NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|163853322|ref|YP_001641365|]
View 

metal dependent phophohydrolase [Methylobacterium extorquens PA1]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
HDc cd00077
Metal dependent phosphohydrolases with conserved 'HD' motif
210-339 9.23e-23

Metal dependent phosphohydrolases with conserved 'HD' motif


:

Pssm-ID: 238032  Cd Length: 145  Bit Score: 92.79  E-value: 9.23e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322 210 VYQHSLSVAGFAAAFAAELGFSRGDRQRLAKAALLHDVGKALIPHAIlnkpgplTPDEMTVMRTHAALGADLLAQ----- 284
Cdd:cd00077    3 RFEHSLRVAQLARRLAEELGLSEEDIELLRLAALLHDIGKPGTPDAI-------TEEESELEKDHAIVGAEILRElllee 75
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 163853322 285 -EGAFEPEILDVVRYHHERLDGSGYPEGLKGARISDLVRLVAICDVHSALTERRVY 339
Cdd:cd00077   76 vIKLIDELILAVDASHHERLDGLGYPDGLKGEEITLEARIVKLADRLDALRRDSRE 131
 
Name Accession Description Interval E-value
HDc cd00077
Metal dependent phosphohydrolases with conserved 'HD' motif
210-339 9.23e-23

Metal dependent phosphohydrolases with conserved 'HD' motif


Pssm-ID: 238032  Cd Length: 145  Bit Score: 92.79  E-value: 9.23e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322 210 VYQHSLSVAGFAAAFAAELGFSRGDRQRLAKAALLHDVGKALIPHAIlnkpgplTPDEMTVMRTHAALGADLLAQ----- 284
Cdd:cd00077    3 RFEHSLRVAQLARRLAEELGLSEEDIELLRLAALLHDIGKPGTPDAI-------TEEESELEKDHAIVGAEILRElllee 75
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 163853322 285 -EGAFEPEILDVVRYHHERLDGSGYPEGLKGARISDLVRLVAICDVHSALTERRVY 339
Cdd:cd00077   76 vIKLIDELILAVDASHHERLDGLGYPDGLKGEEITLEARIVKLADRLDALRRDSRE 131
HD pfam01966
HD domain; HD domains are metal dependent phosphohydrolases.
210-333 9.24e-15

HD domain; HD domains are metal dependent phosphohydrolases.


Pssm-ID: 251000  Cd Length: 110  Bit Score: 69.57  E-value: 9.24e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322  210 VYQHSLSVAGFAAAFAAELGfsRGDRQRLAKAALLHDVGKALIPHAIlnkpgpltPDEMTVMRTHAALGADLLAQEGA-- 287
Cdd:pfam01966   1 VLEHSLRVALLARELAEELG--ELDRELLLLAALLHDIGKPPFGDEK--------PLLFEIFLGHAVVGAEILRELEKpl 70
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 163853322  288 FEPEILDVVRYHHERldgsgyPEGLKGARISDLVRLVAICDVHSAL 333
Cdd:pfam01966  71 GLEDVLKLILEHHES------WEGLYGEPISLEARIVKLADRLDAL 110
HDc smart00471
Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic ...
210-340 4.40e-14

Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic nucleotide phosphodiesterases (PDEc). This profile/HMM does not detect HD homologues in bacterial glycine aminoacyl-tRNA synthetases (beta subunit).


Pssm-ID: 214679  Cd Length: 124  Bit Score: 68.09  E-value: 4.40e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322   210 VYQHSLSVAGFAAAFAAELGFSrgDRQRLAKAALLHDVGKALIPHAILNKPGpltpdemtVMRTHAALGADLLAQEG--- 286
Cdd:smart00471   5 VFEHSLRVAQLAAALAEELGLL--DIELLLLAALLHDIGKPGTPDSFLVKTS--------VLEDHHFIGAEILLEEEepr 74
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....
gi 163853322   287 AFEPEILDVVRYHHERLDgsgypeGLKGARISDLVRLVAICDVHSALTERRVYR 340
Cdd:smart00471  75 ILEEILRTAILSHHERPD------GLRGEPITLEARIVKVADRLDALRADRRYR 122
HDIG TIGR00277
uncharacterized domain HDIG; This domain is found in a few known nucleotidyltransferes and in ...
210-301 1.56e-07

uncharacterized domain HDIG; This domain is found in a few known nucleotidyltransferes and in a large number of uncharacterized proteins. It contains four widely separated His residues, the second of which is part of an invariant dipeptide His-Asp in a region matched approximately by the motif HDIG. For proteins scoring above the trusted cutoff, confidence is high both that the domain is present and that the model produces an essentially correct alignment. Protein regions scoring between the trusted and noise cutoffs include correctly aligned domains, homologous domains in which one or more of the His residues is conserved but misaligned, and some probable false-positive hits indications of homology.


Pssm-ID: 232902  Cd Length: 80  Bit Score: 48.48  E-value: 1.56e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322  210 VYQHSLSVAGFAAAFAAELGFsrgDRQRLAKAALLHDVGKaliphailnkpgPLTPdEMTVMRTHAALGADLLAQEGaFE 289
Cdd:TIGR00277   5 VLQHSLEVAKLAEALARELGL---DVELARRGALLHDIGK------------PITR-EGVIFESHAVVGAEIARKYG-EP 67
                          90
                  ....*....|..
gi 163853322  290 PEILDVVRYHHE 301
Cdd:TIGR00277  68 LEVIDIIAEHHG 79
COG2206 COG2206
c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms]
211-340 2.78e-44

c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms]


Pssm-ID: 225116 [Multi-domain]  Cd Length: 344  Bit Score: 157.65  E-value: 2.78e-44
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322 211 YQHSLSVAGFAAAFAAELGFSRGDRQRLAKAALLHDVGKALIPHAILNKPGPLTPDEMTVMRTHAALGADLLAQEGAFEP 290
Cdd:COG2206  150 YGHSVRVAELAEAIAKKLGLSEEKIEELALAGLLHDIGKIGIPDSILNKPGKLTEEEFEIIKKHPIYGYDILKDLPEFLE 229
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 163853322 291 EILDVVRYHHERLDGSGYPEGLKGARISDLVRLVAICDVHSALTERRVYR 340
Cdd:COG2206  230 SVRAVALRHHERWDGTGYPRGLKGEEIPLEARIIAVADVYDALTSDRPYK 279
PRK12705 PRK12705
hypothetical protein; Provisional
210-332 3.48e-05

hypothetical protein; Provisional


Pssm-ID: 237178 [Multi-domain]  Cd Length: 508  Bit Score: 44.31  E-value: 3.48e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322 210 VYQHSLSVAGFAAAFAAELGFsrgDRQRLAKAALLHDVGKAliphailnkpgpltpDEMTVMRTHAALGAdLLAQEGAFE 289
Cdd:PRK12705 324 VLSHSLEVAHLAGIIAAEIGL---DPALAKRAGLLHDIGKS---------------IDRESDGNHVEIGA-ELARKFNEP 384
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 163853322 290 PEILDVVRYHHERLDgsgyPEGLKGarisdlvRLVAICDVHSA 332
Cdd:PRK12705 385 DEVINAIASHHNKVN----PETVYS-------VLVQIADALSA 416
RNase_Y TIGR03319
ribonuclease Y; Members of this family are RNase Y, an endoribonuclease. The member from ...
210-301 2.72e-04

ribonuclease Y; Members of this family are RNase Y, an endoribonuclease. The member from Bacillus subtilis, YmdA, has been shown to be involved in turnover of yitJ riboswitch [Transcription, Degradation of RNA].


Pssm-ID: 188306 [Multi-domain]  Cd Length: 514  Bit Score: 41.45  E-value: 2.72e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322  210 VYQHSLSVAGFAAAFAAELGFSrgdrQRLAK-AALLHDVGKAlIPHAIlnkpgpltpdEMtvmrTHAALGADLLAQEGAf 288
Cdd:TIGR03319 330 VLQHSIEVAHLAGIMAAELGED----VKLAKrAGLLHDIGKA-VDHEV----------EG----SHVEIGAELAKKYKE- 389
                          90
                  ....*....|...
gi 163853322  289 EPEILDVVRYHHE 301
Cdd:TIGR03319 390 SPEVVNAIAAHHG 402
 
Name Accession Description Interval E-value
HDc cd00077
Metal dependent phosphohydrolases with conserved 'HD' motif
210-339 9.23e-23

Metal dependent phosphohydrolases with conserved 'HD' motif


Pssm-ID: 238032  Cd Length: 145  Bit Score: 92.79  E-value: 9.23e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322 210 VYQHSLSVAGFAAAFAAELGFSRGDRQRLAKAALLHDVGKALIPHAIlnkpgplTPDEMTVMRTHAALGADLLAQ----- 284
Cdd:cd00077    3 RFEHSLRVAQLARRLAEELGLSEEDIELLRLAALLHDIGKPGTPDAI-------TEEESELEKDHAIVGAEILRElllee 75
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 163853322 285 -EGAFEPEILDVVRYHHERLDGSGYPEGLKGARISDLVRLVAICDVHSALTERRVY 339
Cdd:cd00077   76 vIKLIDELILAVDASHHERLDGLGYPDGLKGEEITLEARIVKLADRLDALRRDSRE 131
HD pfam01966
HD domain; HD domains are metal dependent phosphohydrolases.
210-333 9.24e-15

HD domain; HD domains are metal dependent phosphohydrolases.


Pssm-ID: 251000  Cd Length: 110  Bit Score: 69.57  E-value: 9.24e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322  210 VYQHSLSVAGFAAAFAAELGfsRGDRQRLAKAALLHDVGKALIPHAIlnkpgpltPDEMTVMRTHAALGADLLAQEGA-- 287
Cdd:pfam01966   1 VLEHSLRVALLARELAEELG--ELDRELLLLAALLHDIGKPPFGDEK--------PLLFEIFLGHAVVGAEILRELEKpl 70
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 163853322  288 FEPEILDVVRYHHERldgsgyPEGLKGARISDLVRLVAICDVHSAL 333
Cdd:pfam01966  71 GLEDVLKLILEHHES------WEGLYGEPISLEARIVKLADRLDAL 110
HD_5 pfam13487
HD domain; HD domains are metal dependent phosphohydrolases.
261-323 4.03e-14

HD domain; HD domains are metal dependent phosphohydrolases.


Pssm-ID: 257811  Cd Length: 63  Bit Score: 66.82  E-value: 4.03e-14
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 163853322  261 GPLTPDEMTVMRTHAALGADLLAQEGAFEPeILDVVRYHHERLDGSGYPEGLKGARISDLVRL 323
Cdd:pfam13487   1 GTLTPEERAIINEHPEQTARLLEKIPRLPP-VAEIIGHHHERLDGSGYPRGLKGDEIPLGARI 62
HDc smart00471
Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic ...
210-340 4.40e-14

Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic nucleotide phosphodiesterases (PDEc). This profile/HMM does not detect HD homologues in bacterial glycine aminoacyl-tRNA synthetases (beta subunit).


Pssm-ID: 214679  Cd Length: 124  Bit Score: 68.09  E-value: 4.40e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322   210 VYQHSLSVAGFAAAFAAELGFSrgDRQRLAKAALLHDVGKALIPHAILNKPGpltpdemtVMRTHAALGADLLAQEG--- 286
Cdd:smart00471   5 VFEHSLRVAQLAAALAEELGLL--DIELLLLAALLHDIGKPGTPDSFLVKTS--------VLEDHHFIGAEILLEEEepr 74
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....
gi 163853322   287 AFEPEILDVVRYHHERLDgsgypeGLKGARISDLVRLVAICDVHSALTERRVYR 340
Cdd:smart00471  75 ILEEILRTAILSHHERPD------GLRGEPITLEARIVKVADRLDALRADRRYR 122
HDIG TIGR00277
uncharacterized domain HDIG; This domain is found in a few known nucleotidyltransferes and in ...
210-301 1.56e-07

uncharacterized domain HDIG; This domain is found in a few known nucleotidyltransferes and in a large number of uncharacterized proteins. It contains four widely separated His residues, the second of which is part of an invariant dipeptide His-Asp in a region matched approximately by the motif HDIG. For proteins scoring above the trusted cutoff, confidence is high both that the domain is present and that the model produces an essentially correct alignment. Protein regions scoring between the trusted and noise cutoffs include correctly aligned domains, homologous domains in which one or more of the His residues is conserved but misaligned, and some probable false-positive hits indications of homology.


Pssm-ID: 232902  Cd Length: 80  Bit Score: 48.48  E-value: 1.56e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322  210 VYQHSLSVAGFAAAFAAELGFsrgDRQRLAKAALLHDVGKaliphailnkpgPLTPdEMTVMRTHAALGADLLAQEGaFE 289
Cdd:TIGR00277   5 VLQHSLEVAKLAEALARELGL---DVELARRGALLHDIGK------------PITR-EGVIFESHAVVGAEIARKYG-EP 67
                          90
                  ....*....|..
gi 163853322  290 PEILDVVRYHHE 301
Cdd:TIGR00277  68 LEVIDIIAEHHG 79
Cas10_III cd09680
CRISPR/Cas system-associated protein Cas10; CRISPR (Clustered Regularly Interspaced Short ...
238-337 4.13e-06

CRISPR/Cas system-associated protein Cas10; CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Multidomain protein with permuted HD nuclease domain, palm domain and Zn-ribbon; signature gene for type III; also known as Csm1 family


Pssm-ID: 187811 [Multi-domain]  Cd Length: 650  Bit Score: 47.32  E-value: 4.13e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322 238 LAKAALLHDVGKaLIPHAILNKPGpltpdemtvmRTHAALGADLLAQEGAFEPEILDVVRYHHER-LDGSGYPEGLKGAR 316
Cdd:cd09680    1 LALGALLHDIGK-VVQRAGLGFYS----------KTHSKFGAEFLKEFSKNKDDLGDCISYHHTKeLAKALLENHHPLAY 69
                         90       100
                 ....*....|....*....|.
gi 163853322 317 IsdlvrlVAICDVHSALTERR 337
Cdd:cd09680   70 I------VYIADNIAASVERR 84
Cas3''_I cd09641
CRISPR/Cas system-associated protein Cas3''; CRISPR (Clustered Regularly Interspaced ...
211-304 3.77e-03

CRISPR/Cas system-associated protein Cas3''; CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; HD-like nuclease, specifically digesting double-stranded oligonucleotides and preferably cleaving at G:C pairs; signature gene for Type I


Pssm-ID: 193608  Cd Length: 200  Bit Score: 36.87  E-value: 3.77e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322 211 YQHSLSVAGFAAAFAAELG-----FSRGDRQRLAKAALLHDVGKAlipHA-----ILNKPGPLTPDEMTVMRtHAALGA- 279
Cdd:cd09641   10 LEHLLDVAAWDAELAEEFArklglELGLSRELLALAGLLHDLGKA---TPafqkyLRGGKEALREGKRKEVR-HSLLGAl 85
                         90       100       110
                 ....*....|....*....|....*....|.
gi 163853322 280 ---DLLAQEGAFEPE---ILDVVRYHHERLD 304
Cdd:cd09641   86 llyELLKELGLDEELallLAYAIAGHHGGLP 116
HDOD pfam08668
HDOD domain;
212-301 6.38e-03

HDOD domain;


Pssm-ID: 254961  Cd Length: 196  Bit Score: 36.06  E-value: 6.38e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322  212 QHSLSVAGFAAAFAAELGFSRGDRqrLAKAALLHDVGK------------ALIPHAILNKPGPLTPDEMTVMRTHAALGA 279
Cdd:pfam08668  97 RHSLACALAARLLARRLGLDDPEE--AFTAGLLHDIGKlillsllpdeyeEILERVAAEGISLLEAERELLGTDHAEVGA 174
                          90       100
                  ....*....|....*....|..
gi 163853322  280 dLLAQEGAFEPEILDVVRYHHE 301
Cdd:pfam08668 175 -ALLERWNLPEELVEAIAYHHD 195
cas3_HD TIGR01596
CRISPR-associated endonuclease Cas3-HD; CRISPR/Cas systems are widespread, mobile systems for ...
230-304 6.62e-03

CRISPR-associated endonuclease Cas3-HD; CRISPR/Cas systems are widespread, mobile systems for host defense against invasive elements such as phage. In these systems, Cas3 designates one of the core proteins shared widely by multiple types of CRISPR/Cas system. This model represents an HD-like endonuclease that occurs either separately or as the N-terminal region of Cas3, the helicase-containing CRISPR-associated protein [Mobile and extrachromosomal element functions, Other].


Pssm-ID: 233487  Cd Length: 177  Bit Score: 35.98  E-value: 6.62e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322  230 FSRGDRQRLAKAALLHDVGKA------LIPHAILNKPGPLTPdemtvmrtHAALGADLLAQ--EGAFEPE-----ILDVV 296
Cdd:TIGR01596  26 IGKDLRELLALLALLHDIGKAspgfqaKLRKAYKRGRRKAVR--------HSVLSAALLDAllIKKGYEEevaklLALAV 97

                  ....*...
gi 163853322  297 RYHHERLD 304
Cdd:TIGR01596  98 AGHHGGLS 105
COG2206 COG2206
c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms]
211-340 2.78e-44

c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms]


Pssm-ID: 225116 [Multi-domain]  Cd Length: 344  Bit Score: 157.65  E-value: 2.78e-44
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322 211 YQHSLSVAGFAAAFAAELGFSRGDRQRLAKAALLHDVGKALIPHAILNKPGPLTPDEMTVMRTHAALGADLLAQEGAFEP 290
Cdd:COG2206  150 YGHSVRVAELAEAIAKKLGLSEEKIEELALAGLLHDIGKIGIPDSILNKPGKLTEEEFEIIKKHPIYGYDILKDLPEFLE 229
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 163853322 291 EILDVVRYHHERLDGSGYPEGLKGARISDLVRLVAICDVHSALTERRVYR 340
Cdd:COG2206  230 SVRAVALRHHERWDGTGYPRGLKGEEIPLEARIIAVADVYDALTSDRPYK 279
COG3437 COG3437
Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription ...
207-340 3.63e-33

Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms]


Pssm-ID: 225971 [Multi-domain]  Cd Length: 360  Bit Score: 127.09  E-value: 3.63e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322 207 DIQVYQHSLSVAGFAAAFAAELGFSRGDRQRLAKAALLHDVGKALIPHAILNKPGPLTPDEMTVMRTHAALGADLLAQ-E 285
Cdd:COG3437  183 DYETGDHLERVAQYSELLAELLGLSEEEVDLIKKAAPLHDIGKVAIPDSILLKPGKLTSEEFEIMKGHPILGAEILKSsE 262
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 163853322 286 GAFEP--EIldvVRYHHERLDGSGYPEGLKGARISDLVRLVAICDVHSALTERRVYR 340
Cdd:COG3437  263 RLMQVaaEI---ARHHHERWDGSGYPDGLKGDEIPLSARIVAIADVFDALVSGRPYK 316
PRK12705 PRK12705
hypothetical protein; Provisional
210-332 3.48e-05

hypothetical protein; Provisional


Pssm-ID: 237178 [Multi-domain]  Cd Length: 508  Bit Score: 44.31  E-value: 3.48e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322 210 VYQHSLSVAGFAAAFAAELGFsrgDRQRLAKAALLHDVGKAliphailnkpgpltpDEMTVMRTHAALGAdLLAQEGAFE 289
Cdd:PRK12705 324 VLSHSLEVAHLAGIIAAEIGL---DPALAKRAGLLHDIGKS---------------IDRESDGNHVEIGA-ELARKFNEP 384
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 163853322 290 PEILDVVRYHHERLDgsgyPEGLKGarisdlvRLVAICDVHSA 332
Cdd:PRK12705 385 DEVINAIASHHNKVN----PETVYS-------VLVQIADALSA 416
RNase_Y TIGR03319
ribonuclease Y; Members of this family are RNase Y, an endoribonuclease. The member from ...
210-301 2.72e-04

ribonuclease Y; Members of this family are RNase Y, an endoribonuclease. The member from Bacillus subtilis, YmdA, has been shown to be involved in turnover of yitJ riboswitch [Transcription, Degradation of RNA].


Pssm-ID: 188306 [Multi-domain]  Cd Length: 514  Bit Score: 41.45  E-value: 2.72e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322  210 VYQHSLSVAGFAAAFAAELGFSrgdrQRLAK-AALLHDVGKAlIPHAIlnkpgpltpdEMtvmrTHAALGADLLAQEGAf 288
Cdd:TIGR03319 330 VLQHSIEVAHLAGIMAAELGED----VKLAKrAGLLHDIGKA-VDHEV----------EG----SHVEIGAELAKKYKE- 389
                          90
                  ....*....|...
gi 163853322  289 EPEILDVVRYHHE 301
Cdd:TIGR03319 390 SPEVVNAIAAHHG 402
PRK12704 PRK12704
phosphodiesterase; Provisional
210-332 4.48e-04

phosphodiesterase; Provisional


Pssm-ID: 237177 [Multi-domain]  Cd Length: 520  Bit Score: 40.92  E-value: 4.48e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163853322 210 VYQHSLSVAGFAAAFAAELGfsrGDrQRLAK-AALLHDVGKALiphailnkpgpltPDEMTvmRTHAALGADLLAQEGaf 288
Cdd:PRK12704 336 VLQHSIEVAHLAGLMAAELG---LD-VKLAKrAGLLHDIGKAL-------------DHEVE--GSHVEIGAELAKKYK-- 394
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 163853322 289 E-PEILDVVRYHHERLDgsgyPEGLKGArisdlvrLVAICDVHSA 332
Cdd:PRK12704 395 EsPVVINAIAAHHGDEE----PTSIEAV-------LVAAADAISA 428
cas_TM1811_Csm1 TIGR02578
CRISPR-associated protein Cas10/Csm1, subtype III-A/MTUBE; The family is designated Csm2, for ...
238-302 1.37e-03

CRISPR-associated protein Cas10/Csm1, subtype III-A/MTUBE; The family is designated Csm2, for CRISPR/Cas Subtype Mtube Protein 2. A typical example is TM1811 from Thermotoga maritima. CRISPR are Clustered Regularly Interspaced Short Palindromic Repeats. This protein family belongs to a conserved gene cluster regularly found near CRISPR repeats [Mobile and extrachromosomal element functions, Other].


Pssm-ID: 233936 [Multi-domain]  Cd Length: 648  Bit Score: 39.30  E-value: 1.37e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 163853322  238 LAKAALLHDVGKaLIPHAILNKPGPLTPDEMTVMRTHAAL-GADLLAQEGAFEPEILDVVRYHHER 302
Cdd:TIGR02578   1 LAVAALLHDIGK-VIRRAGDCYNEDLKHDKTGYEFIHEFFkNALLEVLDKKADDLLKNLVKSHHEE 65
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH