRTCEDIDE 24
EGF_3 pfam12947
EGF domain; This family includes a variety of EGF-like domain homologues. This family includes ...
213-240 1.93e-03

EGF domain; This family includes a variety of EGF-like domain homologues. This family includes the C-terminal domain of the malaria parasite MSP1 protein.


Pssm-ID: 257421  Cd Length: 36  Bit Score: 37.13  E-value: 1.93e-03
                          10        20
                  ....*....|....*....|....*...
gi 17978491   213 CSSGQHQCDSSTVCFNTVGSYSCRCRPG 240
Cdd:pfam12947   1 CSENNGGCHPNATCTNTGGSFTCTCKSG 28
vWA_Matrilin cd01475
VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and ...
204-242 1.96e-03

VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity. Some members of the matrilin family are expressed specifically in developing cartilage rudiments. The matrilin family consists of at least four members. All the members of the matrilin family contain VWA domains, EGF-like domains and a heptad repeat coiled-coiled domain at the carboxy terminus which is responsible for the oligomerization of the matrilins. The VWA domains have been shown to be essential for matrilin network formation by interacting with matrix ligands.


Pssm-ID: 238752 [Multi-domain]  Cd Length: 224  Bit Score: 39.29  E-value: 1.96e-03
                        10        20        30
                ....*....|....*....|....*....|....*....
gi 17978491 204 NTVCEDVDECSSGQHQCDSstVCFNTVGSYSCRCRPGWK 242
Cdd:cd01475 181 GKICVVPDLCATLSHVCQQ--VCISTPGSYLCACTEGYA 217
EGF cd00053
Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large ...
212-245 3.19e-03

Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium.


Pssm-ID: 238010  Cd Length: 36  Bit Score: 36.30  E-value: 3.19e-03
                        10        20        30
                ....*....|....*....|....*....|....
gi 17978491 212 ECSSgQHQCDSSTVCFNTVGSYSCRCRPGWKPRH 245
Cdd:cd00053   1 ECAA-SNPCSNGGTCVNTPGSYRCVCPPGYTGDR 33
EGF_3 pfam12947
EGF domain; This family includes a variety of EGF-like domain homologues. This family includes ...
120-149 4.55e-03

EGF domain; This family includes a variety of EGF-like domain homologues. This family includes the C-terminal domain of the malaria parasite MSP1 protein.


Pssm-ID: 257421  Cd Length: 36  Bit Score: 35.98  E-value: 4.55e-03
                          10        20        30
                  ....*....|....*....|....*....|
gi 17978491   120 CQQNPRLCKSYGTCVNTLGSYTCQCLPGFK 149
Cdd:pfam12947   1 CSENNGGCHPNATCTNTGGSFTCTCKSGYT 30
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
120-149 5.91e-03

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 249503  Cd Length: 32  Bit Score: 35.48  E-value: 5.91e-03
                          10        20        30
                  ....*....|....*....|....*....|
gi 17978491   120 CQQNPRlCKSYGTCVNTLGSYTCQCLPGFK 149
Cdd:pfam00008   1 CSPNNP-CSNGGTCVDTPGGYTCECPPGYT 29
Plasmod_Pvs28 pfam06247
Plasmodium ookinete surface protein Pvs28; This family consists of several ookinete surface ...
42-191 1.22e-06

Plasmodium ookinete surface protein Pvs28; This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium. Pvs25 and Pvs28 are expressed on the surface of ookinetes. These proteins are potential candidates for vaccine and induce antibodies that block the infectivity of Plasmodium vivax in immunised animals.


Pssm-ID: 253638 [Multi-domain]  Cd Length: 196  Bit Score: 48.59  E-value: 1.22e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491    42 CRCNPGFSSFSEiittptETCDDINECATPSKV--SCGKFSDCWNT-----EGSYDCVCSPGYEpvsgaktfknESENTC 114
Cdd:pfam06247  22 CKCNEGYVLKNE------NTCEEKVKCDKLENVnkVCGEYATCINQankaeEKALKCGCINGYT----------LSQGVC 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491   115 QdvdecqqnPRLCKSY----GTCV---NTLGSYTCQCLPGfkFIPEDPKVCTDVNEcTSGQNPCHSSTHCLNNVGSYQCR 187
Cdd:pfam06247  86 V--------PNKCNNKvcgsGKCIvdpANPNNTTCSCNIG--KVPDQNGKCTKTGE-TKCSLKCKENEECKLVGGYYECV 154

                  ....
gi 17978491   188 CRPG 191
Cdd:pfam06247 155 CKEG 158
Plasmod_Pvs28 pfam06247
Plasmodium ookinete surface protein Pvs28; This family consists of several ookinete surface ...
87-240 1.19e-04

Plasmodium ookinete surface protein Pvs28; This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium. Pvs25 and Pvs28 are expressed on the surface of ookinetes. These proteins are potential candidates for vaccine and induce antibodies that block the infectivity of Plasmodium vivax in immunised animals.


Pssm-ID: 253638 [Multi-domain]  Cd Length: 196  Bit Score: 42.81  E-value: 1.19e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491    87 GSYDCVCSPGYEPVSgaktfknesENTCQDVDECQQNPRL---CKSYGTCVNTLG-----SYTCQCLPGFKFIPED--PK 156
Cdd:pfam06247  18 NHFECKCNEGYVLKN---------ENTCEEKVKCDKLENVnkvCGEYATCINQANkaeekALKCGCINGYTLSQGVcvPN 88
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491   157 VCTDVnECTSGQnpchssthCL---NNVGSYQCRCRPGwqpipgspngpnnTVCEDVDECS-SGQHQC----DSSTVCFN 228
Cdd:pfam06247  89 KCNNK-VCGSGK--------CIvdpANPNNTTCSCNIG-------------KVPDQNGKCTkTGETKCslkcKENEECKL 146
                         170
                  ....*....|..
gi 17978491   229 TVGSYSCRCRPG 240
Cdd:pfam06247 147 VGGYYECVCKEG 158
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
586-788 1.61e-04

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 42.68  E-value: 1.61e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491   586 LCICLFVG--STIFLAGIENEGGQVGlrCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGQGLSTR---------- 653
Cdd:pfam00001  25 LLFLLTLPpwALYYLVGGDWPFGDAL--CKLVGFLFVVNGYASILLLTAISIDRYLAIVHPLRYRRIRTPrrakvlilvv 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491   654 WLCLIGYGVPLLIVGVSaaiYSKGYGRPRYCWLDFEQG----------FLWSFLGPVTFIILCNAVIFVtTVWKLTQKFS 723
Cdd:pfam00001 103 WVLALLLSLPPLLFSWL---RTVEEGNVTTCLIDFPEEstlrsytllsTLLGFVLPLLVILVCYTLILR-TLRKRARSGA 178
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 17978491   724 EINPDMKKLKKARALTITAIAQLFLLGCTWvFGLFIFddrSLVLTYVFTILNCLQGAFLYLLHCL 788
Cdd:pfam00001 179 SQARAKRSSSKERKAAKMLLVVVVVFVLCW-LPYHIV---LLLDSLCPLSIIRLLPTALLITLWL 239
ProP COG0477
Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino ...
608-785 6.95e-03

Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only]


Pssm-ID: 223553 [Multi-domain]  Cd Length: 338  Bit Score: 38.13  E-value: 6.95e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491 608 VGLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGqglstrwlcLIGYGVPLLIVGVSAAIYSKGYGRPRY-CWL 686
Cdd:COG0477  66 YGRRKVLIIGLLLFLLGTLLLALAPNVGLALLLILRLLQG---------LGGGGLLPVASALLSEWFPEATERGLAvGLV 136
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17978491 687 DFEQGFLWSFLGPVTFIILCNAV-----------IFVTTVWKLTQKFSEINPDMKKLKKARALTITAIAQLFLLGCTWVF 755
Cdd:COG0477 137 TLGAGALGLALGPLLAGLLLGALlwgwraafllaALLGLLLLILVLLLDLLLAAPRLPLAVGLALIELGKLLLLLLILLL 216
                       170       180       190
                ....*....|....*....|....*....|
gi 17978491 756 GLFIFddrsLVLTYVFTILNCLQGAFLYLL 785
Cdd:COG0477 217 GGLVL----LLLGLYLSAAGFGLRALLLGL 242
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH