NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|16802937|ref|NP_464422|]
View 

indirect negative regulation of sigma B dependant gene expression (serine phosphatase) [Listeria monocytogenes EGD-e]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
7-170 1.05e-35

Sigma factor PP2C-like phosphatases;


:

Pssm-ID: 214624  Cd Length: 193  Bit Score: 125.54  E-value: 1.05e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16802937      7 SNNLFVFQRSKALQQYCGDVYYTHEDENG-FLYVLSDGLGSGLEANRAAKATVDAIKEDIHADIT--DMLEKANQAVSGL 83
Cdd:smart00331   1 DDGGLIAQYYEDATQVGGDFYDVVKLPEGrLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISlsQILERLNRAIYEN 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16802937     84 ----RGAAIAIIKGDYLTKTLYYTGMGNIRFYMIGIEDKLIFPLSGSGFLSGRKQ--KYRLQSFKYKPDSKFLMHSDGLV 157
Cdd:smart00331  81 gedgMFATLFLALYDFAGGTLSYANAGHSPPYLLRADGGLVEDLDDLGAPLGLEPdvEVDVRELTLEPGDLLLLYTDGLT 160
                          170
                   ....*....|...
gi 16802937    158 LSRVRKSLESPLC 170
Cdd:smart00331 161 EARNPERLEELLE 173
 
Name Accession Description Interval E-value
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
7-170 1.05e-35

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 125.54  E-value: 1.05e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16802937      7 SNNLFVFQRSKALQQYCGDVYYTHEDENG-FLYVLSDGLGSGLEANRAAKATVDAIKEDIHADIT--DMLEKANQAVSGL 83
Cdd:smart00331   1 DDGGLIAQYYEDATQVGGDFYDVVKLPEGrLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISlsQILERLNRAIYEN 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16802937     84 ----RGAAIAIIKGDYLTKTLYYTGMGNIRFYMIGIEDKLIFPLSGSGFLSGRKQ--KYRLQSFKYKPDSKFLMHSDGLV 157
Cdd:smart00331  81 gedgMFATLFLALYDFAGGTLSYANAGHSPPYLLRADGGLVEDLDDLGAPLGLEPdvEVDVRELTLEPGDLLLLYTDGLT 160
                          170
                   ....*....|...
gi 16802937    158 LSRVRKSLESPLC 170
Cdd:smart00331 161 EARNPERLEELLE 173
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
39-157 5.95e-04

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 284611  Cd Length: 190  Bit Score: 38.00  E-value: 5.95e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16802937    39 VLSDGLGSGLEANRAAKATVDAIKE--DIHADITDMLEKANQAVS----GLRGAAIAIIKGDYLTKTLYYTGMGNIRFYM 112
Cdd:pfam07228   7 VIGDVMGHGLPAALLMGMLRTALRAlaAEGLDPAEVLKRLNRLLQrnleEDMFATAVLAVYDPETGTLEYANAGHPPPLL 86
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*..
gi 16802937   113 IGIEDKLIFPLSGSGFLSG--RKQKYRLQSFKYKPDSKFLMHSDGLV 157
Cdd:pfam07228  87 LRPDGGVVELLESTGLPLGilPDADYEVVELELEPGDTLLLYTDGLT 133
 
Name Accession Description Interval E-value
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
7-170 1.05e-35

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 125.54  E-value: 1.05e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16802937      7 SNNLFVFQRSKALQQYCGDVYYTHEDENG-FLYVLSDGLGSGLEANRAAKATVDAIKEDIHADIT--DMLEKANQAVSGL 83
Cdd:smart00331   1 DDGGLIAQYYEDATQVGGDFYDVVKLPEGrLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISlsQILERLNRAIYEN 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16802937     84 ----RGAAIAIIKGDYLTKTLYYTGMGNIRFYMIGIEDKLIFPLSGSGFLSGRKQ--KYRLQSFKYKPDSKFLMHSDGLV 157
Cdd:smart00331  81 gedgMFATLFLALYDFAGGTLSYANAGHSPPYLLRADGGLVEDLDDLGAPLGLEPdvEVDVRELTLEPGDLLLLYTDGLT 160
                          170
                   ....*....|...
gi 16802937    158 LSRVRKSLESPLC 170
Cdd:smart00331 161 EARNPERLEELLE 173
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
39-157 5.95e-04

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 284611  Cd Length: 190  Bit Score: 38.00  E-value: 5.95e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16802937    39 VLSDGLGSGLEANRAAKATVDAIKE--DIHADITDMLEKANQAVS----GLRGAAIAIIKGDYLTKTLYYTGMGNIRFYM 112
Cdd:pfam07228   7 VIGDVMGHGLPAALLMGMLRTALRAlaAEGLDPAEVLKRLNRLLQrnleEDMFATAVLAVYDPETGTLEYANAGHPPPLL 86
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*..
gi 16802937   113 IGIEDKLIFPLSGSGFLSG--RKQKYRLQSFKYKPDSKFLMHSDGLV 157
Cdd:pfam07228  87 LRPDGGVVELLESTGLPLGilPDADYEVVELELEPGDTLLLYTDGLT 133
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH