NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|17539092|ref|NP_502513|]
View 

Protein C39E9.10 [Caenorhabditis elegans]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
11-413 1.33e-27

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


:

Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 112.02  E-value: 1.33e-27
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092  11 VTALFVVNLLNYVDRYTVAGVLTQVQTYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLG 90
Cdd:cd06174   1 LLLLFLGFFLSGLDRGLLSPALPLLAEDLGLSASQAGLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092  91 SSFvpANHFWLFLVLRSFVGIGEASYSNVAPSLISDMFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTGhWQWGIR 170
Cdd:cd06174  81 LAF--ASSLWLLLVGRFLLGLGGGALYPAAAALIAEWFPPKERGRALGLFSAGFGLGALLGPLLGGLLAESLG-WRWLFL 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 171 VSAIAGLIVMIALVLFtyepergaadkamgeskdvvvttnttyledlvillkTPTLVACTWGYTALVFVSGTLSWWEPTV 250
Cdd:cd06174 158 ILAILGLLLALLLLFL------------------------------------LRLLLLLALAFFLLSFGYYGLLTYLPLY 201
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 251 IQHLTAWHQGlndtkdlastdkdrVALYFGAITTAGGLIGVIFGSMLSKWLVagwgpfrrlqtdRAQPLVAGGGALLAAP 330
Cdd:cd06174 202 LQEVLGLSAA--------------EAGLLLSLFGLGGILGALLGGLLSDRLG------------RRRLLLLIGLLLAALG 255
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 331 FLLIGMIFGDKSLVLLYIMIFFGITFMcfnWGLNIDMLTTVIHPNRRSTAFSYFVLVSHLFGdASGPYLIGLISDAIRHG 410
Cdd:cd06174 256 LLLLALAPSLALLLVALLLLGFGLGFA---FPALLTLASELAPPEARGTASGLFNTFGSLGG-ALGPLLAGLLLDTGGYG 331

                ...
gi 17539092 411 STY 413
Cdd:cd06174 332 GVF 334
MFS_1 pfam07690
Major Facilitator Superfamily;
14-390 1.45e-25

Major Facilitator Superfamily;


:

Pssm-ID: 254360 [Multi-domain]  Cd Length: 346  Bit Score: 105.96  E-value: 1.45e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    14 LFVVNLLNYVDRYTVAGVLTQ-VQTYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLGSS 92
Cdd:pfam07690   1 LFLAAFLAGLGRSLLGPALPLyLAEDLGISPTEIGLLLTAFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLLLLL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    93 FvpANHFWLFLVLRSFVGIGEASYSNVAPSLISDMFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTGhWQWGIRVS 172
Cdd:pfam07690  81 F--ASSLWLLLVLRVLQGLGGGALFPAAAALIADWFPPEERGRALGLLSAGFGLGAALGPLLGGLLASLFG-WRAAFLIL 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   173 AIAGLIVMIALVLFTYEPERGAADKAMGESKDVVVTTNTTYledlvilLKTPTLVACTWGYTALVFVSGTLSWWEPTVIQ 252
Cdd:pfam07690 158 AILALLAAVLAALLLPRPPPESKRPKPAEEAPAPLLPAWKL-------LLRDPVLWLLLALLLFGFAFFALLTYLPLYQE 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   253 HLtawhqGLNDTkdlastdkdrVALYFGAITTAGGLIGVIFGSMLSKWLvagwgpfrrlqtDRAQPLVAGGGALLAAPFL 332
Cdd:pfam07690 231 VL-----GLSAL----------LAGLLLGLAGLLGAIGRLLLGRLSDRL------------GRRRRLLLALLLLILAALG 283
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 17539092   333 LIGMIFGDKSLVLLYIMIFFGITFMcFNWGLNIDMLTTVIHPNRRSTAFSYFVLVSHL 390
Cdd:pfam07690 284 LALLSLTESSLWLLLALLLLGFGFG-LVFPALNALVSDLAPKEERGTASGLYNTAGSL 340
 
Name Accession Description Interval E-value
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
11-413 1.33e-27

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 112.02  E-value: 1.33e-27
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092  11 VTALFVVNLLNYVDRYTVAGVLTQVQTYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLG 90
Cdd:cd06174   1 LLLLFLGFFLSGLDRGLLSPALPLLAEDLGLSASQAGLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092  91 SSFvpANHFWLFLVLRSFVGIGEASYSNVAPSLISDMFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTGhWQWGIR 170
Cdd:cd06174  81 LAF--ASSLWLLLVGRFLLGLGGGALYPAAAALIAEWFPPKERGRALGLFSAGFGLGALLGPLLGGLLAESLG-WRWLFL 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 171 VSAIAGLIVMIALVLFtyepergaadkamgeskdvvvttnttyledlvillkTPTLVACTWGYTALVFVSGTLSWWEPTV 250
Cdd:cd06174 158 ILAILGLLLALLLLFL------------------------------------LRLLLLLALAFFLLSFGYYGLLTYLPLY 201
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 251 IQHLTAWHQGlndtkdlastdkdrVALYFGAITTAGGLIGVIFGSMLSKWLVagwgpfrrlqtdRAQPLVAGGGALLAAP 330
Cdd:cd06174 202 LQEVLGLSAA--------------EAGLLLSLFGLGGILGALLGGLLSDRLG------------RRRLLLLIGLLLAALG 255
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 331 FLLIGMIFGDKSLVLLYIMIFFGITFMcfnWGLNIDMLTTVIHPNRRSTAFSYFVLVSHLFGdASGPYLIGLISDAIRHG 410
Cdd:cd06174 256 LLLLALAPSLALLLVALLLLGFGLGFA---FPALLTLASELAPPEARGTASGLFNTFGSLGG-ALGPLLAGLLLDTGGYG 331

                ...
gi 17539092 411 STY 413
Cdd:cd06174 332 GVF 334
2_A_01_02 TIGR00880
Multidrug resistance protein;
47-186 1.01e-12

Multidrug resistance protein;


Pssm-ID: 233166  Cd Length: 141  Bit Score: 65.37  E-value: 1.01e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    47 GLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWlgAVLGSSFVPANHFWLFLVLRSFVGIGEASYSNVAPSLISD 126
Cdd:TIGR00880   1 GLLLAGYALGQLIYSPLSGLLTDRFGRKPVLLVGLFIF--VLSTAMFALSSNITVLIIARFLQGFGAAFALVAGAALIAD 78
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   127 MFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTGhWQWGIRVSAIAGLIVMIALVLF 186
Cdd:TIGR00880  79 IYPPEERGVALGLMSAGIALGPLLGPPLGGVLAQFLG-WRAPFLFLAILALAAFILLAFL 137
MFS_1 pfam07690
Major Facilitator Superfamily;
14-390 1.45e-25

Major Facilitator Superfamily;


Pssm-ID: 254360 [Multi-domain]  Cd Length: 346  Bit Score: 105.96  E-value: 1.45e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    14 LFVVNLLNYVDRYTVAGVLTQ-VQTYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLGSS 92
Cdd:pfam07690   1 LFLAAFLAGLGRSLLGPALPLyLAEDLGISPTEIGLLLTAFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLLLLL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    93 FvpANHFWLFLVLRSFVGIGEASYSNVAPSLISDMFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTGhWQWGIRVS 172
Cdd:pfam07690  81 F--ASSLWLLLVLRVLQGLGGGALFPAAAALIADWFPPEERGRALGLLSAGFGLGAALGPLLGGLLASLFG-WRAAFLIL 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   173 AIAGLIVMIALVLFTYEPERGAADKAMGESKDVVVTTNTTYledlvilLKTPTLVACTWGYTALVFVSGTLSWWEPTVIQ 252
Cdd:pfam07690 158 AILALLAAVLAALLLPRPPPESKRPKPAEEAPAPLLPAWKL-------LLRDPVLWLLLALLLFGFAFFALLTYLPLYQE 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   253 HLtawhqGLNDTkdlastdkdrVALYFGAITTAGGLIGVIFGSMLSKWLvagwgpfrrlqtDRAQPLVAGGGALLAAPFL 332
Cdd:pfam07690 231 VL-----GLSAL----------LAGLLLGLAGLLGAIGRLLLGRLSDRL------------GRRRRLLLALLLLILAALG 283
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 17539092   333 LIGMIFGDKSLVLLYIMIFFGITFMcFNWGLNIDMLTTVIHPNRRSTAFSYFVLVSHL 390
Cdd:pfam07690 284 LALLSLTESSLWLLLALLLLGFGFG-LVFPALNALVSDLAPKEERGTASGLYNTAGSL 340
2A0114 TIGR00893
D-galactonate transporter; [Transport and binding proteins, Carbohydrates, organic alcohols, ...
20-411 9.44e-12

D-galactonate transporter; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].


Pssm-ID: 233174 [Multi-domain]  Cd Length: 399  Bit Score: 65.44  E-value: 9.44e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    20 LNYVDRYTVAGVLTQVQTYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFN-RKWIMIIGVgIWlGAVLGSSFVPANh 98
Cdd:TIGR00893   5 INYLDRANLSFAAPMLQEDLGLSAAQYGYVFSAFSWGYVVGQFPGGWLLDRFGaRKTLAVFIV-IW-GVFTGLQAFAGA- 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    99 FWLFLVLRSFVGIGEASYSNVAPSLISDMFNGQKRSTVFMIFYFAIPVGSGLGF-IVGSNVATLtgHWQWGIRVSAIAGL 177
Cdd:TIGR00893  82 YVSLYILRVLLGAAEAPFFPGIILIVASWFPASERATAVSIFNSAQGLGGIIGGpLVGWILIHF--SWQWAFIIEGVLGI 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   178 IVMIALVLFTYEPERGAADKAMGESKDVVVTT---------NTTYLEDLVILLKTPTLVACTWGYTALVFVSGTLSWWEP 248
Cdd:TIGR00893 160 IWGVLWLKFIPDPPQKAKWLTEEEKYIVVGGLlaeqqgkgpSTPKKYQIKELLKDRRVWGLALGQFLVNIGLGFFLTWFP 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   249 TVIQhltawhqglndtKDLASTDKDrvALYFGAITTAGGLIGVIFGSMLSKWLVAgwgpfRRLQTDRAQPLVAGGGALLA 328
Cdd:TIGR00893 240 TYLV------------QERGLSILE--AGFMASLPGIVGFIGMILGGRLSDLLLR-----RGKSLVFARKTAIIAGLVLS 300
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   329 APFLLIGMIFGDKSLVLLYIMIFFGITFMCFNWGlnidMLTTVIHPNRRSTAFSYFVLVSHLfGDASGPYLIGLISDAIR 408
Cdd:TIGR00893 301 LLMFATNYVNIPYAALALVALGFFGLGAGAIGWA----LISDNAPGNIAGLTGGLINSLGNL-GGIVGPIVIGAIAATTG 375

                  ...
gi 17539092   409 HGS 411
Cdd:TIGR00893 376 SFA 378
AraJ COG2814
Arabinose efflux permease [Carbohydrate transport and metabolism]
28-444 1.72e-09

Arabinose efflux permease [Carbohydrate transport and metabolism]


Pssm-ID: 225371 [Multi-domain]  Cd Length: 394  Bit Score: 58.01  E-value: 1.72e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092  28 VAGVLTQVQTYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLGSSFvpANHFWLFLVLRS 107
Cdd:COG2814  32 PVGLLPPIAADLGVSEGAAGQLITAYALGVALGAPLLALLTGRLERRRLLLGLLALFIVSNLLSAL--APSFAVLLLARA 109
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 108 FVGIGEASYSNVAPSLISDMFNGQKR----STVFMIFYFAIPVGSGLGFIVGsnvatltGHWQWGIRVSAIAGLIVMIAL 183
Cdd:COG2814 110 LAGLAHGVFWSIAAALAARLVPPGKRgralALVFTGLTLATVLGVPLGTFLG-------QLFGWRATFLAIAVLALLALL 182
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 184 VLFTYEPERGAADKAMGESKDVV-VTTNTtyledLVILLKTPTLVACTWGYTALVFVSgtlswwepTVIQHLTAwhqgln 262
Cdd:COG2814 183 LLWKLLPPSEISGSLPGPLRTLLrLLRRP-----GVLLGLLATFLFMTGHFALYTYIR--------PFLESVAG------ 243
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 263 dtkdLASTDKDRVALYFGAittaGGLIGVIFGSMLskwlvAGWGPFRrlqtdraqpLVAGGGALLAAPFLLIgMIFGDKS 342
Cdd:COG2814 244 ----FSVSAVSLVLLAFGI----AGFIGNLLGGRL-----ADRGPRR---------ALIAALLLLALALLAL-TFTGASP 300
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 343 LVLLYIMIFFGITFMCFNWGLNIDMLTTVihPNRRSTAFSYFVLVSHLfGDASGPYLIGLISDAIrhgstypkdqyhSLV 422
Cdd:COG2814 301 ALALALLFLWGFAFSPALQGLQTRLARLA--PDAADLAGSLNVAAFNL-GIALGAALGGLVLDAL------------GYA 365
                       410       420
                ....*....|....*....|..
gi 17539092 423 SATYCCVALLLLSAGLYFVSSL 444
Cdd:COG2814 366 ATGWVGAALLLLALLLALLSAR 387
PRK08633 PRK08633
2-acyl-glycerophospho-ethanolamine acyltransferase; Validated
48-203 8.78e-06

2-acyl-glycerophospho-ethanolamine acyltransferase; Validated


Pssm-ID: 236315 [Multi-domain]  Cd Length: 1146  Bit Score: 47.23  E-value: 8.78e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    48 LIQTVFLISFMVFSPVCGYLGDRFNRKWIMII----GVGIWLGAVLGSSFvpaNHFWLFLVLRSFVGIGEASYS----NV 119
Cdd:PRK08633   51 IVNALFLLPFLLLSSPAGFLADKFSKNRVIRIvklfEVGLTLLIVLAYYL---GWFWLAFAVTFLLGAQSAIYSpakyGI 127
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   120 APSLISDMFNGQKRSTVFMIFYFAIPVGSGLG-FIVGSNVATLTGHWQWGIRVSAIAGLIVMIALVLFTYEPERGAADKA 198
Cdd:PRK08633  128 IPELVGKENLSRANGLLEAFTIVAILAGTALFsFLFESVNGNTPSEILGRIAPAGLVLLAVAVLGLIFAYRLPKVPAAAP 207

                  ....*
gi 17539092   199 MGESK 203
Cdd:PRK08633  208 EVFDK 212
 
Name Accession Description Interval E-value
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
11-413 1.33e-27

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 112.02  E-value: 1.33e-27
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092  11 VTALFVVNLLNYVDRYTVAGVLTQVQTYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLG 90
Cdd:cd06174   1 LLLLFLGFFLSGLDRGLLSPALPLLAEDLGLSASQAGLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092  91 SSFvpANHFWLFLVLRSFVGIGEASYSNVAPSLISDMFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTGhWQWGIR 170
Cdd:cd06174  81 LAF--ASSLWLLLVGRFLLGLGGGALYPAAAALIAEWFPPKERGRALGLFSAGFGLGALLGPLLGGLLAESLG-WRWLFL 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 171 VSAIAGLIVMIALVLFtyepergaadkamgeskdvvvttnttyledlvillkTPTLVACTWGYTALVFVSGTLSWWEPTV 250
Cdd:cd06174 158 ILAILGLLLALLLLFL------------------------------------LRLLLLLALAFFLLSFGYYGLLTYLPLY 201
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 251 IQHLTAWHQGlndtkdlastdkdrVALYFGAITTAGGLIGVIFGSMLSKWLVagwgpfrrlqtdRAQPLVAGGGALLAAP 330
Cdd:cd06174 202 LQEVLGLSAA--------------EAGLLLSLFGLGGILGALLGGLLSDRLG------------RRRLLLLIGLLLAALG 255
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 331 FLLIGMIFGDKSLVLLYIMIFFGITFMcfnWGLNIDMLTTVIHPNRRSTAFSYFVLVSHLFGdASGPYLIGLISDAIRHG 410
Cdd:cd06174 256 LLLLALAPSLALLLVALLLLGFGLGFA---FPALLTLASELAPPEARGTASGLFNTFGSLGG-ALGPLLAGLLLDTGGYG 331

                ...
gi 17539092 411 STY 413
Cdd:cd06174 332 GVF 334
2_A_01_02 TIGR00880
Multidrug resistance protein;
47-186 1.01e-12

Multidrug resistance protein;


Pssm-ID: 233166  Cd Length: 141  Bit Score: 65.37  E-value: 1.01e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    47 GLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWlgAVLGSSFVPANHFWLFLVLRSFVGIGEASYSNVAPSLISD 126
Cdd:TIGR00880   1 GLLLAGYALGQLIYSPLSGLLTDRFGRKPVLLVGLFIF--VLSTAMFALSSNITVLIIARFLQGFGAAFALVAGAALIAD 78
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   127 MFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTGhWQWGIRVSAIAGLIVMIALVLF 186
Cdd:TIGR00880  79 IYPPEERGVALGLMSAGIALGPLLGPPLGGVLAQFLG-WRAPFLFLAILALAAFILLAFL 137
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
11-186 3.47e-08

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 53.86  E-value: 3.47e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092  11 VTALFVVNLLNYVDRYTVAGVLTQV-QTYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIgVGIWLGAVL 89
Cdd:cd06174 177 LLLLALAFFLLSFGYYGLLTYLPLYlQEVLGLSAAEAGLLLSLFGLGGILGALLGGLLSDRLGRRRLLLL-IGLLLAALG 255
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092  90 GSSFVPANHFWLFLVLRSFVGIGEASYSNVAPSLISDMFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATlTGHWQWGI 169
Cdd:cd06174 256 LLLLALAPSLALLLVALLLLGFGLGFAFPALLTLASELAPPEARGTASGLFNTFGSLGGALGPLLAGLLLD-TGGYGGVF 334
                       170
                ....*....|....*..
gi 17539092 170 RVSAIAGLIVMIALVLF 186
Cdd:cd06174 335 LILAALALLAALLLLLL 351
MFS_1 pfam07690
Major Facilitator Superfamily;
14-390 1.45e-25

Major Facilitator Superfamily;


Pssm-ID: 254360 [Multi-domain]  Cd Length: 346  Bit Score: 105.96  E-value: 1.45e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    14 LFVVNLLNYVDRYTVAGVLTQ-VQTYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLGSS 92
Cdd:pfam07690   1 LFLAAFLAGLGRSLLGPALPLyLAEDLGISPTEIGLLLTAFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLLLLL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    93 FvpANHFWLFLVLRSFVGIGEASYSNVAPSLISDMFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTGhWQWGIRVS 172
Cdd:pfam07690  81 F--ASSLWLLLVLRVLQGLGGGALFPAAAALIADWFPPEERGRALGLLSAGFGLGAALGPLLGGLLASLFG-WRAAFLIL 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   173 AIAGLIVMIALVLFTYEPERGAADKAMGESKDVVVTTNTTYledlvilLKTPTLVACTWGYTALVFVSGTLSWWEPTVIQ 252
Cdd:pfam07690 158 AILALLAAVLAALLLPRPPPESKRPKPAEEAPAPLLPAWKL-------LLRDPVLWLLLALLLFGFAFFALLTYLPLYQE 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   253 HLtawhqGLNDTkdlastdkdrVALYFGAITTAGGLIGVIFGSMLSKWLvagwgpfrrlqtDRAQPLVAGGGALLAAPFL 332
Cdd:pfam07690 231 VL-----GLSAL----------LAGLLLGLAGLLGAIGRLLLGRLSDRL------------GRRRRLLLALLLLILAALG 283
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 17539092   333 LIGMIFGDKSLVLLYIMIFFGITFMcFNWGLNIDMLTTVIHPNRRSTAFSYFVLVSHL 390
Cdd:pfam07690 284 LALLSLTESSLWLLLALLLLGFGFG-LVFPALNALVSDLAPKEERGTASGLYNTAGSL 340
2A0114 TIGR00893
D-galactonate transporter; [Transport and binding proteins, Carbohydrates, organic alcohols, ...
20-411 9.44e-12

D-galactonate transporter; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].


Pssm-ID: 233174 [Multi-domain]  Cd Length: 399  Bit Score: 65.44  E-value: 9.44e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    20 LNYVDRYTVAGVLTQVQTYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFN-RKWIMIIGVgIWlGAVLGSSFVPANh 98
Cdd:TIGR00893   5 INYLDRANLSFAAPMLQEDLGLSAAQYGYVFSAFSWGYVVGQFPGGWLLDRFGaRKTLAVFIV-IW-GVFTGLQAFAGA- 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    99 FWLFLVLRSFVGIGEASYSNVAPSLISDMFNGQKRSTVFMIFYFAIPVGSGLGF-IVGSNVATLtgHWQWGIRVSAIAGL 177
Cdd:TIGR00893  82 YVSLYILRVLLGAAEAPFFPGIILIVASWFPASERATAVSIFNSAQGLGGIIGGpLVGWILIHF--SWQWAFIIEGVLGI 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   178 IVMIALVLFTYEPERGAADKAMGESKDVVVTT---------NTTYLEDLVILLKTPTLVACTWGYTALVFVSGTLSWWEP 248
Cdd:TIGR00893 160 IWGVLWLKFIPDPPQKAKWLTEEEKYIVVGGLlaeqqgkgpSTPKKYQIKELLKDRRVWGLALGQFLVNIGLGFFLTWFP 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   249 TVIQhltawhqglndtKDLASTDKDrvALYFGAITTAGGLIGVIFGSMLSKWLVAgwgpfRRLQTDRAQPLVAGGGALLA 328
Cdd:TIGR00893 240 TYLV------------QERGLSILE--AGFMASLPGIVGFIGMILGGRLSDLLLR-----RGKSLVFARKTAIIAGLVLS 300
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   329 APFLLIGMIFGDKSLVLLYIMIFFGITFMCFNWGlnidMLTTVIHPNRRSTAFSYFVLVSHLfGDASGPYLIGLISDAIR 408
Cdd:TIGR00893 301 LLMFATNYVNIPYAALALVALGFFGLGAGAIGWA----LISDNAPGNIAGLTGGLINSLGNL-GGIVGPIVIGAIAATTG 375

                  ...
gi 17539092   409 HGS 411
Cdd:TIGR00893 376 SFA 378
Sugar_tr pfam00083
Sugar (and other) transporter;
37-186 5.86e-11

Sugar (and other) transporter;


Pssm-ID: 249572 [Multi-domain]  Cd Length: 449  Bit Score: 63.09  E-value: 5.86e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    37 TYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLGSSFVPANHFWLFLVLRSFVGIGEASY 116
Cdd:pfam00083  38 GADYLSTSLSGLIVSIFSVGCLIGSLFAGKLGDRFGRKPSLLIANVLFVIGALLQGFAPGKSFYMLIVGRVIVGLGVGGI 117
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 17539092   117 SNVAPSLISDMFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTGHWQWGIRVSAIAGL-IVMIALVLF 186
Cdd:pfam00083 118 SVLVPMYISEIAPKKLRGALGSLYQLGITFGILVAAIIGLGLNKYSNSDGWRIPLGLQFVPaLLLLIGLLF 188
AraJ COG2814
Arabinose efflux permease [Carbohydrate transport and metabolism]
28-444 1.72e-09

Arabinose efflux permease [Carbohydrate transport and metabolism]


Pssm-ID: 225371 [Multi-domain]  Cd Length: 394  Bit Score: 58.01  E-value: 1.72e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092  28 VAGVLTQVQTYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLGSSFvpANHFWLFLVLRS 107
Cdd:COG2814  32 PVGLLPPIAADLGVSEGAAGQLITAYALGVALGAPLLALLTGRLERRRLLLGLLALFIVSNLLSAL--APSFAVLLLARA 109
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 108 FVGIGEASYSNVAPSLISDMFNGQKR----STVFMIFYFAIPVGSGLGFIVGsnvatltGHWQWGIRVSAIAGLIVMIAL 183
Cdd:COG2814 110 LAGLAHGVFWSIAAALAARLVPPGKRgralALVFTGLTLATVLGVPLGTFLG-------QLFGWRATFLAIAVLALLALL 182
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 184 VLFTYEPERGAADKAMGESKDVV-VTTNTtyledLVILLKTPTLVACTWGYTALVFVSgtlswwepTVIQHLTAwhqgln 262
Cdd:COG2814 183 LLWKLLPPSEISGSLPGPLRTLLrLLRRP-----GVLLGLLATFLFMTGHFALYTYIR--------PFLESVAG------ 243
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 263 dtkdLASTDKDRVALYFGAittaGGLIGVIFGSMLskwlvAGWGPFRrlqtdraqpLVAGGGALLAAPFLLIgMIFGDKS 342
Cdd:COG2814 244 ----FSVSAVSLVLLAFGI----AGFIGNLLGGRL-----ADRGPRR---------ALIAALLLLALALLAL-TFTGASP 300
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 343 LVLLYIMIFFGITFMCFNWGLNIDMLTTVihPNRRSTAFSYFVLVSHLfGDASGPYLIGLISDAIrhgstypkdqyhSLV 422
Cdd:COG2814 301 ALALALLFLWGFAFSPALQGLQTRLARLA--PDAADLAGSLNVAAFNL-GIALGAALGGLVLDAL------------GYA 365
                       410       420
                ....*....|....*....|..
gi 17539092 423 SATYCCVALLLLSAGLYFVSSL 444
Cdd:COG2814 366 ATGWVGAALLLLALLLALLSAR 387
MFS_2 pfam13347
MFS/sugar transport protein; This family is part of the major facilitator superfamily of ...
15-188 1.91e-09

MFS/sugar transport protein; This family is part of the major facilitator superfamily of membrane transport proteins.


Pssm-ID: 257676 [Multi-domain]  Cd Length: 423  Bit Score: 57.98  E-value: 1.91e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    15 FVVNLLNYVDRYTVAGVLTQVQTYYNI----SDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLG 90
Cdd:pfam13347 222 LLILLLLYLLNALAMAVRNGLLLYYFTyvlgNAGLFSVLLLIGTIAAILGAPLWPWLAKRFGKKRTFLLGMLLAAIGLVL 301
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    91 SSFVPANHFWLFLVLRSFVGIGEASYSNVAPSLISDMF------NGQKRSTVFM-IFYFAIPVGSGLG-FIVG------- 155
Cdd:pfam13347 302 LFFLPPGSVWLFLVLVVLIGIGLGLATLLPWAMLADVVdygewkTGKRREGIVFsLYSFADKLGGALGgAIVGlllafag 381
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 17539092   156 --SNVATLTGHWQWGIRVSAI---AGLIVMIALVLFTY 188
Cdd:pfam13347 382 yvANATAQSAAALSGIRLLFTlipAVLALLALLILRFY 419
2A0119 TIGR00898
cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds] ...
47-182 3.11e-09

cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds].


Pssm-ID: 233176 [Multi-domain]  Cd Length: 505  Bit Score: 57.72  E-value: 3.11e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    47 GLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLGSSFVPanHFWLFLVLRSFVGIGEASYSNVAPSLISD 126
Cdd:TIGR00898 130 DLTQSCFFVGVLLGSFVFGYLSDRFGRKKVLLLSTLVTAVSGVLTAFSP--NYTVFLVFRLLVGMGIGGIWVQAVVLNTE 207
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 17539092   127 mFNGQKRSTVFMIFYFaipVGSGLGFIVGSNVATLTGHWQWGIRVSAIAGLIVMIA 182
Cdd:TIGR00898 208 -FLPKKQRAIVGTLIQ---VFFSLGLVLLPLVAYFIPDWRWLQLAVSLPTFLFFLL 259
2A0104 TIGR00881
phosphoglycerate transporter family protein; [Transport and binding proteins, Carbohydrates, ...
15-243 3.79e-09

phosphoglycerate transporter family protein; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].


Pssm-ID: 233167 [Multi-domain]  Cd Length: 379  Bit Score: 57.00  E-value: 3.79e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    15 FVVNLLNYVDRYTVAGVLTQVQTYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLGSSFv 94
Cdd:TIGR00881   1 FIGYAAYYLVRKNFALAMPYLVEEIGLSKTDLGLLLSSFSIAYGISKFVMGSVSDRSNPRVFLPIGLILCAIVNLFFGF- 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    95 pANHFWLFLVLRSFVGIGEASYSNVAPSLISDMFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTGHWQWGIRVSAI 174
Cdd:TIGR00881  80 -STSLWVMAALWALNGIFQGMGWPPCGRTVTKWFSRSERGTWVSFWNCSHNVGGGLLPPLVLFGIAELYSWHWVFIVPGI 158
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 17539092   175 AGLIV-MIALVLFTYEPER---GAADKAMGESKDVVVTTNTTYLEDLVILLKTPTLVACTWG-YTALVFVSGTL 243
Cdd:TIGR00881 159 IAIIVsLICFLLLRDSPQScglPPAEEMPNEEPDGDAEKKEEELTKKQIFLQYVLLNKVLWYiSLGYVFVYVVR 232
2A0115 TIGR00895
benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and ...
39-401 1.78e-08

benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].


Pssm-ID: 233175 [Multi-domain]  Cd Length: 398  Bit Score: 55.06  E-value: 1.78e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    39 YNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLGSSFvpANHFWLFLVLRSFVGIGEASYSN 118
Cdd:TIGR00895  47 WGLDPVQLGFLFSAGLIGMAFGALFFGPLADRIGRRRVLLWSILLFSVFTLLCAL--ATNVTQLLILRFLAGLGLGGLMP 124
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   119 VAPSLISDMFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTGhWQWGIRVSAIAGLIVMIALVLFTYEPER------ 192
Cdd:TIGR00895 125 NLNALVSEYAPKRFRGTAVGLMFCGYPIGAAVGGFLAGWLIPVFG-WRSLFYVGGIAPLLLLLLLMRFLPESIDflvskr 203
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   193 --------GAADKAMGESKDVVVTTN---TTYLEDLVILLKTPTLVACT---W-GYTALVFVSGTLSWWEPTVIQHLTAw 257
Cdd:TIGR00895 204 petvrrivNAIAPQMQAEAQSALPEQkatQGTKRSVFKALFQGKTARITvllWlLYFMLLVGVYFLTNWLPKLMVELGF- 282
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   258 hqglndtkdlastdKDRVALYFGAITTAGGLIGVIFGSMLSkwlvagwgpfrrlqtDRAQPLVAGGGALLAAPFLLIGMI 337
Cdd:TIGR00895 283 --------------SLSLAATGGALFNFGGVIGSIIFGWLA---------------DRLGPRVTALLLLLGAVFAVLVGS 333
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 17539092   338 FGDKSLVLLYIMIFFGitfMCFNWGLNIDM-LTTVIHPNR-RSTAFSYFVLVSHlFGDASGPYLIG 401
Cdd:TIGR00895 334 TLFSPTLLLLLGAIAG---FFVNGGQSGLYaLMALFYPTAiRATGVGWAIGIGR-LGAIIGPILAG 395
SP TIGR00879
MFS transporter, sugar porter (SP) family; This model represent the sugar porter subfamily of ...
42-186 1.22e-07

MFS transporter, sugar porter (SP) family; This model represent the sugar porter subfamily of the major facilitator superfamily (pfam00083) [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].


Pssm-ID: 233165 [Multi-domain]  Cd Length: 481  Bit Score: 52.73  E-value: 1.22e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    42 SDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRK-WIMIIGVGIWLGAVLGSSFVPANHFWLFLVLRSFVGIGEASYSNVA 120
Cdd:TIGR00879  69 SSSLWGLVVSIFLVGGFIGALFAGWLSDRFGRKkSLLIIALLFVIGAILMGLAAFALSVEMLIVGRVLLGIGVGIASALV 148
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 17539092   121 PSLISDMFNGQKRSTVFMIFYFAIPVGSGLGFIVGS--NVATLTGHWQWGIRVSAIAGLIVMIALVLF 186
Cdd:TIGR00879 149 PMYLSEIAPKALRGALTSLYQLAITFGILVAYGFGSgkVSLNNTLGWRIPLGLQLIPAGLLFLGLFFL 216
MelB COG2211
Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism]
35-188 2.09e-07

Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism]


Pssm-ID: 225121 [Multi-domain]  Cd Length: 467  Bit Score: 51.87  E-value: 2.09e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092  35 VQTYYNI-----SDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLGSSFVPANHFWLFLVLRSFV 109
Cdd:COG2211 258 IMVYYVTyvlgdPELFAYLLLLASGAGLLIGLILWPRLVKKFGKKKLFLIGLLLLAVGYLLLYFTPAGSVVLIVVALIIA 337
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 110 GIGEASYSNVAPSLISDM------FNGQKRS-TVFMIFYFAIPVGSGL-GFIVG---------SNVATLTGHWQWGIRVS 172
Cdd:COG2211 338 GVGTGIANPLPWAMVADTvdygewKTGVRREgIVYSGMTFFRKLGLALaGFIPGwilgaigyvPNVSAQSASALFGIRFL 417
                       170
                ....*....|....*....
gi 17539092 173 AI---AGLIVMIALVLFTY 188
Cdd:COG2211 418 FIilpALLLLLAAIIIFFY 436
2A0106 TIGR00883
metabolite-proton symporter; This model represents the metabolite:H+ symport subfamily of the ...
40-184 5.44e-07

metabolite-proton symporter; This model represents the metabolite:H+ symport subfamily of the major facilitator superfamily (pfam00083), including citrate-H+ symporters, dicarboxylate:H+ symporters, the proline/glycine-betaine transporter ProP, etc [Transport and binding proteins, Unknown substrate].


Pssm-ID: 233168 [Multi-domain]  Cd Length: 394  Bit Score: 50.35  E-value: 5.44e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    40 NISDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIgvGIWLGAVLGSSFVPA----NHFWLFLVLRSFVGIGEAS 115
Cdd:TIGR00883 251 GLSANSALLVLMLSLILFFITIPLSGALSDRIGRRPVLII--FTVLAALLAVPLLMAlldsGSFTLFFFLVLGMALIGGM 328
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   116 YSNVAPSLISDMFNGQKRSTVFMIFY-FAIPVGSGLGFIVGSNVATLTGHWqwgirvSAIAGLIVMIALV 184
Cdd:TIGR00883 329 YTGPMGSFLPELFPTEVRYTGASLAYnLAGAIFGGFAPYIAAALVAMTGDW------YAIGYYLAALALI 392
ProP COG0477
Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino ...
13-191 6.74e-07

Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only]


Pssm-ID: 223553 [Multi-domain]  Cd Length: 338  Bit Score: 49.69  E-value: 6.74e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092  13 ALFVVNLLNYVDRYTVAGVLTQVQTYYNISDSLG--GLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLG 90
Cdd:COG0477   6 ALALAALLLGLDLGLLSPALPLLLSTLSLSSGRLlyGLLLSAFFLGYAIGSLLAGPLGDRYGRRKVLIIGLLLFLLGTLL 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092  91 SSFVPANHFWLFLVLRSFVGIGEASYSNVAPSLISDMFNGQKRSTVFMIFYFAIPVGSGL---GFIVGSNVATLTGHWQW 167
Cdd:COG0477  86 LALAPNVGLALLLILRLLQGLGGGGLLPVASALLSEWFPEATERGLAVGLVTLGAGALGLalgPLLAGLLLGALLWGWRA 165
                       170       180
                ....*....|....*....|....
gi 17539092 168 GIRVSAIAGLIVMIALVLFTYEPE 191
Cdd:COG0477 166 AFLLAALLGLLLLILVLLLDLLLA 189
FucP COG0738
Fucose permease [Carbohydrate transport and metabolism]
8-407 3.14e-06

Fucose permease [Carbohydrate transport and metabolism]


Pssm-ID: 223809 [Multi-domain]  Cd Length: 422  Bit Score: 48.08  E-value: 3.14e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   8 YISVTALFVVNLLNYVdryTVAGVLTQVQTYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWlgA 87
Cdd:COG0738  15 FVLLTSLFFLWGFITC---LNDILIPHLKEVFDLTYFEASLIQFAFFGGYFIMSLPAGLLIKKLGYKAGIVLGLLLY--A 89
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092  88 VLGSSFVPANH---FWLFLVLRSFVGIGEASYSNVAPSLISDMFNGQK---RSTVFMIFYfaiPVGSGLGFIVGSN---- 157
Cdd:COG0738  90 VGAALFWPAASsksYGFFLVALFILASGIGLLETAANPYVTLLGKPESaafRLNLAQAFN---GLGAILGPLLGSSlils 166
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 158 --------------VATLTGHWQWgIRVSAIAGLIVMIALVLFTYEPERGAADKAMGESKDVVVTTnttyledlviLLKT 223
Cdd:COG0738 167 gvaltmsaaqilaiKGADASSVQF-PYLILAGLLVLLAVLILLSKLPDLQVAAPSLGASGSAGLSS----------LFQN 235
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 224 PTLVACTWGYTALVFVSGTLSWWEPTViqhltawhqgLNDTKDLASTDkdrvALYFGAITTAGGLIGVIFGSMLskwlva 303
Cdd:COG0738 236 KHLRLGVLAIFLYVGAEVAIGSFLVSY----------LEELLGLNEQQ----AAYYLSFFWVGFMVGRFIGSAL------ 295
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 304 gwgpFRRLQTDRAQPLVAGGGALLAAPFLLIGMIFGDKSLVLlyIMIFFGITFMcfnwglNIDMLTTVIHPNRRSTAFSy 383
Cdd:COG0738 296 ----MSRIKPEKYLAFYALIAILLLLAVALIGGVVALYALFL--IGLFNSIMFP------TIFSLALKNLGEHTSVGSG- 362
                       410       420
                ....*....|....*....|....
gi 17539092 384 fVLVSHLFGDASGPYLIGLISDAI 407
Cdd:COG0738 363 -LLVMAIVGGAIIPPLQGVIADMF 385
MFS_1 pfam07690
Major Facilitator Superfamily;
11-151 3.16e-06

Major Facilitator Superfamily;


Pssm-ID: 254360 [Multi-domain]  Cd Length: 346  Bit Score: 47.80  E-value: 3.16e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    11 VTALFVVNLLNYVDRYTVAGVLTQVQTYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLG 90
Cdd:pfam07690 204 VLWLLLALLLFGFAFFALLTYLPLYQEVLGLSALLAGLLLGLAGLLGAIGRLLLGRLSDRLGRRRRLLLALLLLILAALG 283
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 17539092    91 SSFVP-ANHFWLFLVLRSFVGIGEASYSNVAPSLISDMFNGQKRSTVFMIFYFAIPVGSGLG 151
Cdd:pfam07690 284 LALLSlTESSLWLLLALLLLGFGFGLVFPALNALVSDLAPKEERGTASGLYNTAGSLGGALG 345
PRK08633 PRK08633
2-acyl-glycerophospho-ethanolamine acyltransferase; Validated
48-203 8.78e-06

2-acyl-glycerophospho-ethanolamine acyltransferase; Validated


Pssm-ID: 236315 [Multi-domain]  Cd Length: 1146  Bit Score: 47.23  E-value: 8.78e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    48 LIQTVFLISFMVFSPVCGYLGDRFNRKWIMII----GVGIWLGAVLGSSFvpaNHFWLFLVLRSFVGIGEASYS----NV 119
Cdd:PRK08633   51 IVNALFLLPFLLLSSPAGFLADKFSKNRVIRIvklfEVGLTLLIVLAYYL---GWFWLAFAVTFLLGAQSAIYSpakyGI 127
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   120 APSLISDMFNGQKRSTVFMIFYFAIPVGSGLG-FIVGSNVATLTGHWQWGIRVSAIAGLIVMIALVLFTYEPERGAADKA 198
Cdd:PRK08633  128 IPELVGKENLSRANGLLEAFTIVAILAGTALFsFLFESVNGNTPSEILGRIAPAGLVLLAVAVLGLIFAYRLPKVPAAAP 207

                  ....*
gi 17539092   199 MGESK 203
Cdd:PRK08633  208 EVFDK 212
HpaX TIGR02332
4-hydroxyphenylacetate permease; This protein is a part of the Major Facilitator Superfamily ...
14-252 2.96e-05

4-hydroxyphenylacetate permease; This protein is a part of the Major Facilitator Superfamily (Pfam family pfam07690). Member of this family are found in a number of proteobacterial genomes, but only in the context of having genes for 4-hydroxyphenylacetate (4-HPA) degradation. The protein is characterized by Prieto, et al. (PMID:9315705) as 4-hydroxyphenylacetate permease in E. coli, where 3-HPA and 3,4-dihydroxyphenylacetate are shown to competitively inhibit 4-HPA transport and therefore also interact specificially.


Pssm-ID: 131385 [Multi-domain]  Cd Length: 412  Bit Score: 44.98  E-value: 2.96e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    14 LFVVNLLNYVDRYTVAGVLTQVQTYYNISDSLGGLIQTVFLISFMVFS-PVCGYLGDRFNRKWIMIIGVgIWLGAVLGSS 92
Cdd:TIGR02332  13 LFILFIFSFLDRINIGFAGLTMGKDLGLSATMFGLAATLFYAAYVICGiPSNIMLAIIGARRWIAGIMV-LWGIASTATM 91
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    93 FvpANHFWLFLVLRSFVGIGEASYSNVAPSLISDMFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTG-----HWQW 167
Cdd:TIGR02332  92 F--ATGPESLYLLRILVGIAEAGFLPGILLYLTFWFPAYFRARANALFMIAMPVTMALGLILSGYILALDGlmalkGWQW 169
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   168 GIRV----SAIAGLIVMIAL------VLFTYEPERGA------ADKAMGESKDVVVTTNTTYLEDLVILLKTPTLVACTW 231
Cdd:TIGR02332 170 LFLLegfpSVILGVMTWFWLddspdkAKWLDEEDKKAlkemidNDQLTLEQPEGAFAHAAMPQRSMLREIFTPAIMLYTL 249
                         250       260
                  ....*....|....*....|.
gi 17539092   232 GYTALVFVSGTLSWWEPTVIQ 252
Cdd:TIGR02332 250 AYFCLTNTLSAINIWTPQILQ 270
UhpC COG2271
Sugar phosphate permease [Carbohydrate transport and metabolism]
47-406 3.29e-05

Sugar phosphate permease [Carbohydrate transport and metabolism]


Pssm-ID: 225180 [Multi-domain]  Cd Length: 448  Bit Score: 44.95  E-value: 3.29e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092  47 GLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLGSSFVPAnhFWLFLVLRSFVGIGEASYSNVAPSLISD 126
Cdd:COG2271  67 GILGSAFSITYGVSKFVMGVLSDRSNPRYFMAFGLILSAIVNILFGFSPS--LFLFAVLWVLNGWFQGMGWPPCARTITH 144
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 127 MFNGQKRSTVFMIFYFAIPVGSGL-GFIVGSNVATLTGHWQWGIRVSAIAGLIVMIALV-----------LFTYEPERGA 194
Cdd:COG2271 145 WFSRKERGTWWSIWNTSHNIGGALaPLVALLAFFAFHGGWRAAFYFPGIIAIIVALILLfllrdrpqsegLPPIEEYRGD 224
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 195 ADKAMGESKDVVVTTNTTYLEDLVilLKTPTLVACTWGYTALVFVSGTLSWWEPTVIQHLTAWhqglndtkdlastDKDR 274
Cdd:COG2271 225 PLEIYEEEKENEGLTAWQIFVKYV--LKNKLIWLLALANVFVYVVRYGINDWGPLYLSEVKGF-------------SLVK 289
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092 275 VALYFGAITTAGgligvIFGSmlskwLVAGWGPFRRLQTDRAqplVAGGGALLAAPFLLIGMIFGDKSLVLLYIMIFFGI 354
Cdd:COG2271 290 ANWAISLFEVAG-----LPGT-----LLAGWLSDKLFKGRRG---PMALIFMLLITASLVLYWLAPNGSYLLDAILLFII 356
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|...
gi 17539092 355 TFMCFNWGLNIDMLTT-VIHPNRRSTAFSYFVLVSHLFGDASGPYLIGLISDA 406
Cdd:COG2271 357 GFLIYGPQMLIGLAAAeFVPKKAAGTATGFVGLFAYLIGAALAGLPLGYIADT 409
TRI12 pfam06609
Fungal trichothecene efflux pump (TRI12); This family consists of several fungal specific ...
47-190 9.59e-05

Fungal trichothecene efflux pump (TRI12); This family consists of several fungal specific trichothecene efflux pump proteins. Many of the genes involved in trichothecene toxin biosynthesis in Fusarium sporotrichioides are present within a gene cluster.It has been suggested that TRI12 may play a role in F. sporotrichioides self-protection against trichothecenes.


Pssm-ID: 115279 [Multi-domain]  Cd Length: 598  Bit Score: 43.50  E-value: 9.59e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    47 GLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWL-GAVLGSSfvpANHFWLFLVLRSFVGIGeASYSNVAPSLIS 125
Cdd:pfam06609  81 GLFSTLWTMGQAVSILMMGRLTDRFGRRPFVIATHIIGLvGAIVGCT---ANKFNTLLAAMTLLGVA-AGPAGASPLFIG 156
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 17539092   126 DMFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVAtLTGHWQWGIRVSAIAGLIVMIALVLFTYEP 190
Cdd:pfam06609 157 ELMSNKTKFLGLLIVSAPTIAMNGAGPYFGQRLA-IQGNWRWIFYIYIIMSAIAVLLIIIWYHPP 220
2A0121 TIGR00900
H+ Antiporter protein; [Transport and binding proteins, Cations and iron carrying compounds].
47-407 2.12e-04

H+ Antiporter protein; [Transport and binding proteins, Cations and iron carrying compounds].


Pssm-ID: 162098 [Multi-domain]  Cd Length: 365  Bit Score: 41.92  E-value: 2.12e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    47 GLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLGSSFVPANHF---WLFLVLRSFVGIGEA----SYSNV 119
Cdd:TIGR00900  37 SLAALAGMLPYVVLSPIAGALADRYDRKKVMIGADLIRAVLVAVLPFVALLGGlniWQVYVLAGILAIAQAfftpAYQAM 116
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   120 APSLISDMFNGQKRSTVFMIFYFAIPVGSGLGfivGSNVATLTGHwqWGIRVSAIaGLIVMIALVLFTYEPERGAADkAM 199
Cdd:TIGR00900 117 LPDLVPEEQLTQANSLSQAVRSLFYIVGPGIG---GLMYATLGIK--WAIWVDAV-GFAISALLIVSVRIPELAASE-IQ 189
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   200 GESKDVVVTTnttyLEDLVILLKTPTLVACTWGYTALVFV-SGTLSWWEP---TVIQHLTAWHqglndtkdlastdkdrv 275
Cdd:TIGR00900 190 ALSNAVLRDT----REGIKFVLKNPLLRTLLLLALLFNLVfAPAIVALFPyvqSKYLGRGSTH----------------- 248
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   276 alyFGAITTAGGLigvifGSMLSKWLVAgwgpfrRLQTDRAQPLVAGGGALLAAPFLLIGMIFGDKSLVLLYIMIFFGIT 355
Cdd:TIGR00900 249 ---YGWVLAAFGL-----GALLGALLLG------LLGRYFKRMALMTGAIFVIGLAILVVGLTPPNFPLFLVLWFAIGVG 314
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|..
gi 17539092   356 FMCFNwGLNIDMLTTVIHPNRRSTAFSYFVLVSHLFGDASGPyLIGLISDAI 407
Cdd:TIGR00900 315 YGPIN-VPQGTLLQRRVPAELLGRVFGAQFSLSHAAWPLGLI-LAGPLADHL 364
NarK COG2223
Nitrate/nitrite transporter [Inorganic ion transport and metabolism]
36-115 3.61e-04

Nitrate/nitrite transporter [Inorganic ion transport and metabolism]


Pssm-ID: 225133 [Multi-domain]  Cd Length: 417  Bit Score: 41.48  E-value: 3.61e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092  36 QTYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFN-RKWIMIIGVGIWLGAVLGSSFVPANH--------FWLFLVLR 106
Cdd:COG2223 246 VTQFGLSPVTAGLIAFLFPLIGALARPLGGWLSDRIGgRRVTLAVFVGMALAAALLSLFLTGFGhggsfvvfVAVFLALF 325

                ....*....
gi 17539092 107 SFVGIGEAS 115
Cdd:COG2223 326 VFAGLGNGS 334
2A0112 TIGR00891
putative sialic acid transporter; [Transport and binding proteins, Carbohydrates, organic ...
19-185 5.02e-04

putative sialic acid transporter; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].


Pssm-ID: 233172 [Multi-domain]  Cd Length: 405  Bit Score: 41.02  E-value: 5.02e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    19 LLNYVDRYTVAGVLTQVQTYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLGSSFVPAnh 98
Cdd:TIGR00891  22 LLDAFDFFLVALVLAEVAGEFGLTTVDAASLISAALISRWFGALMFGLWGDRYGRRLPMVTSIVLFSAGTLACGFAPG-- 99
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    99 FWLFLVLRSFVGIGEASYSNVAPSLISDMFNGQKRStVFMIFYFAipvGSGLGFIVGSNVATLTGHWqWGIRVSAIAGLI 178
Cdd:TIGR00891 100 YITMFIARLVIGIGMGGEYGSSAAYVIESWPKHLRN-KASGLLIS---GYAVGAVVAAQVYSLVVPV-WGDGWRALFFIS 174

                  ....*..
gi 17539092   179 VMIALVL 185
Cdd:TIGR00891 175 ILPIIFA 181
synapt_SV2 TIGR01299
synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger ...
23-114 5.27e-04

synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by PFAM model pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.


Pssm-ID: 130366 [Multi-domain]  Cd Length: 742  Bit Score: 41.12  E-value: 5.27e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    23 VDRYTVAGVLTQVQTYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLGSSFVPANHFWLF 102
Cdd:TIGR01299 181 VEVFVVGFVLPSAEKDLCIPDSGKGMLGLIVYLGMMVGAFFWGGLADKLGRKQCLLICLSVNGFFAFFSSFVQGYGFFLF 260
                          90
                  ....*....|..
gi 17539092   103 LVLRSFVGIGEA 114
Cdd:TIGR01299 261 CRLLSGFGIGGA 272
PRK03893 PRK03893
putative sialic acid transporter; Provisional
19-245 1.48e-03

putative sialic acid transporter; Provisional


Pssm-ID: 179668 [Multi-domain]  Cd Length: 496  Bit Score: 39.68  E-value: 1.48e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   19 LLNYVDRYTVAGVLTQVQTYYNIsdslgGLIQTVFLISFMVFSP-----VCGYLGDRFNRKWIMIIGVGIWLGAVLGSSF 93
Cdd:PRK03893  30 LLDGFDFVLITLVLTEVQGEFGL-----TTVQAASLISAAFISRwfgglLLGAMGDRYGRRLAMVISIVLFSVGTLACGF 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   94 VPAnhFWLFLVLRSFVGIGEA-SYSNVAPSLI-SDMFNGQKRSTVFMIFYFAIpvGSGLGFIVGSNVATLtghwqWGIRV 171
Cdd:PRK03893 105 APG--YWTLFIARLVIGMGMAgEYGSSATYVIeSWPKHLRNKASGFLISGFSI--GAVVAAQVYSLVVPV-----WGWRA 175
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 17539092  172 SAIAGLI-VMIALVLFTYEPERGAADKAMGESKDVVVTTNTTYLEDLVIL--LKTPTLVACTWGYTALVFVSGTLSW 245
Cdd:PRK03893 176 LFFIGILpIIFALWLRKNLPEAEDWKEKHAGKAPVRTMVDILYRGEHRIIniLLTLAAAAALWFCFAGNLQNAAIVA 252
efflux_Bcr_CflA TIGR00710
drug resistance transporter, Bcr/CflA subfamily; This subfamily of drug efflux proteins, a ...
51-186 1.84e-03

drug resistance transporter, Bcr/CflA subfamily; This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 12 membrane-spanning regions. Members with known activity include Bcr (bicyclomycin resistance protein) in E. coli, Flor (chloramphenicol and florfenicol resistance) in Salmonella typhimurium DT104, and CmlA (chloramphenicol resistance) in Pseudomonas sp. plasmid R1033.


Pssm-ID: 233099 [Multi-domain]  Cd Length: 385  Bit Score: 39.29  E-value: 1.84e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    51 TVFLISFMVFSPVCGYLGDRFNRKWIMIIGVGIWLGAVLGSSFVpaNHFWLFLVLRSFVGIGEASYSNVAPSLISDMFNG 130
Cdd:TIGR00710  47 TLYLLGFAAGQLLWGPLSDRYGRRPVLLLGLFIFALSSLGLALS--NNIETLLVLRFVQAFGASAGSVISQALVRDIYPG 124
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 17539092   131 QKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTgHWQWGIRVSAIAGlIVMIALVLF 186
Cdd:TIGR00710 125 EELSRIYSILMPVLALAPAVAPLLGGYILVWL-SWHAIFAFLSLAG-ILLSALIFF 178
efflux_EmrB TIGR00711
drug resistance transporter, EmrB/QacA subfamily; This subfamily of drug efflux proteins, a ...
49-192 2.33e-03

drug resistance transporter, EmrB/QacA subfamily; This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].


Pssm-ID: 129794 [Multi-domain]  Cd Length: 485  Bit Score: 38.90  E-value: 2.33e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    49 IQTVFLISFMVFSPVCGYLGDRFNRKWIMIIGVgiwLGAVLGSSFVP-ANHFWLFLVLRSFVGIGEASYSNVAPSLISDM 127
Cdd:TIGR00711  42 VITSYMLANAISIPLTGWLAKRFGTRRLFLIST---FAFTLGSLLCGvAPNLELMIIFRVIQGFGGGPLIPLSFSTLLNI 118
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 17539092   128 FNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTgHWQWGIRVSAIAGLIVMIaLVLFTYEPER 192
Cdd:TIGR00711 119 YPPEKRGRAMAIWGLTVLVAPALGPTLGGWIIENY-HWRWIFLINVPIGIIVVV-VAFFILPRDK 181
CynX TIGR00896
cyanate transporter; This family of proteins is involved in active transport of cyanate. The ...
27-301 2.99e-03

cyanate transporter; This family of proteins is involved in active transport of cyanate. The cyanate transporter in E.Coli is used to transport cyanate into the cell so it can be metabolized into ammonia and bicarbonate. This process is used to overcome the toxicity of environmental cyanate [Transport and binding proteins, Other].


Pssm-ID: 129974 [Multi-domain]  Cd Length: 355  Bit Score: 38.20  E-value: 2.99e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    27 TVAGVLTQVQTYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRF-NRKWIMIIGVGIWLGAVLGSSFVPANHFWLFLVL 105
Cdd:TIGR00896  18 SVGPLLPQIRSALGMSFSVAGLLTALPVLCFAVLAPLAPWLARRFgEERSVAAGLLLIAAGILIRSAPGTALLFAGTALI 97
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   106 RSFVGIGEAsysnVAPSLISDMFNgQKRSTVFMIFYFAIPVGSGLGFIVGSNVAT-LTGHWQwgirvSAIAGLIVMIALV 184
Cdd:TIGR00896  98 GVGIAIINV----LLPSLIKRDFP-QRVGLMTGLYSMALMGGAALAAAATVPLAQhSGGHWQ-----QALAWWALPALLA 167
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092   185 LFTYEPergaadkamgESKDVVVTTNTTYLEDLVILLKTPTL--VACTWGYTALVFVSgTLSWWEPTVIQH-LTAWHQGL 261
Cdd:TIGR00896 168 LLAWIP----------QVRRRVAANQTTTRLTPVRIWRSPLAwqVTVFFGLQSGLYYS-LIGWLPAILISHgASAATAGS 236
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....
gi 17539092   262 ND-------------TKDLASTDKD-RVALYFGAITTAGGLIGVIFGSMLSKWL 301
Cdd:TIGR00896 237 LLalmqlaqaasallIPALARRVKDqRGIVAVLAVLQLVGLCGLLFAPMHGLWA 290
OATP pfam03137
Organic Anion Transporter Polypeptide (OATP) family; This family consists of several ...
28-156 3.19e-03

Organic Anion Transporter Polypeptide (OATP) family; This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters.


Pssm-ID: 251753 [Multi-domain]  Cd Length: 583  Bit Score: 38.44  E-value: 3.19e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    28 VAGVLTQVQTYYNISDSLGGLIQTVFLISFMVFSPVCGYLGDRFNR-KWIMIIGVGIWLGAVL----------------- 89
Cdd:pfam03137  22 FKSSITTIEKRFKISSSHSGIISSSYDIGNLLLIIFVSYFGSKGHRpRWIGIGGLLMALGSLLtalphflsgpysyeqtn 101
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092    90 ---GSSFVPAN--------------------------HFWLFLVLRSFVGIGEASYSNVAPSLISDmFNGQKRSTVFM-I 139
Cdd:pfam03137 102 ltgSNESSNSTlcthggalipspcqsegschkestslMWLLLFVGQLLRGIGATPIFTLGISYIDD-NVKSKNSPLYLgI 180
                         170
                  ....*....|....*..
gi 17539092   140 FYFAIPVGSGLGFIVGS 156
Cdd:pfam03137 181 LFTMAMFGPAIGFLLGS 197
NarK COG2223
Nitrate/nitrite transporter [Inorganic ion transport and metabolism]
65-187 6.35e-03

Nitrate/nitrite transporter [Inorganic ion transport and metabolism]


Pssm-ID: 225133 [Multi-domain]  Cd Length: 417  Bit Score: 37.63  E-value: 6.35e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539092  65 GYLGDRFNRKWIMIIGVGIWLGAVLGSSFVPANH-FWLFLVLRSFVGIGEASYSnVAPSLISDMFNGQKRSTVFMIFYfA 143
Cdd:COG2223  70 GFLTDRFGGRKWTILSMLLLLIPCLGLAFAVTYPsTWQLLVIGLLLGLAGASFA-VGMPNASFFFPKEKQGLALGIAG-A 147
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*.
gi 17539092 144 IPVGSGLGFIVGSNVAT--LTGHWQWGIRVSAIAGLIVMIALVLFT 187
Cdd:COG2223 148 GNLGVAVAQLVAPLVAVafGFLAWRNVAGIYVVALAIAAVLAWLGM 193
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH