NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|166367204|ref|YP_001659477|]
View 

protein serin/threonin phosphatase [Microcystis aeruginosa NIES-843]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
6-238 1.83e-53

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


:

Pssm-ID: 238083  Cd Length: 254  Bit Score: 174.82  E-value: 1.83e-53
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204   6 FGGMTDPGVVRSVNQDSYYIDPER-----RFFIVADGMGGHAGGQEASQIATETIQAHLEEHWN-SPRAAGELLQEAITA 79
Cdd:cd00143    2 SAGVSDKGGDRKTNEDAVVIKPNLnnedgGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTlSEEDIEEALRKAFLR 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204  80 ANEKIIEDQLKNPERQEMGTTLVIAIFRDDGSWYTHIGDSRLYRFREQKLEQVTEDHTLIARAIKMGDMSEE---DAKNS 156
Cdd:cd00143   82 ADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGgrvSNGRV 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204 157 PYRHILLKCLGRPGLLP-VTVSPlDVQ------SGDSLILCSDGLTEEVSDEEISDYLQ---TGADCQEIVENLVAAAKK 226
Cdd:cd00143  162 PGVLAVTRALGDFDLKPgVSAEP-DVTvvklteDDDFLILASDGLWDVLSNQEAVDIVRselAKEDLQEAAQELVDLALR 240
                        250
                 ....*....|..
gi 166367204 227 AGGSDNITVVMV 238
Cdd:cd00143  241 RGSHDNITVVVV 252
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
6-238 1.83e-53

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 174.82  E-value: 1.83e-53
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204   6 FGGMTDPGVVRSVNQDSYYIDPER-----RFFIVADGMGGHAGGQEASQIATETIQAHLEEHWN-SPRAAGELLQEAITA 79
Cdd:cd00143    2 SAGVSDKGGDRKTNEDAVVIKPNLnnedgGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTlSEEDIEEALRKAFLR 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204  80 ANEKIIEDQLKNPERQEMGTTLVIAIFRDDGSWYTHIGDSRLYRFREQKLEQVTEDHTLIARAIKMGDMSEE---DAKNS 156
Cdd:cd00143   82 ADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGgrvSNGRV 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204 157 PYRHILLKCLGRPGLLP-VTVSPlDVQ------SGDSLILCSDGLTEEVSDEEISDYLQ---TGADCQEIVENLVAAAKK 226
Cdd:cd00143  162 PGVLAVTRALGDFDLKPgVSAEP-DVTvvklteDDDFLILASDGLWDVLSNQEAVDIVRselAKEDLQEAAQELVDLALR 240
                        250
                 ....*....|..
gi 166367204 227 AGGSDNITVVMV 238
Cdd:cd00143  241 RGSHDNITVVVV 252
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
1-240 4.99e-80

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 243.42  E-value: 4.99e-80
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204   1 MNNLSFGGMTDPGVVRSVNQDSYYIDPERR-----FFIVADGMGGHAGGQEASQIATETIQAHLEEHWNSPRAAG--ELL 73
Cdd:COG0631    5 ILSLKVAGLSDVGTVRKHNEDAFLIKPNENgnlllLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSLNESleELL 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204  74 QEAITAANEKIIEDQLKNPERQEMGTTLVIAIFRDDGSWYTHIGDSRLYRFREQKLEQVTEDHTLIARAIKMGDMSEEDA 153
Cdd:COG0631   85 KEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEEA 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204 154 KNSPYRHILLKCLGRPGLLPVTVSPLDVQSGDSLILCSDGLTEEVSDEEISDYLQTGADCQEIVENLVAAAKKAGGSDNI 233
Cdd:COG0631  165 RSHPRRNALTRALGDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILKNSETPQEAADKLIELALEGGGPDNI 244

                 ....*..
gi 166367204 234 TVVMVSC 240
Cdd:COG0631  245 TVVLVRL 251
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
2-238 6.87e-42

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 144.83  E-value: 6.87e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204     2 NNLSFGGMTDPGVvRSVNQDSYYIDPERR----FFIVADGMGGHAGGQEASQIATETIQAHLEEHWNSPRAAGELLQEAI 77
Cdd:smart00332   7 LGLRYGLSSMQGV-RKPMEDAHVITPDLSdsggFFGVFDGHGGSEAAKFLSKNLPEILAEELIKEKDELEDVEEALRKAF 85
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204    78 TAANEKIIEDqlknpERQEMGTTLVIAIFRDDGSWYTHIGDSRLYRFREQKLEQVTEDHTLIaRAIKMGDMSEEDAKNSP 157
Cdd:smart00332  86 LSTDEEILEE-----LEALSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKPS-NEDERARIEAAGGFVIN 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204   158 YRHILLKCLGR--------PGLLP---VTVSPLdVQSGDSLILCSDGLTEEVSDEEISDYLQ--TGADCQEIVENLVAAA 224
Cdd:smart00332 160 GRVNGVLALSRaigdfflkPYVSAepdVTVVEL-TEKDDFLILASDGLWDVLSNQEVVDIVRkhLSKDPKEAAKRLIDLA 238
                          250
                   ....*....|....
gi 166367204   225 KKAGGSDNITVVMV 238
Cdd:smart00332 239 LARGSKDNITVVVV 252
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
17-233 1.32e-20

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 86.21  E-value: 1.32e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204   17 SVNQDSYY--IDPERRFFIVADGMGGHAGGQEASQIATETIQAHLEEHWNSPR--AAGELLQEAITAANEKIIEDQL--K 90
Cdd:pfam13672  10 LPCQDAFAyrVLSDGWLIAVADGAGSAKYSDVGARLAVEAAVEALRELLDSGElpELEALVRQILNDILALVRQEAAaqG 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204   91 NPERqEMGTTLVIAIFRDDGSWYTHIGDSRL-YRFREQKLEQVTEDHTliaraikmGDMSEEDAKNSPYRHILLKCLGRp 169
Cdd:pfam13672  90 LEPR-DYATTLLLAVITPGGIVFFQIGDGAIvVRDRDGELQLLSEPDS--------GEYANETTFLTSPDALEEFRIRR- 159
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 166367204  170 gllpvtvspLDVQSGDSLILCSDGlteevsdeeISDYLQTGADCQEIVENLVAAAKKAGGSDNI 233
Cdd:pfam13672 160 ---------LTLEPGDALALMTDG---------LSDSLVTEEPFFPFFAPLLETLEEEGASEQL 205
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
3-238 1.31e-42

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 152.52  E-value: 1.31e-42
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204   3 NLSFGGMTDPGVVRSVNQDSYYIDPE--------------RRFFIVADGMGGHAGGQEASQIATETIQAHLEEHWNSPRA 68
Cdd:PRK14559 374 SLEDAGRTDVGRQRHHNEDYFGINTRiqklenphgrivqaRGLYILCDGMGGHAAGEVASALAVETLQQYFQQHWQDELP 453
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204  69 AGELLQEAITAANEKIIEDQLKNPE----RqeMGTTLVIAIFRDDGSWYTHIGDSRLYRF-REQKLEQVTEDHTLIARAI 143
Cdd:PRK14559 454 DEETIREAIYLANEAIYDLNQQNARsgsgR--MGTTLVMALVQDTQVAVAHVGDSRLYRVtRKGGLEQLTVDHEVGQREI 531
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204 144 KMGdMSEEDAKNSPYRHILLKCLG-------RPgllpvTVSPLDVQSGDSLILCSDGLT-----EEVSDEEISDYLQTGA 211
Cdd:PRK14559 532 QRG-VEPQIAYARPDAYQLTQALGprdnsaiQP-----DIQFLEIEEDTLLLLCSDGLSdndllETHWQTHLLPLLSSSA 605
                        250       260
                 ....*....|....*....|....*..
gi 166367204 212 DCQEIVENLVAAAKKAGGSDNITVVMV 238
Cdd:PRK14559 606 NLDQGLNKLIDLANQYNGHDNITAILV 632
PTZ00224 PTZ00224
protein phosphatase 2C; Provisional
24-238 5.75e-05

protein phosphatase 2C; Provisional


Pssm-ID: 240318 [Multi-domain]  Cd Length: 381  Bit Score: 42.07  E-value: 5.75e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204  24 YIDPERRFFIVADGmggHAGGQeASQiatetiqaHLEEHWnspraagellQEAITAANEKIIEDQLK----NPERQEM-- 97
Cdd:PTZ00224  43 YLTDDWGFFGVFDG---HVNDE-CSQ--------YLARAW----------PQALEKEPEPMTDERMEelclEIDEEWMds 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204  98 ----GTTLVIAIFRDDgswYT----HIGDSRLYRFREQKLEQVTEDHT--------------------------LIARAi 143
Cdd:PTZ00224 101 gregGSTGTFCVIMKD---VHlqvgNVGDSRVLVCRDGKLVFATEDHKpnnpgerqrieacggrvvsnrvdgdlAVSRA- 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204 144 kMGDMSEEDAKNSPYRHilLKCLGRPgllpvTVSPLDVQSGDSLILCSDGLTE-EVSDEEISDY----LQTGADCQEIVE 218
Cdd:PTZ00224 177 -FGDRSFKVKGTGDYLE--QKVIAVP-----DVTHLTCQSNDFIILACDGVFEgNFSNEEVVAFvkeqLETCDDLAVVAG 248
                        250       260
                 ....*....|....*....|
gi 166367204 219 NLVAAAKKAGGSDNITVVMV 238
Cdd:PTZ00224 249 RVCDEAIRRGSKDNISCLIV 268
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
6-238 1.83e-53

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 174.82  E-value: 1.83e-53
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204   6 FGGMTDPGVVRSVNQDSYYIDPER-----RFFIVADGMGGHAGGQEASQIATETIQAHLEEHWN-SPRAAGELLQEAITA 79
Cdd:cd00143    2 SAGVSDKGGDRKTNEDAVVIKPNLnnedgGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTlSEEDIEEALRKAFLR 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204  80 ANEKIIEDQLKNPERQEMGTTLVIAIFRDDGSWYTHIGDSRLYRFREQKLEQVTEDHTLIARAIKMGDMSEE---DAKNS 156
Cdd:cd00143   82 ADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGgrvSNGRV 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204 157 PYRHILLKCLGRPGLLP-VTVSPlDVQ------SGDSLILCSDGLTEEVSDEEISDYLQ---TGADCQEIVENLVAAAKK 226
Cdd:cd00143  162 PGVLAVTRALGDFDLKPgVSAEP-DVTvvklteDDDFLILASDGLWDVLSNQEAVDIVRselAKEDLQEAAQELVDLALR 240
                        250
                 ....*....|..
gi 166367204 227 AGGSDNITVVMV 238
Cdd:cd00143  241 RGSHDNITVVVV 252
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
1-240 4.99e-80

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 243.42  E-value: 4.99e-80
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204   1 MNNLSFGGMTDPGVVRSVNQDSYYIDPERR-----FFIVADGMGGHAGGQEASQIATETIQAHLEEHWNSPRAAG--ELL 73
Cdd:COG0631    5 ILSLKVAGLSDVGTVRKHNEDAFLIKPNENgnlllLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSLNESleELL 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204  74 QEAITAANEKIIEDQLKNPERQEMGTTLVIAIFRDDGSWYTHIGDSRLYRFREQKLEQVTEDHTLIARAIKMGDMSEEDA 153
Cdd:COG0631   85 KEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEEA 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204 154 KNSPYRHILLKCLGRPGLLPVTVSPLDVQSGDSLILCSDGLTEEVSDEEISDYLQTGADCQEIVENLVAAAKKAGGSDNI 233
Cdd:COG0631  165 RSHPRRNALTRALGDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILKNSETPQEAADKLIELALEGGGPDNI 244

                 ....*..
gi 166367204 234 TVVMVSC 240
Cdd:COG0631  245 TVVLVRL 251
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
2-238 6.87e-42

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 144.83  E-value: 6.87e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204     2 NNLSFGGMTDPGVvRSVNQDSYYIDPERR----FFIVADGMGGHAGGQEASQIATETIQAHLEEHWNSPRAAGELLQEAI 77
Cdd:smart00332   7 LGLRYGLSSMQGV-RKPMEDAHVITPDLSdsggFFGVFDGHGGSEAAKFLSKNLPEILAEELIKEKDELEDVEEALRKAF 85
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204    78 TAANEKIIEDqlknpERQEMGTTLVIAIFRDDGSWYTHIGDSRLYRFREQKLEQVTEDHTLIaRAIKMGDMSEEDAKNSP 157
Cdd:smart00332  86 LSTDEEILEE-----LEALSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKPS-NEDERARIEAAGGFVIN 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204   158 YRHILLKCLGR--------PGLLP---VTVSPLdVQSGDSLILCSDGLTEEVSDEEISDYLQ--TGADCQEIVENLVAAA 224
Cdd:smart00332 160 GRVNGVLALSRaigdfflkPYVSAepdVTVVEL-TEKDDFLILASDGLWDVLSNQEVVDIVRkhLSKDPKEAAKRLIDLA 238
                          250
                   ....*....|....
gi 166367204   225 KKAGGSDNITVVMV 238
Cdd:smart00332 239 LARGSKDNITVVVV 252
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
21-224 4.99e-23

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 92.80  E-value: 4.99e-23
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204    21 DSYY---IDPERRFFIVADGMGGHAGGQEASQIATETIQAHLEEhwnspraaGELLQEAITAANEKIIEDqlknpERQEM 97
Cdd:smart00331  19 DFYDvvkLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSE--------GISLSQILERLNRAIYEN-----GEDGM 85
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204    98 GTTLVIAI--FRDDGSWYTHIGDSRLYRFREQKLEQVTEDHTLiaraikmgdmseedaknspyrhillKCLGRPGLLPVT 175
Cdd:smart00331  86 FATLFLALydFAGGTLSYANAGHSPPYLLRADGGLVEDLDDLG-------------------------APLGLEPDVEVD 140
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|.
gi 166367204   176 VSPLDVQSGDSLILCSDGLTEEVSDEEISDYLQ--TGADCQEIVENLVAAA 224
Cdd:smart00331 141 VRELTLEPGDLLLLYTDGLTEARNPERLEELLEelLGSPPAEIAQRILEEL 191
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
17-233 1.32e-20

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 86.21  E-value: 1.32e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204   17 SVNQDSYY--IDPERRFFIVADGMGGHAGGQEASQIATETIQAHLEEHWNSPR--AAGELLQEAITAANEKIIEDQL--K 90
Cdd:pfam13672  10 LPCQDAFAyrVLSDGWLIAVADGAGSAKYSDVGARLAVEAAVEALRELLDSGElpELEALVRQILNDILALVRQEAAaqG 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204   91 NPERqEMGTTLVIAIFRDDGSWYTHIGDSRL-YRFREQKLEQVTEDHTliaraikmGDMSEEDAKNSPYRHILLKCLGRp 169
Cdd:pfam13672  90 LEPR-DYATTLLLAVITPGGIVFFQIGDGAIvVRDRDGELQLLSEPDS--------GEYANETTFLTSPDALEEFRIRR- 159
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 166367204  170 gllpvtvspLDVQSGDSLILCSDGlteevsdeeISDYLQTGADCQEIVENLVAAAKKAGGSDNI 233
Cdd:pfam13672 160 ---------LTLEPGDALALMTDG---------LSDSLVTEEPFFPFFAPLLETLEEEGASEQL 205
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
26-233 1.75e-15

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 72.01  E-value: 1.75e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204   26 DPERRFFIVADGMGGHaggqEASQIATEtiqaHLEEHWNSPRAAGEL------LQEAITAANEKIiEDQLKNPERQEMGT 99
Cdd:pfam00481  31 KDSWSFFAVFDGHGGS----EAAKYAGK----HLHTILALRRSFLTLrkledaLRESFLETDEEL-RSDAANHEDLSSGS 101
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204  100 TLVIAIFRDDGSWYTHIGDSRLYRFREQK-LEQVTEDHTL-----IARAIKM-GDMSEEDAKN---SPYRHILLKCLgRP 169
Cdd:pfam00481 102 TAVVALIRGNKLYVANVGDSRAVLCRNGGaIKQLTEDHKPsdedeRRRIRAAgGFVSRNGRVNgvlAVSRAFGDFDL-KP 180
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 166367204  170 GLLPVTVSP--LDVQSGDS---LILCSDGLTEEVSDEEISDYLQT----GADCQEIVENLVAAAKKAGGSDNI 233
Cdd:pfam00481 181 GEQPVSAEPdiTSHKITEDdefLILACDGLWDVLSDQEVVDIVRSnlsdGGDPMEAAEKLVDEAIAYGSEDNI 253
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
26-238 1.13e-08

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 51.91  E-value: 1.13e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204   26 DPERRFFIVADGMGgHagGQEASQIATETIQAhLEEHwnspRAAGELLQEAITAANEKIIEDQlknpeRQEMGTTLVIAI 105
Cdd:pfam07228   1 PDGRVALVIGDVMG-H--GLPAALLMGMLRTA-LRAL----ALEGLDPAEVLERLNRALQRNL-----EGERFATAVLAV 67
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204  106 FRDDGS--WYTHIGDSRLYRFREQKLEQVTEDHTLIAraikmgdmseedaknspyrhillkcLGRPGLLPVTVSPLDVQS 183
Cdd:pfam07228  68 YDPETGtlEYANAGHPPPLLLRPDGGVVELLESPGLP-------------------------LGVLPDAPYETAEFPLEP 122
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 166367204  184 GDSLILCSDGLTE-------EVSDEEISDYLQ--TGADCQEIVENLVAAAKKAGG---SDNITVVMV 238
Cdd:pfam07228 123 GDTLLLYTDGLTEardpdgeLFGLERLLALLAerHGLSPEELLDALLEDLLRLGGgelEDDITLLVL 189
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
3-238 1.31e-42

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 152.52  E-value: 1.31e-42
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204   3 NLSFGGMTDPGVVRSVNQDSYYIDPE--------------RRFFIVADGMGGHAGGQEASQIATETIQAHLEEHWNSPRA 68
Cdd:PRK14559 374 SLEDAGRTDVGRQRHHNEDYFGINTRiqklenphgrivqaRGLYILCDGMGGHAAGEVASALAVETLQQYFQQHWQDELP 453
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204  69 AGELLQEAITAANEKIIEDQLKNPE----RqeMGTTLVIAIFRDDGSWYTHIGDSRLYRF-REQKLEQVTEDHTLIARAI 143
Cdd:PRK14559 454 DEETIREAIYLANEAIYDLNQQNARsgsgR--MGTTLVMALVQDTQVAVAHVGDSRLYRVtRKGGLEQLTVDHEVGQREI 531
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204 144 KMGdMSEEDAKNSPYRHILLKCLG-------RPgllpvTVSPLDVQSGDSLILCSDGLT-----EEVSDEEISDYLQTGA 211
Cdd:PRK14559 532 QRG-VEPQIAYARPDAYQLTQALGprdnsaiQP-----DIQFLEIEEDTLLLLCSDGLSdndllETHWQTHLLPLLSSSA 605
                        250       260
                 ....*....|....*....|....*..
gi 166367204 212 DCQEIVENLVAAAKKAGGSDNITVVMV 238
Cdd:PRK14559 606 NLDQGLNKLIDLANQYNGHDNITAILV 632
PTZ00224 PTZ00224
protein phosphatase 2C; Provisional
24-238 5.75e-05

protein phosphatase 2C; Provisional


Pssm-ID: 240318 [Multi-domain]  Cd Length: 381  Bit Score: 42.07  E-value: 5.75e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204  24 YIDPERRFFIVADGmggHAGGQeASQiatetiqaHLEEHWnspraagellQEAITAANEKIIEDQLK----NPERQEM-- 97
Cdd:PTZ00224  43 YLTDDWGFFGVFDG---HVNDE-CSQ--------YLARAW----------PQALEKEPEPMTDERMEelclEIDEEWMds 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204  98 ----GTTLVIAIFRDDgswYT----HIGDSRLYRFREQKLEQVTEDHT--------------------------LIARAi 143
Cdd:PTZ00224 101 gregGSTGTFCVIMKD---VHlqvgNVGDSRVLVCRDGKLVFATEDHKpnnpgerqrieacggrvvsnrvdgdlAVSRA- 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166367204 144 kMGDMSEEDAKNSPYRHilLKCLGRPgllpvTVSPLDVQSGDSLILCSDGLTE-EVSDEEISDY----LQTGADCQEIVE 218
Cdd:PTZ00224 177 -FGDRSFKVKGTGDYLE--QKVIAVP-----DVTHLTCQSNDFIILACDGVFEgNFSNEEVVAFvkeqLETCDDLAVVAG 248
                        250       260
                 ....*....|....*....|
gi 166367204 219 NLVAAAKKAGGSDNITVVMV 238
Cdd:PTZ00224 249 RVCDEAIRRGSKDNISCLIV 268
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH