NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|163847328|ref|YP_001635372|]
View 

stage II sporulation E family protein [Chloroflexus aurantiacus J-10-fl]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2Cc super family cl00120
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
46-231 5.86e-16

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


The actual alignment was detected with superfamily member pfam07228:

Pssm-ID: 294085  Cd Length: 190  Bit Score: 72.67  E-value: 5.86e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163847328   46 GGGFSFVLVDGQGNGRSAktlsHLVATRAITLL----KDGARDGAVARAVHDYLYTYRMGQASATLNILSVDFASSKILV 121
Cdd:pfam07228   1 DGRVALVIGDVMGHGLPA----ALLMGMLRTALralaAEGLDPAEVLKRLNRLLQRNLEEDMFATAVLAVYDPETGTLEY 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163847328  122 TRNNPAPFFVITP--QELRSFNTPSTPIGLHPLIRPQISEIPIAAYTYVVLFTDGLLRAGERRGEDLGLPNYLAAWPAHE 199
Cdd:pfam07228  77 ANAGHPPPLLLRPdgGVVELLESTGLPLGILPDADYEVVELELEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAERH 156
                         170       180       190
                  ....*....|....*....|....*....|..
gi 163847328  200 GRDPQTLVDSIMNQALELDDGQPVDDMSIVVL 231
Cdd:pfam07228 157 GLPPEELLDALLEALLRLGGGELEDDITLLVL 188
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
46-231 5.86e-16

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 284611  Cd Length: 190  Bit Score: 72.67  E-value: 5.86e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163847328   46 GGGFSFVLVDGQGNGRSAktlsHLVATRAITLL----KDGARDGAVARAVHDYLYTYRMGQASATLNILSVDFASSKILV 121
Cdd:pfam07228   1 DGRVALVIGDVMGHGLPA----ALLMGMLRTALralaAEGLDPAEVLKRLNRLLQRNLEEDMFATAVLAVYDPETGTLEY 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163847328  122 TRNNPAPFFVITP--QELRSFNTPSTPIGLHPLIRPQISEIPIAAYTYVVLFTDGLLRAGERRGEDLGLPNYLAAWPAHE 199
Cdd:pfam07228  77 ANAGHPPPLLLRPdgGVVELLESTGLPLGILPDADYEVVELELEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAERH 156
                         170       180       190
                  ....*....|....*....|....*....|..
gi 163847328  200 GRDPQTLVDSIMNQALELDDGQPVDDMSIVVL 231
Cdd:pfam07228 157 GLPPEELLDALLEALLRLGGGELEDDITLLVL 188
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
24-216 7.69e-10

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 55.82  E-value: 7.69e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163847328    24 VAKVPRYGDRESGDTLETIERPGGGFSFVLVDGQGNGRSAktlsHLVATRAITLLKDGARDGAVARAVHDYL--YTYRMG 101
Cdd:smart00331   6 IAQYYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAA----ALAMSMARSALRTLLSEGISLSQILERLnrAIYENG 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163847328   102 QAS--ATLNILSVDFASSKILVTRNNPAPFFVITPQELRSFNTPST--PIGLHPLIRPQISEIPIAAYTYVVLFTDGLLR 177
Cdd:smart00331  82 EDGmfATLFLALYDFAGGTLSYANAGHSPPYLLRADGGLVEDLDDLgaPLGLEPDVEVDVRELTLEPGDLLLLYTDGLTE 161
                          170       180       190
                   ....*....|....*....|....*....|....*....
gi 163847328   178 AgeRRGEDLGLPnyLAawpAHEGRDPQTLVDSIMNQALE 216
Cdd:smart00331 162 A--RNPERLEEL--LE---ELLGSPPAEIAQRILEELLE 193
spore_II_E TIGR02865
stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane ...
15-230 1.08e-14

stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane spanning protein with two separable functions. It plays a role in the switch to polar cell division during sporulation. By means of it protein phosphatase activity, located in the C-terminal region, it activates sigma-F. All proteins that score above the trusted cutoff to this model are found in endospore-forming Gram-positive bacteria. Surprisingly, a sequence from the Cyanobacterium-like (and presumably non-spore-forming) photosynthesizer Heliobacillus mobilis is homologous, and scores between the trusted and noise cutoffs. [Cellular processes, Sporulation and germination]


Pssm-ID: 274328 [Multi-domain]  Cd Length: 764  Bit Score: 72.42  E-value: 1.08e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163847328   15 MADLEMRVAVAKVPRYGDRESGDTLETIERPGGGFSFVLVDGQGNGRSAKTLSHLVATRAITLLKDGARDGAVARAVHDY 94
Cdd:TIGR02865 547 TPKYHVSTGVARAAKDGELVSGDSYSFGKLSAGKYAVAISDGMGSGPEAAQESSACVRLLEKFLESGFDREVAIKTVNSI 626
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163847328   95 LYTYRMGQASATLNILSVDFASSKILVTRNNPAPFFVITPQELRSFNTPSTPIGLHPLIRPQISEIPIAAYTYVVLFTDG 174
Cdd:TIGR02865 627 LSLRSTDEKFSTLDLSVIDLYTGQAEFVKVGAVPSFIKRGAKVEVIRSSNLPIGILDEVDVELVRKKLKNGDLIVMVSDG 706
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 163847328  175 LLRAGERR-GEDLGLPNYLAAWPAHegrDPQTLVDSIMNQALELDDGQPVDDMSIVV 230
Cdd:TIGR02865 707 VLEGEKEVeGKVLWLVRKLKETNTN---DPEEIAEYLLEKAKELRSGKIKDDMTVIV 760
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, ...
128-231 4.30e-10

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, Transcription];


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 58.18  E-value: 4.30e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163847328 128 PFFVITPQELRSF---NTPSTPIGLHPLIRPQISEIPIAAYTYVVLFTDGLLRAGERRGEDLGLPNYLAAWPAHEGRDPQ 204
Cdd:COG2208  256 PALILSADGEIEVedlTALGLPIGLLPDYQYEVASLQLEPGDLLVLYTDGVTEARNSDGEFFGLERLLKILGRLLGQPAE 335
                         90       100
                 ....*....|....*....|....*...
gi 163847328 205 TLVDSIMNQALELDDGQPV-DDMSIVVL 231
Cdd:COG2208  336 EILEAILESLEELQGDQIQdDDITLLVL 363
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
46-231 5.86e-16

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 284611  Cd Length: 190  Bit Score: 72.67  E-value: 5.86e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163847328   46 GGGFSFVLVDGQGNGRSAktlsHLVATRAITLL----KDGARDGAVARAVHDYLYTYRMGQASATLNILSVDFASSKILV 121
Cdd:pfam07228   1 DGRVALVIGDVMGHGLPA----ALLMGMLRTALralaAEGLDPAEVLKRLNRLLQRNLEEDMFATAVLAVYDPETGTLEY 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163847328  122 TRNNPAPFFVITP--QELRSFNTPSTPIGLHPLIRPQISEIPIAAYTYVVLFTDGLLRAGERRGEDLGLPNYLAAWPAHE 199
Cdd:pfam07228  77 ANAGHPPPLLLRPdgGVVELLESTGLPLGILPDADYEVVELELEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAERH 156
                         170       180       190
                  ....*....|....*....|....*....|..
gi 163847328  200 GRDPQTLVDSIMNQALELDDGQPVDDMSIVVL 231
Cdd:pfam07228 157 GLPPEELLDALLEALLRLGGGELEDDITLLVL 188
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
24-216 7.69e-10

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 55.82  E-value: 7.69e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163847328    24 VAKVPRYGDRESGDTLETIERPGGGFSFVLVDGQGNGRSAktlsHLVATRAITLLKDGARDGAVARAVHDYL--YTYRMG 101
Cdd:smart00331   6 IAQYYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAA----ALAMSMARSALRTLLSEGISLSQILERLnrAIYENG 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163847328   102 QAS--ATLNILSVDFASSKILVTRNNPAPFFVITPQELRSFNTPST--PIGLHPLIRPQISEIPIAAYTYVVLFTDGLLR 177
Cdd:smart00331  82 EDGmfATLFLALYDFAGGTLSYANAGHSPPYLLRADGGLVEDLDDLgaPLGLEPDVEVDVRELTLEPGDLLLLYTDGLTE 161
                          170       180       190
                   ....*....|....*....|....*....|....*....
gi 163847328   178 AgeRRGEDLGLPnyLAawpAHEGRDPQTLVDSIMNQALE 216
Cdd:smart00331 162 A--RNPERLEEL--LE---ELLGSPPAEIAQRILEELLE 193
spore_II_E TIGR02865
stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane ...
15-230 1.08e-14

stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane spanning protein with two separable functions. It plays a role in the switch to polar cell division during sporulation. By means of it protein phosphatase activity, located in the C-terminal region, it activates sigma-F. All proteins that score above the trusted cutoff to this model are found in endospore-forming Gram-positive bacteria. Surprisingly, a sequence from the Cyanobacterium-like (and presumably non-spore-forming) photosynthesizer Heliobacillus mobilis is homologous, and scores between the trusted and noise cutoffs. [Cellular processes, Sporulation and germination]


Pssm-ID: 274328 [Multi-domain]  Cd Length: 764  Bit Score: 72.42  E-value: 1.08e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163847328   15 MADLEMRVAVAKVPRYGDRESGDTLETIERPGGGFSFVLVDGQGNGRSAKTLSHLVATRAITLLKDGARDGAVARAVHDY 94
Cdd:TIGR02865 547 TPKYHVSTGVARAAKDGELVSGDSYSFGKLSAGKYAVAISDGMGSGPEAAQESSACVRLLEKFLESGFDREVAIKTVNSI 626
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163847328   95 LYTYRMGQASATLNILSVDFASSKILVTRNNPAPFFVITPQELRSFNTPSTPIGLHPLIRPQISEIPIAAYTYVVLFTDG 174
Cdd:TIGR02865 627 LSLRSTDEKFSTLDLSVIDLYTGQAEFVKVGAVPSFIKRGAKVEVIRSSNLPIGILDEVDVELVRKKLKNGDLIVMVSDG 706
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 163847328  175 LLRAGERR-GEDLGLPNYLAAWPAHegrDPQTLVDSIMNQALELDDGQPVDDMSIVV 230
Cdd:TIGR02865 707 VLEGEKEVeGKVLWLVRKLKETNTN---DPEEIAEYLLEKAKELRSGKIKDDMTVIV 760
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, ...
128-231 4.30e-10

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, Transcription];


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 58.18  E-value: 4.30e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163847328 128 PFFVITPQELRSF---NTPSTPIGLHPLIRPQISEIPIAAYTYVVLFTDGLLRAGERRGEDLGLPNYLAAWPAHEGRDPQ 204
Cdd:COG2208  256 PALILSADGEIEVedlTALGLPIGLLPDYQYEVASLQLEPGDLLVLYTDGVTEARNSDGEFFGLERLLKILGRLLGQPAE 335
                         90       100
                 ....*....|....*....|....*...
gi 163847328 205 TLVDSIMNQALELDDGQPV-DDMSIVVL 231
Cdd:COG2208  336 EILEAILESLEELQGDQIQdDDITLLVL 363
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH