NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|17229223|ref|NP_485771|]
View 

hypothetical protein all1731 [Nostoc sp. PCC 7120]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
268-523 2.10e-49

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


:

Pssm-ID: 238083  Cd Length: 254  Bit Score: 174.05  E-value: 2.10e-49
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223 268 TDTGPSRQRNEDACYPpsgtLLSKPPQPTALAIVCDGIGGHEGGNVASNLAIETIQKQVQQLTNVPPDHIEpslliADLE 347
Cdd:cd00143   6 SDKGGDRKTNEDAVVI----KPNLNNEDGGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDIE-----EALR 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223 348 RAAAVANDKISQRNDSENrqGRKRMGTTLVMALPIAHEMYITHVGDSRAYWITRHGCYQVTLDDDVASREVRLGYAVYRE 427
Cdd:cd00143  77 KAFLRADEEILEEAQDEP--DDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGG 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223 428 AVQQG---GSGSLVQALGMS---PSSSLHPTAQRFIL-DEDGVFLLTSDGLSDFDrvedyWETEILPILTGE--ENNIVN 498
Cdd:cd00143 155 RVSNGrvpGVLAVTRALGDFdlkPGVSAEPDVTVVKLtEDDDFLILASDGLWDVL-----SNQEAVDIVRSElaKEDLQE 229
                       250       260
                ....*....|....*....|....*
gi 17229223 499 VVERLVDIANTKNGHDNVTIALVNC 523
Cdd:cd00143 230 AAQELVDLALRRGSHDNITVVVVRL 254
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
8-535 6.68e-68

putative protein serine/threonine phosphatase; Provisional


:

Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 237.26  E-value: 6.68e-68
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223    8 LYCPNelCQAANPLTHKFCQRCSTPLPKRY-------------------------LWVV------------------GDS 44
Cdd:PRK14559   2 LICPQ--CQFENPNNNRFCQKCGTSLTHKPcpqcgtevpvdeahcpncgaetgtiWWAIiaqaspnsevlesgeatqQSE 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223   45 LSIGSTGEILADRYLIINQ---------------------SVVLDTKP-------GLLPQAPDL---------ENTHP-- 85
Cdd:PRK14559  80 SSLTPSSSPLYGSYLDPGQryqllasseeiptaaahtelqGRVLDCQPlqpspleALLEQLEDLlnpladpteVLPTLlw 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223   86 --------IRPYLRLIP-YRLNIPQVYgmlpitDGYVHS--QVLLLEksplfaDNLAQQVHLcseftDAWRYAT-SMRQ- 152
Cdd:PRK14559 160 qqlgipalAIPYLALQDqFPTEIPKIH------DAWQDGdlQVILLE------DRSHWQPLL-----DLWQDQTlPTLQi 222
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223  153 LHWLWQIANLWQPFKSEGVVSSLLNPYLLRV-EGPLVRLLELHSDST-TALELPQLGEFWQQLHQEAKPAIAEFVQQISH 230
Cdd:PRK14559 223 LYWLNQMTQLWKALEPWGCCQSLLELENLRVdEDQTLGLQQLYQDPPeQPPSLQDLGQVWQQLFTQSQRTQFESLIPLLQ 302
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223  231 LLIQGEIKSSEVLVAVLDRGLAEL-------------------SKSQT-------------PT-------IQI--ATKTD 269
Cdd:PRK14559 303 DLQSGKIQTIAQLRLRLQELATELeaegeaefestegettlapSILQSddsespihetedaPTavlpmqlVSLedAGRTD 382
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223  270 TGPSRQRNEDA---------CYPPSGTLLskppQPTALAIVCDGIGGHEGGNVASNLAIETIQKQVQQ-LTNVPPDHiep 339
Cdd:PRK14559 383 VGRQRHHNEDYfgintriqkLENPHGRIV----QARGLYILCDGMGGHAAGEVASALAVETLQQYFQQhWQDELPDE--- 455
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223  340 slliADLERAAAVANDKISQRNDSENRQGRKRMGTTLVMALPIAHEMYITHVGDSRAYWITRH-GCYQVTLDDDVASREV 418
Cdd:PRK14559 456 ----ETIREAIYLANEAIYDLNQQNARSGSGRMGTTLVMALVQDTQVAVAHVGDSRLYRVTRKgGLEQLTVDHEVGQREI 531
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223  419 RLG------YAvyR-EAVQqggsgsLVQALGMSPSSSLHPTAQRFILDEDGVFLLTSDGLSDFDRVEDYWETEILPILTg 491
Cdd:PRK14559 532 QRGvepqiaYA--RpDAYQ------LTQALGPRDNSAIQPDIQFLEIEEDTLLLLCSDGLSDNDLLETHWQTHLLPLLS- 602
                        650       660       670       680
                 ....*....|....*....|....*....|....*....|....
gi 17229223  492 EENNIVNVVERLVDIANTKNGHDNVTIALVNCRIKytePQITLK 535
Cdd:PRK14559 603 SSANLDQGLNKLIDLANQYNGHDNITAILVRLKVR---PQLSLE 643
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
268-523 2.10e-49

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 174.05  E-value: 2.10e-49
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223 268 TDTGPSRQRNEDACYPpsgtLLSKPPQPTALAIVCDGIGGHEGGNVASNLAIETIQKQVQQLTNVPPDHIEpslliADLE 347
Cdd:cd00143   6 SDKGGDRKTNEDAVVI----KPNLNNEDGGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDIE-----EALR 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223 348 RAAAVANDKISQRNDSENrqGRKRMGTTLVMALPIAHEMYITHVGDSRAYWITRHGCYQVTLDDDVASREVRLGYAVYRE 427
Cdd:cd00143  77 KAFLRADEEILEEAQDEP--DDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGG 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223 428 AVQQG---GSGSLVQALGMS---PSSSLHPTAQRFIL-DEDGVFLLTSDGLSDFDrvedyWETEILPILTGE--ENNIVN 498
Cdd:cd00143 155 RVSNGrvpGVLAVTRALGDFdlkPGVSAEPDVTVVKLtEDDDFLILASDGLWDVL-----SNQEAVDIVRSElaKEDLQE 229
                       250       260
                ....*....|....*....|....*
gi 17229223 499 VVERLVDIANTKNGHDNVTIALVNC 523
Cdd:cd00143 230 AAQELVDLALRRGSHDNITVVVVRL 254
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
255-531 2.61e-68

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 227.24  E-value: 2.61e-68
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223 255 SKSQTPTIQIATKTDTGPSRQRNEDACYPPsgtlLSKPPQPTALAIVCDGIGGHEGGNVASNLAIETIQKQVQQLTNVPP 334
Cdd:COG0631   1 SSSGILSLKVAGLSDVGTVRKHNEDAFLIK----PNENGNLLLLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSL 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223 335 DHIepslLIADLERAAAVANDKISQRNDseNRQGRKRMGTTLVMALPIAHEMYITHVGDSRAYWITRHGCYQVTLDDDVA 414
Cdd:COG0631  77 NES----LEELLKEAILKANEAIAEEGQ--LNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLV 150
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223 415 SREVRLGYAVYREAVQQGGSGSLVQALGMSPssSLHPTAQRFILDEDGVFLLTSDGLSDFdrVEDyweTEILPILTGEEn 494
Cdd:COG0631 151 NRLEQRGIITPEEARSHPRRNALTRALGDFD--LLEPDITELELEPGDFLLLCSDGLWDV--VSD---DEIVDILKNSE- 222
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 17229223 495 NIVNVVERLVDIANTKNGHDNVTIALVNCRIKYTEPQ 531
Cdd:COG0631 223 TPQEAADKLIELALEGGGPDNITVVLVRLNGEGETSR 259
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
267-521 3.45e-21

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 93.59  E-value: 3.45e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223    267 KTDTGPSRQRNEDACYPpsgtlLSKPPQPTALAIVCDGIGGHEGGNVASNLAIETIQKQVQQLTNvppdhiEPSLLIADL 346
Cdd:smart00332  13 LSSMQGVRKPMEDAHVI-----TPDLSDSGGFFGVFDGHGGSEAAKFLSKNLPEILAEELIKEKD------ELEDVEEAL 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223    347 ERAAAVANDKISQRNDSenrqgrkRMGTTLVMALpIAHE-MYITHVGDSRAYWITRHGCYQVTLD-----DDVASREVRL 420
Cdd:smart00332  82 RKAFLSTDEEILEELEA-------LSGSTAVVAL-ISGNkLYVANVGDSRAVLCRNGKAVQLTEDhkpsnEDERARIEAA 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223    421 GYAVYREAVQqgGSGSLVQALG----MSPSSSLHPTAQRFILDEDGVFLLTSDGLSDF---DRVEDYWETEIlpiltgeE 493
Cdd:smart00332 154 GGFVINGRVN--GVLALSRAIGdfflKPYVSAEPDVTVVELTEKDDFLILASDGLWDVlsnQEVVDIVRKHL-------S 224
                          250       260
                   ....*....|....*....|....*...
gi 17229223    494 NNIVNVVERLVDIANTKNGHDNVTIALV 521
Cdd:smart00332 225 KDPKEAAKRLIDLALARGSKDNITVVVV 252
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
274-516 5.64e-10

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 59.30  E-value: 5.64e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223   274 RQRNEDA--CYPPSGTLLSKPPqpTALAIVCDGIGGHEGGNVASNLAIETIQKQvqqltnvppdhiEPSLLIADLERAAA 351
Cdd:pfam00481  12 RKSMEDAhiDGKNLNSSSGKDS--WSFFAVFDGHGGSEAAKYAGKHLHTILALR------------RSFLTLRKLEDALR 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223   352 VANDKISQRNDSEN-RQGRKRMGTTLVMALPIAHEMYITHVGDSRAYwITRHGCYQVTL-------DDDVASREVRLGYA 423
Cdd:pfam00481  78 ESFLETDEELRSDAaNHEDLSSGSTAVVALIRGNKLYVANVGDSRAV-LCRNGGAIKQLtedhkpsDEDERRRIRAAGGF 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223   424 VYREAvQQGGSGSLVQALG----MSPSSSLHP---TAQRFILDEDGVFLLTSDGLsdFDRVEDyweTEILPILTGEENNI 496
Cdd:pfam00481 157 VSRNG-RVNGVLAVSRAFGdfdlKPGEQPVSAepdITSHKITEDDEFLILACDGL--WDVLSD---QEVVDIVRSNLSDG 230
                         250       260
                  ....*....|....*....|...
gi 17229223   497 V---NVVERLVDIANTKNGHDNV 516
Cdd:pfam00481 231 GdpmEAAEKLVDEAIAYGSEDNI 253
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
8-535 6.68e-68

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 237.26  E-value: 6.68e-68
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223    8 LYCPNelCQAANPLTHKFCQRCSTPLPKRY-------------------------LWVV------------------GDS 44
Cdd:PRK14559   2 LICPQ--CQFENPNNNRFCQKCGTSLTHKPcpqcgtevpvdeahcpncgaetgtiWWAIiaqaspnsevlesgeatqQSE 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223   45 LSIGSTGEILADRYLIINQ---------------------SVVLDTKP-------GLLPQAPDL---------ENTHP-- 85
Cdd:PRK14559  80 SSLTPSSSPLYGSYLDPGQryqllasseeiptaaahtelqGRVLDCQPlqpspleALLEQLEDLlnpladpteVLPTLlw 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223   86 --------IRPYLRLIP-YRLNIPQVYgmlpitDGYVHS--QVLLLEksplfaDNLAQQVHLcseftDAWRYAT-SMRQ- 152
Cdd:PRK14559 160 qqlgipalAIPYLALQDqFPTEIPKIH------DAWQDGdlQVILLE------DRSHWQPLL-----DLWQDQTlPTLQi 222
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223  153 LHWLWQIANLWQPFKSEGVVSSLLNPYLLRV-EGPLVRLLELHSDST-TALELPQLGEFWQQLHQEAKPAIAEFVQQISH 230
Cdd:PRK14559 223 LYWLNQMTQLWKALEPWGCCQSLLELENLRVdEDQTLGLQQLYQDPPeQPPSLQDLGQVWQQLFTQSQRTQFESLIPLLQ 302
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223  231 LLIQGEIKSSEVLVAVLDRGLAEL-------------------SKSQT-------------PT-------IQI--ATKTD 269
Cdd:PRK14559 303 DLQSGKIQTIAQLRLRLQELATELeaegeaefestegettlapSILQSddsespihetedaPTavlpmqlVSLedAGRTD 382
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223  270 TGPSRQRNEDA---------CYPPSGTLLskppQPTALAIVCDGIGGHEGGNVASNLAIETIQKQVQQ-LTNVPPDHiep 339
Cdd:PRK14559 383 VGRQRHHNEDYfgintriqkLENPHGRIV----QARGLYILCDGMGGHAAGEVASALAVETLQQYFQQhWQDELPDE--- 455
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223  340 slliADLERAAAVANDKISQRNDSENRQGRKRMGTTLVMALPIAHEMYITHVGDSRAYWITRH-GCYQVTLDDDVASREV 418
Cdd:PRK14559 456 ----ETIREAIYLANEAIYDLNQQNARSGSGRMGTTLVMALVQDTQVAVAHVGDSRLYRVTRKgGLEQLTVDHEVGQREI 531
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223  419 RLG------YAvyR-EAVQqggsgsLVQALGMSPSSSLHPTAQRFILDEDGVFLLTSDGLSDFDRVEDYWETEILPILTg 491
Cdd:PRK14559 532 QRGvepqiaYA--RpDAYQ------LTQALGPRDNSAIQPDIQFLEIEEDTLLLLCSDGLSDNDLLETHWQTHLLPLLS- 602
                        650       660       670       680
                 ....*....|....*....|....*....|....*....|....
gi 17229223  492 EENNIVNVVERLVDIANTKNGHDNVTIALVNCRIKytePQITLK 535
Cdd:PRK14559 603 SSANLDQGLNKLIDLANQYNGHDNITAILVRLKVR---PQLSLE 643
DZR pfam12773
Double zinc ribbon; This family consists of a pair of zinc ribbon domains.
10-36 1.16e-03

Double zinc ribbon; This family consists of a pair of zinc ribbon domains.


Pssm-ID: 257289 [Multi-domain]  Cd Length: 45  Bit Score: 37.79  E-value: 1.16e-03
                          10        20
                  ....*....|....*....|....*..
gi 17229223    10 CPNelCQAANPLTHKFCQRCSTPLPKR 36
Cdd:pfam12773   1 CPN--CGAENPSGAKFCPHCGTSLPPR 25
PRK07418 PRK07418
acetolactate synthase 3 catalytic subunit; Reviewed
1-33 6.30e-03

acetolactate synthase 3 catalytic subunit; Reviewed


Pssm-ID: 236014 [Multi-domain]  Cd Length: 616  Bit Score: 38.49  E-value: 6.30e-03
                         10        20        30
                 ....*....|....*....|....*....|...
gi 17229223    1 MENDAATLYCPNelCQAANPLTHKFCQRCSTPL 33
Cdd:PRK07418 586 LALAAELIYCSN--CGAKNPSTHRFCPECGTKL 616
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
268-523 2.10e-49

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 174.05  E-value: 2.10e-49
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223 268 TDTGPSRQRNEDACYPpsgtLLSKPPQPTALAIVCDGIGGHEGGNVASNLAIETIQKQVQQLTNVPPDHIEpslliADLE 347
Cdd:cd00143   6 SDKGGDRKTNEDAVVI----KPNLNNEDGGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDIE-----EALR 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223 348 RAAAVANDKISQRNDSENrqGRKRMGTTLVMALPIAHEMYITHVGDSRAYWITRHGCYQVTLDDDVASREVRLGYAVYRE 427
Cdd:cd00143  77 KAFLRADEEILEEAQDEP--DDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGG 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223 428 AVQQG---GSGSLVQALGMS---PSSSLHPTAQRFIL-DEDGVFLLTSDGLSDFDrvedyWETEILPILTGE--ENNIVN 498
Cdd:cd00143 155 RVSNGrvpGVLAVTRALGDFdlkPGVSAEPDVTVVKLtEDDDFLILASDGLWDVL-----SNQEAVDIVRSElaKEDLQE 229
                       250       260
                ....*....|....*....|....*
gi 17229223 499 VVERLVDIANTKNGHDNVTIALVNC 523
Cdd:cd00143 230 AAQELVDLALRRGSHDNITVVVVRL 254
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
255-531 2.61e-68

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 227.24  E-value: 2.61e-68
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223 255 SKSQTPTIQIATKTDTGPSRQRNEDACYPPsgtlLSKPPQPTALAIVCDGIGGHEGGNVASNLAIETIQKQVQQLTNVPP 334
Cdd:COG0631   1 SSSGILSLKVAGLSDVGTVRKHNEDAFLIK----PNENGNLLLLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSL 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223 335 DHIepslLIADLERAAAVANDKISQRNDseNRQGRKRMGTTLVMALPIAHEMYITHVGDSRAYWITRHGCYQVTLDDDVA 414
Cdd:COG0631  77 NES----LEELLKEAILKANEAIAEEGQ--LNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLV 150
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223 415 SREVRLGYAVYREAVQQGGSGSLVQALGMSPssSLHPTAQRFILDEDGVFLLTSDGLSDFdrVEDyweTEILPILTGEEn 494
Cdd:COG0631 151 NRLEQRGIITPEEARSHPRRNALTRALGDFD--LLEPDITELELEPGDFLLLCSDGLWDV--VSD---DEIVDILKNSE- 222
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 17229223 495 NIVNVVERLVDIANTKNGHDNVTIALVNCRIKYTEPQ 531
Cdd:COG0631 223 TPQEAADKLIELALEGGGPDNITVVLVRLNGEGETSR 259
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
267-521 3.45e-21

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 93.59  E-value: 3.45e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223    267 KTDTGPSRQRNEDACYPpsgtlLSKPPQPTALAIVCDGIGGHEGGNVASNLAIETIQKQVQQLTNvppdhiEPSLLIADL 346
Cdd:smart00332  13 LSSMQGVRKPMEDAHVI-----TPDLSDSGGFFGVFDGHGGSEAAKFLSKNLPEILAEELIKEKD------ELEDVEEAL 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223    347 ERAAAVANDKISQRNDSenrqgrkRMGTTLVMALpIAHE-MYITHVGDSRAYWITRHGCYQVTLD-----DDVASREVRL 420
Cdd:smart00332  82 RKAFLSTDEEILEELEA-------LSGSTAVVAL-ISGNkLYVANVGDSRAVLCRNGKAVQLTEDhkpsnEDERARIEAA 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223    421 GYAVYREAVQqgGSGSLVQALG----MSPSSSLHPTAQRFILDEDGVFLLTSDGLSDF---DRVEDYWETEIlpiltgeE 493
Cdd:smart00332 154 GGFVINGRVN--GVLALSRAIGdfflKPYVSAEPDVTVVELTEKDDFLILASDGLWDVlsnQEVVDIVRKHL-------S 224
                          250       260
                   ....*....|....*....|....*...
gi 17229223    494 NNIVNVVERLVDIANTKNGHDNVTIALV 521
Cdd:smart00332 225 KDPKEAAKRLIDLALARGSKDNITVVVV 252
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
298-493 1.54e-14

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 72.38  E-value: 1.54e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223    298 LAIVCDGIGGHEGGNVASNLAIETIQKQVQQltnvppdHIEPSLLIADLERAAavandkisqrndseNRQGRKRMGTTLV 377
Cdd:smart00331  32 LIAIADVMGKGLAAALAMSMARSALRTLLSE-------GISLSQILERLNRAI--------------YENGEDGMFATLF 90
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223    378 MAL--PIAHEMYITHVGDSRAYWITRHGCYQVTLDDdvasrevrlgyavyreavqqggsgsLVQALGMSPSSSlhPTAQR 455
Cdd:smart00331  91 LALydFAGGTLSYANAGHSPPYLLRADGGLVEDLDD-------------------------LGAPLGLEPDVE--VDVRE 143
                          170       180       190
                   ....*....|....*....|....*....|....*...
gi 17229223    456 FILDEDGVFLLTSDGLsdFDRVEDYWETEILPILTGEE 493
Cdd:smart00331 144 LTLEPGDLLLLYTDGL--TEARNPERLEELLEELLGSP 179
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
274-516 5.64e-10

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 59.30  E-value: 5.64e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223   274 RQRNEDA--CYPPSGTLLSKPPqpTALAIVCDGIGGHEGGNVASNLAIETIQKQvqqltnvppdhiEPSLLIADLERAAA 351
Cdd:pfam00481  12 RKSMEDAhiDGKNLNSSSGKDS--WSFFAVFDGHGGSEAAKYAGKHLHTILALR------------RSFLTLRKLEDALR 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223   352 VANDKISQRNDSEN-RQGRKRMGTTLVMALPIAHEMYITHVGDSRAYwITRHGCYQVTL-------DDDVASREVRLGYA 423
Cdd:pfam00481  78 ESFLETDEELRSDAaNHEDLSSGSTAVVALIRGNKLYVANVGDSRAV-LCRNGGAIKQLtedhkpsDEDERRRIRAAGGF 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223   424 VYREAvQQGGSGSLVQALG----MSPSSSLHP---TAQRFILDEDGVFLLTSDGLsdFDRVEDyweTEILPILTGEENNI 496
Cdd:pfam00481 157 VSRNG-RVNGVLAVSRAFGdfdlKPGEQPVSAepdITSHKITEDDEFLILACDGL--WDVLSD---QEVVDIVRSNLSDG 230
                         250       260
                  ....*....|....*....|...
gi 17229223   497 V---NVVERLVDIANTKNGHDNV 516
Cdd:pfam00481 231 GdpmEAAEKLVDEAIAYGSEDNI 253
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
270-501 2.77e-08

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 53.47  E-value: 2.77e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223   270 TGPSRQR----NEDACYppsgtllSKPPQPTALAIVCDGIGGHEGGNVASNLAIETIQKQV-QQLTNVPPDHIEpsllia 344
Cdd:pfam13672   1 RGTSHIRrglpCQDAFA-------YRVLSDGWLIAVADGAGSAKYSDVGARLAVEAAVEALrELLDSGELPELE------ 67
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223   345 dlERAAAVANDKISQRNDSENRQGR--KRMGTTLVMALPIAHEMYITHVGDSRAYWITRHGCYQVTLDDDVAsrevrlGY 422
Cdd:pfam13672  68 --ALVRQILNDILALVRQEAAAQGLepRDYATTLLLAVITPGGIVFFQIGDGAIVVRDRDGELQLLSEPDSG------EY 139
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223   423 AvyreavqqGGSGSLvqalgmsPSSSLHPTAQRFILD-EDGV-FLLTSDGLSD-FDRVEDYWE--TEILPILTGEE--NN 495
Cdd:pfam13672 140 A--------NETTFL-------TSPDALEEFRIRRLTlEPGDaLALMTDGLSDsLVTEEPFFPffAPLLETLEEEGasEQ 204

                  ....*.
gi 17229223   496 IVNVVE 501
Cdd:pfam13672 205 LAEFLE 210
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
8-535 6.68e-68

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 237.26  E-value: 6.68e-68
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223    8 LYCPNelCQAANPLTHKFCQRCSTPLPKRY-------------------------LWVV------------------GDS 44
Cdd:PRK14559   2 LICPQ--CQFENPNNNRFCQKCGTSLTHKPcpqcgtevpvdeahcpncgaetgtiWWAIiaqaspnsevlesgeatqQSE 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223   45 LSIGSTGEILADRYLIINQ---------------------SVVLDTKP-------GLLPQAPDL---------ENTHP-- 85
Cdd:PRK14559  80 SSLTPSSSPLYGSYLDPGQryqllasseeiptaaahtelqGRVLDCQPlqpspleALLEQLEDLlnpladpteVLPTLlw 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223   86 --------IRPYLRLIP-YRLNIPQVYgmlpitDGYVHS--QVLLLEksplfaDNLAQQVHLcseftDAWRYAT-SMRQ- 152
Cdd:PRK14559 160 qqlgipalAIPYLALQDqFPTEIPKIH------DAWQDGdlQVILLE------DRSHWQPLL-----DLWQDQTlPTLQi 222
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223  153 LHWLWQIANLWQPFKSEGVVSSLLNPYLLRV-EGPLVRLLELHSDST-TALELPQLGEFWQQLHQEAKPAIAEFVQQISH 230
Cdd:PRK14559 223 LYWLNQMTQLWKALEPWGCCQSLLELENLRVdEDQTLGLQQLYQDPPeQPPSLQDLGQVWQQLFTQSQRTQFESLIPLLQ 302
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223  231 LLIQGEIKSSEVLVAVLDRGLAEL-------------------SKSQT-------------PT-------IQI--ATKTD 269
Cdd:PRK14559 303 DLQSGKIQTIAQLRLRLQELATELeaegeaefestegettlapSILQSddsespihetedaPTavlpmqlVSLedAGRTD 382
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223  270 TGPSRQRNEDA---------CYPPSGTLLskppQPTALAIVCDGIGGHEGGNVASNLAIETIQKQVQQ-LTNVPPDHiep 339
Cdd:PRK14559 383 VGRQRHHNEDYfgintriqkLENPHGRIV----QARGLYILCDGMGGHAAGEVASALAVETLQQYFQQhWQDELPDE--- 455
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223  340 slliADLERAAAVANDKISQRNDSENRQGRKRMGTTLVMALPIAHEMYITHVGDSRAYWITRH-GCYQVTLDDDVASREV 418
Cdd:PRK14559 456 ----ETIREAIYLANEAIYDLNQQNARSGSGRMGTTLVMALVQDTQVAVAHVGDSRLYRVTRKgGLEQLTVDHEVGQREI 531
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17229223  419 RLG------YAvyR-EAVQqggsgsLVQALGMSPSSSLHPTAQRFILDEDGVFLLTSDGLSDFDRVEDYWETEILPILTg 491
Cdd:PRK14559 532 QRGvepqiaYA--RpDAYQ------LTQALGPRDNSAIQPDIQFLEIEEDTLLLLCSDGLSDNDLLETHWQTHLLPLLS- 602
                        650       660       670       680
                 ....*....|....*....|....*....|....*....|....
gi 17229223  492 EENNIVNVVERLVDIANTKNGHDNVTIALVNCRIKytePQITLK 535
Cdd:PRK14559 603 SSANLDQGLNKLIDLANQYNGHDNITAILVRLKVR---PQLSLE 643
DZR pfam12773
Double zinc ribbon; This family consists of a pair of zinc ribbon domains.
10-36 1.16e-03

Double zinc ribbon; This family consists of a pair of zinc ribbon domains.


Pssm-ID: 257289 [Multi-domain]  Cd Length: 45  Bit Score: 37.79  E-value: 1.16e-03
                          10        20
                  ....*....|....*....|....*..
gi 17229223    10 CPNelCQAANPLTHKFCQRCSTPLPKR 36
Cdd:pfam12773   1 CPN--CGAENPSGAKFCPHCGTSLPPR 25
PRK07418 PRK07418
acetolactate synthase 3 catalytic subunit; Reviewed
1-33 6.30e-03

acetolactate synthase 3 catalytic subunit; Reviewed


Pssm-ID: 236014 [Multi-domain]  Cd Length: 616  Bit Score: 38.49  E-value: 6.30e-03
                         10        20        30
                 ....*....|....*....|....*....|...
gi 17229223    1 MENDAATLYCPNelCQAANPLTHKFCQRCSTPL 33
Cdd:PRK07418 586 LALAAELIYCSN--CGAKNPSTHRFCPECGTKL 616
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH