NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|17647377|ref|NP_524043.1|]
View 

eukaryotic initiation factor 2beta [Drosophila melanogaster]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
eIF-5_eIF-2B pfam01873
Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of ...
167-289 1.13e-64

Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of eIF-2 beta. This region corresponds to the whole of the archaebacterial eIF-2 beta homologue. The region contains a putative zinc binding C4 finger.


:

Pssm-ID: 250931  Cd Length: 125  Bit Score: 202.17  E-value: 1.13e-64
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17647377   167 LDKNPDMAAGRKPKFVMRPPQVLRVGTKKTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGSMDGNQQLIIKGRFQPKQI 246
Cdd:pfam01873   3 FNQNPDRVAGDKFRFEMPPPQVKIEGKIKTIIVNFSDIAKALNRPPEHLLKYLLAELGTQGSIDGKGRLIVNGRFTPKKL 82
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 17647377   247 ENVLRRYIKEYVTCHTCRSPETILQKDTRLFFLQCESCGSRCS 289
Cdd:pfam01873  83 QDVLDDYIKEYVLCHECKSPDTELIKENRLIFLKCKACGARRP 125
 
Name Accession Description Interval E-value
eIF-5_eIF-2B pfam01873
Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of ...
167-289 1.13e-64

Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of eIF-2 beta. This region corresponds to the whole of the archaebacterial eIF-2 beta homologue. The region contains a putative zinc binding C4 finger.


Pssm-ID: 250931  Cd Length: 125  Bit Score: 202.17  E-value: 1.13e-64
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17647377   167 LDKNPDMAAGRKPKFVMRPPQVLRVGTKKTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGSMDGNQQLIIKGRFQPKQI 246
Cdd:pfam01873   3 FNQNPDRVAGDKFRFEMPPPQVKIEGKIKTIIVNFSDIAKALNRPPEHLLKYLLAELGTQGSIDGKGRLIVNGRFTPKKL 82
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 17647377   247 ENVLRRYIKEYVTCHTCRSPETILQKDTRLFFLQCESCGSRCS 289
Cdd:pfam01873  83 QDVLDDYIKEYVLCHECKSPDTELIKENRLIFLKCKACGARRP 125
eIF2B_5 smart00653
domain present in translation initiation factor eIF2B and eIF5;
178-287 3.43e-63

domain present in translation initiation factor eIF2B and eIF5;


Pssm-ID: 214764  Cd Length: 110  Bit Score: 197.47  E-value: 3.43e-63
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17647377    178 KPKFVMRPPQVLRVGTKKTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGSMDGNQQLIIKGRFQPKQIENVLRRYIKEY 257
Cdd:smart00653   1 FYRFKMPPPQVLREGKGKTVIVNFADIAKALNRPPDHVLKFLLAELGTQGSIDGKGRLIVNGRFTPKKLQDLLRRYIKEY 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 17647377    258 VTCHTCRSPETILQKDTRLFFLQCESCGSR 287
Cdd:smart00653  81 VLCPECGSPDTELIKENRLFFLKCEACGAR 110
GCD7 COG1601
Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain ...
149-303 5.80e-46

Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain [Translation, ribosomal structure and biogenesis];


Pssm-ID: 224517  Cd Length: 151  Bit Score: 154.44  E-value: 5.80e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17647377 149 SDRDYTYDELLKRVFeiilDKNPDMAAGRKPKFVMRPPQVLRVGtKKTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGS 228
Cdd:COG1601   2 SEMEDDYEELLERAY----SELPEKEVKNDERFRIPEPEINREG-NRTIIRNFGDIAEALNRDPEHLVKFLKKELGTAGS 76
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 17647377 229 MDGNQQLIIKGRFQPKQIENVLRRYIKEYVTCHTCRSPETILQKDTRLFFLQCESCGSRCSVASIKSGFQAVTGK 303
Cdd:COG1601  77 IDGKGRLVLQGKFSDSEIVNEIERYIAEYVKCKECGSPDTELIKEERLLFLKCEACGAIRPVKLMKEYNLDFVSA 151
PRK03988 PRK03988
translation initiation factor IF-2 subunit beta; Validated
152-293 2.31e-41

translation initiation factor IF-2 subunit beta; Validated


Pssm-ID: 235189  Cd Length: 138  Bit Score: 141.97  E-value: 2.31e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17647377  152 DYTYDELLKRVFEIILDKnpdmaAGRKPKFVMRPPQVLRVGTKkTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGSMDG 231
Cdd:PRK03988   4 YYDYEELLDRAYEKLPEK-----VFKESRFEVPKPDVRIEGNR-TIIRNFKEIADRLNRDPKHVAKFLLKELGTAGNIEG 77
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 17647377  232 NQqLIIKGRFQPKQIENVLRRYIKEYVTCHTCRSPETILQKDTRLFFLQCESCGSRCSVASI 293
Cdd:PRK03988  78 GR-LILQGKFSPRVINEKIDRYVKEYVICPECGSPDTKLIKEGRIWVLKCEACGAETPVKPL 138
aIF-2beta TIGR00311
translation initiation factor aIF-2, beta subunit, putative; The trusted cutoff is set high ...
155-293 3.69e-25

translation initiation factor aIF-2, beta subunit, putative; The trusted cutoff is set high enough to select only archaeal members. The suggested cutoff is set to include most eukaryotic members but largely exclude the related eIF-5. [Protein synthesis, Translation factors]


Pssm-ID: 129411  Cd Length: 133  Bit Score: 98.38  E-value: 3.69e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17647377   155 YDELLKRVFEIILDKNPDmaagrKPKFVMRPPQVLRVGTKkTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGSMDGNQq 234
Cdd:TIGR00311   2 YEKLLERAIDQLPDEVFE-----TKRFEVPKAYIVIEGNR-TIIQNFREVAKALNRDEQHLLKYLLKELGTAGNLEGGR- 74
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 17647377   235 LIIKGRFQPKQIENVLRRYIKEYVTCHTCRSPETILQKDTRLFFLQCESCGSRCSVASI 293
Cdd:TIGR00311  75 LILQGKFTHFLLNERIEDYVRKYVICRECNRPDTRIIKEGRVSLLKCEACGAKAPLRNI 133
PRK12336 PRK12336
translation initiation factor IF-2 subunit beta; Provisional
153-295 3.58e-31

translation initiation factor IF-2 subunit beta; Provisional


Pssm-ID: 183451 [Multi-domain]  Cd Length: 201  Bit Score: 116.58  E-value: 3.58e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17647377  153 YTYDELLKRVFEIIldknPDMAAGRKpKFVMRPPQVLRVGtKKTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGSMDGN 232
Cdd:PRK12336   1 MDYESLLDRAMEVL----PEPTKSGE-RFSIPEPKIFIEG-KTTILTNFGEIADALNRDPDHLMKFLQRELGTAGKIEGG 74
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 17647377  233 QqLIIKGRFQPKQIENVLRRYIKEYVTCHTCRSPETILQKDTRLFFLQCESCGSRCSVASIKS 295
Cdd:PRK12336  75 R-AVFNGKFTEEDIQAAIDAYVDEYVICSECGLPDTRLVKEDRVLMLRCDACGAHRPVKKRKA 136
 
Name Accession Description Interval E-value
eIF-5_eIF-2B pfam01873
Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of ...
167-289 1.13e-64

Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of eIF-2 beta. This region corresponds to the whole of the archaebacterial eIF-2 beta homologue. The region contains a putative zinc binding C4 finger.


Pssm-ID: 250931  Cd Length: 125  Bit Score: 202.17  E-value: 1.13e-64
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17647377   167 LDKNPDMAAGRKPKFVMRPPQVLRVGTKKTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGSMDGNQQLIIKGRFQPKQI 246
Cdd:pfam01873   3 FNQNPDRVAGDKFRFEMPPPQVKIEGKIKTIIVNFSDIAKALNRPPEHLLKYLLAELGTQGSIDGKGRLIVNGRFTPKKL 82
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 17647377   247 ENVLRRYIKEYVTCHTCRSPETILQKDTRLFFLQCESCGSRCS 289
Cdd:pfam01873  83 QDVLDDYIKEYVLCHECKSPDTELIKENRLIFLKCKACGARRP 125
eIF2B_5 smart00653
domain present in translation initiation factor eIF2B and eIF5;
178-287 3.43e-63

domain present in translation initiation factor eIF2B and eIF5;


Pssm-ID: 214764  Cd Length: 110  Bit Score: 197.47  E-value: 3.43e-63
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17647377    178 KPKFVMRPPQVLRVGTKKTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGSMDGNQQLIIKGRFQPKQIENVLRRYIKEY 257
Cdd:smart00653   1 FYRFKMPPPQVLREGKGKTVIVNFADIAKALNRPPDHVLKFLLAELGTQGSIDGKGRLIVNGRFTPKKLQDLLRRYIKEY 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 17647377    258 VTCHTCRSPETILQKDTRLFFLQCESCGSR 287
Cdd:smart00653  81 VLCPECGSPDTELIKENRLFFLKCEACGAR 110
GCD7 COG1601
Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain ...
149-303 5.80e-46

Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain [Translation, ribosomal structure and biogenesis];


Pssm-ID: 224517  Cd Length: 151  Bit Score: 154.44  E-value: 5.80e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17647377 149 SDRDYTYDELLKRVFeiilDKNPDMAAGRKPKFVMRPPQVLRVGtKKTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGS 228
Cdd:COG1601   2 SEMEDDYEELLERAY----SELPEKEVKNDERFRIPEPEINREG-NRTIIRNFGDIAEALNRDPEHLVKFLKKELGTAGS 76
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 17647377 229 MDGNQQLIIKGRFQPKQIENVLRRYIKEYVTCHTCRSPETILQKDTRLFFLQCESCGSRCSVASIKSGFQAVTGK 303
Cdd:COG1601  77 IDGKGRLVLQGKFSDSEIVNEIERYIAEYVKCKECGSPDTELIKEERLLFLKCEACGAIRPVKLMKEYNLDFVSA 151
PRK03988 PRK03988
translation initiation factor IF-2 subunit beta; Validated
152-293 2.31e-41

translation initiation factor IF-2 subunit beta; Validated


Pssm-ID: 235189  Cd Length: 138  Bit Score: 141.97  E-value: 2.31e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17647377  152 DYTYDELLKRVFEIILDKnpdmaAGRKPKFVMRPPQVLRVGTKkTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGSMDG 231
Cdd:PRK03988   4 YYDYEELLDRAYEKLPEK-----VFKESRFEVPKPDVRIEGNR-TIIRNFKEIADRLNRDPKHVAKFLLKELGTAGNIEG 77
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 17647377  232 NQqLIIKGRFQPKQIENVLRRYIKEYVTCHTCRSPETILQKDTRLFFLQCESCGSRCSVASI 293
Cdd:PRK03988  78 GR-LILQGKFSPRVINEKIDRYVKEYVICPECGSPDTKLIKEGRIWVLKCEACGAETPVKPL 138
aIF-2beta TIGR00311
translation initiation factor aIF-2, beta subunit, putative; The trusted cutoff is set high ...
155-293 3.69e-25

translation initiation factor aIF-2, beta subunit, putative; The trusted cutoff is set high enough to select only archaeal members. The suggested cutoff is set to include most eukaryotic members but largely exclude the related eIF-5. [Protein synthesis, Translation factors]


Pssm-ID: 129411  Cd Length: 133  Bit Score: 98.38  E-value: 3.69e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17647377   155 YDELLKRVFEIILDKNPDmaagrKPKFVMRPPQVLRVGTKkTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGSMDGNQq 234
Cdd:TIGR00311   2 YEKLLERAIDQLPDEVFE-----TKRFEVPKAYIVIEGNR-TIIQNFREVAKALNRDEQHLLKYLLKELGTAGNLEGGR- 74
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 17647377   235 LIIKGRFQPKQIENVLRRYIKEYVTCHTCRSPETILQKDTRLFFLQCESCGSRCSVASI 293
Cdd:TIGR00311  75 LILQGKFTHFLLNERIEDYVRKYVICRECNRPDTRIIKEGRVSLLKCEACGAKAPLRNI 133
PRK12336 PRK12336
translation initiation factor IF-2 subunit beta; Provisional
153-295 3.58e-31

translation initiation factor IF-2 subunit beta; Provisional


Pssm-ID: 183451 [Multi-domain]  Cd Length: 201  Bit Score: 116.58  E-value: 3.58e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17647377  153 YTYDELLKRVFEIIldknPDMAAGRKpKFVMRPPQVLRVGtKKTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGSMDGN 232
Cdd:PRK12336   1 MDYESLLDRAMEVL----PEPTKSGE-RFSIPEPKIFIEG-KTTILTNFGEIADALNRDPDHLMKFLQRELGTAGKIEGG 74
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 17647377  233 QqLIIKGRFQPKQIENVLRRYIKEYVTCHTCRSPETILQKDTRLFFLQCESCGSRCSVASIKS 295
Cdd:PRK12336  75 R-AVFNGKFTEEDIQAAIDAYVDEYVICSECGLPDTRLVKEDRVLMLRCDACGAHRPVKKRKA 136
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH