NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|169627144|ref|YP_001700793|]
View 

Possible serine/threonine phosphatase Ppp [Mycobacterium abscessus]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
6-227 4.18e-48

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


:

Pssm-ID: 238083  Cd Length: 254  Bit Score: 167.89  E-value: 4.18e-48
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144   6 RYAARSDRGLVRSNNEDSVYA-------GARLLALADGMGGHAAGEVASQLV---IAALAPLDDDEPGGDLLDALADAVH 75
Cdd:cd00143    1 FSAGVSDKGGDRKTNEDAVVIkpnlnneDGGLFGVFDGHGGHAAGEFASKLLveeLLEELEETLTLSEEDIEEALRKAFL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144  76 AGNGAIADHVRAEPELDGMGTTLTAFLFAGKRLGMVHIGDSRAYLMRDGELTQISKDDTFVQtLVDEGRITPEQAH---- 151
Cdd:cd00143   81 RADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVN-EEERERIEKAGGRvsng 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144 152 NHPQRSLIMRAL------TGAPVEPTLIMRE-AHAGDRYLLCSDGLSDPVSHETIAEAL----EIPDVSAAADRLIELAL 220
Cdd:cd00143  160 RVPGVLAVTRALgdfdlkPGVSAEPDVTVVKlTEDDDFLILASDGLWDVLSNQEAVDIVrselAKEDLQEAAQELVDLAL 239

                 ....*..
gi 169627144 221 RSGGPDN 227
Cdd:cd00143  240 RRGSHDN 246
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
6-227 4.18e-48

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 167.89  E-value: 4.18e-48
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144   6 RYAARSDRGLVRSNNEDSVYA-------GARLLALADGMGGHAAGEVASQLV---IAALAPLDDDEPGGDLLDALADAVH 75
Cdd:cd00143    1 FSAGVSDKGGDRKTNEDAVVIkpnlnneDGGLFGVFDGHGGHAAGEFASKLLveeLLEELEETLTLSEEDIEEALRKAFL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144  76 AGNGAIADHVRAEPELDGMGTTLTAFLFAGKRLGMVHIGDSRAYLMRDGELTQISKDDTFVQtLVDEGRITPEQAH---- 151
Cdd:cd00143   81 RADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVN-EEERERIEKAGGRvsng 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144 152 NHPQRSLIMRAL------TGAPVEPTLIMRE-AHAGDRYLLCSDGLSDPVSHETIAEAL----EIPDVSAAADRLIELAL 220
Cdd:cd00143  160 RVPGVLAVTRALgdfdlkPGVSAEPDVTVVKlTEDDDFLILASDGLWDVLSNQEAVDIVrselAKEDLQEAAQELVDLAL 239

                 ....*..
gi 169627144 221 RSGGPDN 227
Cdd:cd00143  240 RRGSHDN 246
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
1-227 1.04e-72

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 233.40  E-value: 1.04e-72
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144   1 MTLVLRYAARSDRGLVRSNNEDSVYAGAR-------LLALADGMGGHAAGEVASQLVIAALAPLDDDEPGGD----LLDA 69
Cdd:COG0631    4 GILSLKVAGLSDVGTVRKHNEDAFLIKPNengnlllLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSlnesLEEL 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144  70 LADAVHAGNGAIADHVRAEPELDGMGTTLTAFLFAGKRLGMVHIGDSRAYLMRDGELTQISKDDTFVQTLVDEGRITPEQ 149
Cdd:COG0631   84 LKEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEE 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144 150 AHNHPQRSLIMRALTGAP-VEPTLIMREAHAGDRYLLCSDGLSDPVSHETIAEAL-EIPDVSAAADRLIELALRSGGPDN 227
Cdd:COG0631  164 ARSHPRRNALTRALGDFDlLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILkNSETPQEAADKLIELALEGGGPDN 243
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
11-227 8.52e-30

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 116.32  E-value: 8.52e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144    11 SDRGLVRSNNEDSVYAGAR------LLALADGMGGHAAGEVASQLVIAALAplDDDEPGGDLLDALADAVHAGNGAIADH 84
Cdd:smart00332  14 SSMQGVRKPMEDAHVITPDlsdsggFFGVFDGHGGSEAAKFLSKNLPEILA--EELIKEKDELEDVEEALRKAFLSTDEE 91
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144    85 VRAEPElDGMGTTLTAFLFAGKRLGMVHIGDSRAYLMRDGELTQISKDDTFvqTLVDE-GRITPEQAHNHPQRSLIMRAL 163
Cdd:smart00332  92 ILEELE-ALSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKP--SNEDErARIEAAGGFVINGRVNGVLAL 168
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 169627144   164 TGAP----------VEPTLIMREAH-AGDRYLLCSDGLSDPVSHETIAEAL---EIPDVSAAADRLIELALRSGGPDN 227
Cdd:smart00332 169 SRAIgdfflkpyvsAEPDVTVVELTeKDDFLILASDGLWDVLSNQEVVDIVrkhLSKDPKEAAKRLIDLALARGSKDN 246
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
30-227 7.03e-14

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 70.08  E-value: 7.03e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144   30 LLALADGMGGHAAGEVASQLVIAALAPLDDDEPGGDLLDALADAVHAGNGAIADHvRAEPELDGMGTTLTAFLFAGKRLG 109
Cdd:pfam00481  36 FFAVFDGHGGSEAAKYAGKHLHTILALRRSFLTLRKLEDALRESFLETDEELRSD-AANHEDLSSGSTAVVALIRGNKLY 114
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144  110 MVHIGDSRAYLMRDGE-LTQISKDdtfvQTLVDE---GRItpEQA---HNHPQRSLIMRALTGA-----------PV--E 169
Cdd:pfam00481 115 VANVGDSRAVLCRNGGaIKQLTED----HKPSDEderRRI--RAAggfVSRNGRVNGVLAVSRAfgdfdlkpgeqPVsaE 188
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 169627144  170 PTLIMREAHAGDRYL-LCSDGLSDPVSHETIAE-----ALEIPDVSAAADRLIELALRSGGPDN 227
Cdd:pfam00481 189 PDITSHKITEDDEFLiLACDGLWDVLSDQEVVDivrsnLSDGGDPMEAAEKLVDEAIAYGSEDN 252
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
1-227 5.08e-22

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 98.20  E-value: 5.08e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144   1 MTLV-LRYAARSDRGLVRSNNEDsvYAG-----------------AR-LLALADGMGGHAAGEVASQLVIAAL-----AP 56
Cdd:PRK14559 370 MQLVsLEDAGRTDVGRQRHHNED--YFGintriqklenphgrivqARgLYILCDGMGGHAAGEVASALAVETLqqyfqQH 447
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144  57 LDDDEPGGDLLDalaDAVHAGNGAIADhVRAEPELDG---MGTTLTAFLFAGKRLGMVHIGDSRAY-LMRDGELTQISKD 132
Cdd:PRK14559 448 WQDELPDEETIR---EAIYLANEAIYD-LNQQNARSGsgrMGTTLVMALVQDTQVAVAHVGDSRLYrVTRKGGLEQLTVD 523
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144 133 DTFVQTLVDEGrITPEQAHNHPQRSLIMRALtgAP-----VEPTLIMREAHAGDRYLLCSDGLSDPVSHETIAEALEIPD 207
Cdd:PRK14559 524 HEVGQREIQRG-VEPQIAYARPDAYQLTQAL--GPrdnsaIQPDIQFLEIEEDTLLLLCSDGLSDNDLLETHWQTHLLPL 600
                        250       260
                 ....*....|....*....|....*.
gi 169627144 208 VSAAAD------RLIELALRSGGPDN 227
Cdd:PRK14559 601 LSSSANldqglnKLIDLANQYNGHDN 626
PLN03145 PLN03145
Protein phosphatase 2c; Provisional
11-132 5.58e-03

Protein phosphatase 2c; Provisional


Pssm-ID: 215603 [Multi-domain]  Cd Length: 365  Bit Score: 37.59  E-value: 5.58e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144  11 SDRGLVRSNNEDSVYAGarllaLADGMGG-HAAGEVASQLviaALAPLDDDEPGGDLLDALADAVHAGNGAIADHVRAEP 89
Cdd:PLN03145  91 SDFGLKNSEDGPSAFYG-----VFDGHGGkHAADFACYHL---PRFIVEDEDFPREIEKVVSSAFLQTDTAFAEACSLDA 162
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 169627144  90 ELdGMGTTLTAFLFAGKRLGMVHIGDSRAYLMRDGELTQISKD 132
Cdd:PLN03145 163 SL-ASGTTALAALVVGRSLVVANAGDCRAVLCRRGKAIEMSRD 204
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
6-227 4.18e-48

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 167.89  E-value: 4.18e-48
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144   6 RYAARSDRGLVRSNNEDSVYA-------GARLLALADGMGGHAAGEVASQLV---IAALAPLDDDEPGGDLLDALADAVH 75
Cdd:cd00143    1 FSAGVSDKGGDRKTNEDAVVIkpnlnneDGGLFGVFDGHGGHAAGEFASKLLveeLLEELEETLTLSEEDIEEALRKAFL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144  76 AGNGAIADHVRAEPELDGMGTTLTAFLFAGKRLGMVHIGDSRAYLMRDGELTQISKDDTFVQtLVDEGRITPEQAH---- 151
Cdd:cd00143   81 RADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVN-EEERERIEKAGGRvsng 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144 152 NHPQRSLIMRAL------TGAPVEPTLIMRE-AHAGDRYLLCSDGLSDPVSHETIAEAL----EIPDVSAAADRLIELAL 220
Cdd:cd00143  160 RVPGVLAVTRALgdfdlkPGVSAEPDVTVVKlTEDDDFLILASDGLWDVLSNQEAVDIVrselAKEDLQEAAQELVDLAL 239

                 ....*..
gi 169627144 221 RSGGPDN 227
Cdd:cd00143  240 RRGSHDN 246
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
1-227 1.04e-72

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 233.40  E-value: 1.04e-72
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144   1 MTLVLRYAARSDRGLVRSNNEDSVYAGAR-------LLALADGMGGHAAGEVASQLVIAALAPLDDDEPGGD----LLDA 69
Cdd:COG0631    4 GILSLKVAGLSDVGTVRKHNEDAFLIKPNengnlllLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSlnesLEEL 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144  70 LADAVHAGNGAIADHVRAEPELDGMGTTLTAFLFAGKRLGMVHIGDSRAYLMRDGELTQISKDDTFVQTLVDEGRITPEQ 149
Cdd:COG0631   84 LKEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEE 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144 150 AHNHPQRSLIMRALTGAP-VEPTLIMREAHAGDRYLLCSDGLSDPVSHETIAEAL-EIPDVSAAADRLIELALRSGGPDN 227
Cdd:COG0631  164 ARSHPRRNALTRALGDFDlLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILkNSETPQEAADKLIELALEGGGPDN 243
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
11-227 8.52e-30

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 116.32  E-value: 8.52e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144    11 SDRGLVRSNNEDSVYAGAR------LLALADGMGGHAAGEVASQLVIAALAplDDDEPGGDLLDALADAVHAGNGAIADH 84
Cdd:smart00332  14 SSMQGVRKPMEDAHVITPDlsdsggFFGVFDGHGGSEAAKFLSKNLPEILA--EELIKEKDELEDVEEALRKAFLSTDEE 91
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144    85 VRAEPElDGMGTTLTAFLFAGKRLGMVHIGDSRAYLMRDGELTQISKDDTFvqTLVDE-GRITPEQAHNHPQRSLIMRAL 163
Cdd:smart00332  92 ILEELE-ALSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKP--SNEDErARIEAAGGFVINGRVNGVLAL 168
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 169627144   164 TGAP----------VEPTLIMREAH-AGDRYLLCSDGLSDPVSHETIAEAL---EIPDVSAAADRLIELALRSGGPDN 227
Cdd:smart00332 169 SRAIgdfflkpyvsAEPDVTVVELTeKDDFLILASDGLWDVLSNQEVVDIVrkhLSKDPKEAAKRLIDLALARGSKDN 246
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
11-221 7.19e-22

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 92.80  E-value: 7.19e-22
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144    11 SDRGLVRSNNEDSVY------------AGARLLALADGMG-GHAAGEVASQLVIAALAPLDDDEPGGDLLDALADAVHAG 77
Cdd:smart00331   1 DDGGLIAQYYEDATQvggdfydvvklpEGRLLIAIADVMGkGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYEN 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144    78 ngaiadhvraepELDGMGTTLTA--FLFAGKRLGMVHIGDSRAYLMRDgeltqiskDDTFVQTLVDEGritpeqahnhpq 155
Cdd:smart00331  81 ------------GEDGMFATLFLalYDFAGGTLSYANAGHSPPYLLRA--------DGGLVEDLDDLG------------ 128
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 169627144   156 rslimrALTGAPVEPTLIMREAH--AGDRYLLCSDGLSDPVSHETIAEALE---IPDVSAAADRLIELALR 221
Cdd:smart00331 129 ------APLGLEPDVEVDVRELTlePGDLLLLYTDGLTEARNPERLEELLEellGSPPAEIAQRILEELLE 193
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
30-227 7.03e-14

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 70.08  E-value: 7.03e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144   30 LLALADGMGGHAAGEVASQLVIAALAPLDDDEPGGDLLDALADAVHAGNGAIADHvRAEPELDGMGTTLTAFLFAGKRLG 109
Cdd:pfam00481  36 FFAVFDGHGGSEAAKYAGKHLHTILALRRSFLTLRKLEDALRESFLETDEELRSD-AANHEDLSSGSTAVVALIRGNKLY 114
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144  110 MVHIGDSRAYLMRDGE-LTQISKDdtfvQTLVDE---GRItpEQA---HNHPQRSLIMRALTGA-----------PV--E 169
Cdd:pfam00481 115 VANVGDSRAVLCRNGGaIKQLTED----HKPSDEderRRI--RAAggfVSRNGRVNGVLAVSRAfgdfdlkpgeqPVsaE 188
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 169627144  170 PTLIMREAHAGDRYL-LCSDGLSDPVSHETIAE-----ALEIPDVSAAADRLIELALRSGGPDN 227
Cdd:pfam00481 189 PDITSHKITEDDEFLiLACDGLWDVLSDQEVVDivrsnLSDGGDPMEAAEKLVDEAIAYGSEDN 252
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
18-198 3.33e-13

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 67.72  E-value: 3.33e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144   18 SNNEDSVYA----GARLLALADGMGGHAAGEVASQL----VIAALAPLDDDEPGGDLLDALADAVHagngAIADHVRAEP 89
Cdd:pfam13672  10 LPCQDAFAYrvlsDGWLIAVADGAGSAKYSDVGARLaveaAVEALRELLDSGELPELEALVRQILN----DILALVRQEA 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144   90 ELDGM-----GTTLTAFLFAGKRLGMVHIGDSRAYLM-RDGELTQISKDDT--FVQTLVdegRITPEQAHNHPQrsliMR 161
Cdd:pfam13672  86 AAQGLeprdyATTLLLAVITPGGIVFFQIGDGAIVVRdRDGELQLLSEPDSgeYANETT---FLTSPDALEEFR----IR 158
                         170       180       190
                  ....*....|....*....|....*....|....*..
gi 169627144  162 ALTGAPveptlimreahaGDRYLLCSDGLSDPVSHET 198
Cdd:pfam13672 159 RLTLEP------------GDALALMTDGLSDSLVTEE 183
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
1-227 5.08e-22

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 98.20  E-value: 5.08e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144   1 MTLV-LRYAARSDRGLVRSNNEDsvYAG-----------------AR-LLALADGMGGHAAGEVASQLVIAAL-----AP 56
Cdd:PRK14559 370 MQLVsLEDAGRTDVGRQRHHNED--YFGintriqklenphgrivqARgLYILCDGMGGHAAGEVASALAVETLqqyfqQH 447
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144  57 LDDDEPGGDLLDalaDAVHAGNGAIADhVRAEPELDG---MGTTLTAFLFAGKRLGMVHIGDSRAY-LMRDGELTQISKD 132
Cdd:PRK14559 448 WQDELPDEETIR---EAIYLANEAIYD-LNQQNARSGsgrMGTTLVMALVQDTQVAVAHVGDSRLYrVTRKGGLEQLTVD 523
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144 133 DTFVQTLVDEGrITPEQAHNHPQRSLIMRALtgAP-----VEPTLIMREAHAGDRYLLCSDGLSDPVSHETIAEALEIPD 207
Cdd:PRK14559 524 HEVGQREIQRG-VEPQIAYARPDAYQLTQAL--GPrdnsaIQPDIQFLEIEEDTLLLLCSDGLSDNDLLETHWQTHLLPL 600
                        250       260
                 ....*....|....*....|....*.
gi 169627144 208 VSAAAD------RLIELALRSGGPDN 227
Cdd:PRK14559 601 LSSSANldqglnKLIDLANQYNGHDN 626
PLN03145 PLN03145
Protein phosphatase 2c; Provisional
11-132 5.58e-03

Protein phosphatase 2c; Provisional


Pssm-ID: 215603 [Multi-domain]  Cd Length: 365  Bit Score: 37.59  E-value: 5.58e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 169627144  11 SDRGLVRSNNEDSVYAGarllaLADGMGG-HAAGEVASQLviaALAPLDDDEPGGDLLDALADAVHAGNGAIADHVRAEP 89
Cdd:PLN03145  91 SDFGLKNSEDGPSAFYG-----VFDGHGGkHAADFACYHL---PRFIVEDEDFPREIEKVVSSAFLQTDTAFAEACSLDA 162
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 169627144  90 ELdGMGTTLTAFLFAGKRLGMVHIGDSRAYLMRDGELTQISKD 132
Cdd:PLN03145 163 SL-ASGTTALAALVVGRSLVVANAGDCRAVLCRRGKAIEMSRD 204
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH