NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|16329875|ref|NP_440603|]
View 

sigma factor SibG regulation protein RsbU [Synechocystis sp. PCC 6803]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
247-449 5.88e-60

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


:

Pssm-ID: 254114  Cd Length: 192  Bit Score: 196.36  E-value: 5.88e-60
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875   247 WSIVIGDVMGKGVPAGLIMTMTRGMLRAEVLNRHSPAQILNHLNRVMYADLENShRFVTLFYSEYNPETSILSYSNAAHN 326
Cdd:pfam07228   5 VALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGE-RFATAVLAVYDPETGTLEYANAGHP 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875   327 PPLLWRAgsdSPQCLIPLDTEGALIGLESDSNYRDAQIQLVPGDVVLYYTDGLTDAGNAKGDRFDDKNLRIAFQRAceTA 406
Cdd:pfam07228  84 PPLLLRP---DGGVVELLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAER--HG 158
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|...
gi 16329875   407 QTAQGILTEIFTSVEAFvgsdnshqtDKIPARDDMTLVVLRVK 449
Cdd:pfam07228 159 LSPEELLDALLEDLLRL---------GGGELEDDITLLVLRVR 192
GAF smart00065
Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these ...
20-173 7.30e-15

Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these domains in PDE6B result in autosomal recessive inheritance of retinitis pigmentosa.


:

Pssm-ID: 214500  Cd Length: 149  Bit Score: 71.26  E-value: 7.30e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875     20 DLLGAMGYALRSLHnlnQFLELTPLMATRVTDADGSALVLMREGEISIFEQIHGHKNSlKGTIKGALQKARQVNLTlDSS 99
Cdd:smart00065   1 DLEELLQTILEELR---QLLGADRVLIYLVDENDRGELVLVAADGLTLPTLGIRFPLD-EGLAGRVAETGRPLNIP-DVE 75
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 16329875    100 TVLSYFDRQLRQELPAIACYNTPILSHQEEVGRLYIFSQDRNYSWTPTRRKLLQLISDQTAVAIANSDLNQKLR 173
Cdd:smart00065  76 ADPLFAEDLLGRYQGVRSFLAVPLVADGELVGVLALHNKKSPRPFTEEDEELLQALANQLAIALANAQLYEELR 149
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
62-450 1.30e-99

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


:

Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 305.48  E-value: 1.30e-99
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875  62 EGEISIFEQIHGHKNSLKGTIKGALQKA-RQVNLTLDSS---TVLSYFDRQLRQ--ELPAIACYNTPILSHQEEVGRLYI 135
Cdd:COG2208   2 FNGDLIMQAGRPEGGMLVGLIDKTLKGLyAQISAEPLTEmffLQTEKGLRQAELlyEINDILERFLPVEVLLGVSGKLRA 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875 136 FSQDRNYSWTPTRRKLLQLISDQTAVAIANSDLNQKLRSRESQDRELEIASEIQNQLLPRCCPQINGLDIAAQCKTASRV 215
Cdd:COG2208  82 LSEEIKHWRGGLPLVAELLVEINRAVGLVSAHNELLLLEQNNISAELEVARQIQQNLLPKALPLFPGIDIEAILVPASEV 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875 216 GGDYYDFIPANYDQLRqgdwlcrntshlgvpwsIVIGDVMGKGVPAGLIMTMTRGMLRA-EVLNRHSPAQILNHLNRVMY 294
Cdd:COG2208 162 GGDYYDFIQLGEKRLR-----------------IGIGDVSGKGVPAALLMLMPKLALRLlLESGPLDPADVLETLNRVLK 224
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875 295 ADLENSHrFVTLFYSEYNPETSILSYSNAAHNPPLLWRAGSDSpqCLIPLDTEGALIGLESDSNYRDAQIQLVPGDVVLY 374
Cdd:COG2208 225 QNLEEDM-FVTLFLGVYDLDSGELTYSNAGHEPALILSADGEI--EVEDLTALGLPIGLLPDYQYEVASLQLEPGDLLVL 301
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 16329875 375 YTDGLTDAGNAKGDRFDDKNLRIAFQRAceTAQTAQGILTEIFTSVEAFVGSDnshqtdkiPARDDMTLVVLRVKS 450
Cdd:COG2208 302 YTDGVTEARNSDGEFFGLERLLKILGRL--LGQPAEEILEAILESLEELQGDQ--------IQDDDITLLVLKVKK 367
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
247-449 5.88e-60

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 196.36  E-value: 5.88e-60
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875   247 WSIVIGDVMGKGVPAGLIMTMTRGMLRAEVLNRHSPAQILNHLNRVMYADLENShRFVTLFYSEYNPETSILSYSNAAHN 326
Cdd:pfam07228   5 VALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGE-RFATAVLAVYDPETGTLEYANAGHP 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875   327 PPLLWRAgsdSPQCLIPLDTEGALIGLESDSNYRDAQIQLVPGDVVLYYTDGLTDAGNAKGDRFDDKNLRIAFQRAceTA 406
Cdd:pfam07228  84 PPLLLRP---DGGVVELLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAER--HG 158
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|...
gi 16329875   407 QTAQGILTEIFTSVEAFvgsdnshqtDKIPARDDMTLVVLRVK 449
Cdd:pfam07228 159 LSPEELLDALLEDLLRL---------GGGELEDDITLLVLRVR 192
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
202-418 3.17e-50

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 170.61  E-value: 3.17e-50
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875    202 GLDIAAQCKTASRVGGDYYDFIPANYDQLRqgdwlcrntshlgvpwsIVIGDVMGKGVPAGLIMTMTRGMLRAEVLNRHS 281
Cdd:smart00331   3 GGLIAQYYEDATQVGGDFYDVVKLPEGRLL-----------------IAIADVMGKGLAAALAMSMARSALRTLLSEGIS 65
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875    282 PAQILNHLNRVMYaDLENSHRFVTLFYSEYNPETSILSYSNAAHNPPLLWRAGSDSpqcLIPLDTEGALIGLESDSNYRD 361
Cdd:smart00331  66 LSQILERLNRAIY-ENGEDGMFATLFLALYDFAGGTLSYANAGHSPPYLLRADGGL---VEDLDDLGAPLGLEPDVEVDV 141
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 16329875    362 AQIQLVPGDVVLYYTDGLTDAGNAkgdrFDDKNLRIAFQrACETAQTAQGILTEIFT 418
Cdd:smart00331 142 RELTLEPGDLLLLYTDGLTEARNP----ERLEELLEELL-GSPPAEIAQRILEELLE 193
GAF smart00065
Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these ...
20-173 7.30e-15

Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these domains in PDE6B result in autosomal recessive inheritance of retinitis pigmentosa.


Pssm-ID: 214500  Cd Length: 149  Bit Score: 71.26  E-value: 7.30e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875     20 DLLGAMGYALRSLHnlnQFLELTPLMATRVTDADGSALVLMREGEISIFEQIHGHKNSlKGTIKGALQKARQVNLTlDSS 99
Cdd:smart00065   1 DLEELLQTILEELR---QLLGADRVLIYLVDENDRGELVLVAADGLTLPTLGIRFPLD-EGLAGRVAETGRPLNIP-DVE 75
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 16329875    100 TVLSYFDRQLRQELPAIACYNTPILSHQEEVGRLYIFSQDRNYSWTPTRRKLLQLISDQTAVAIANSDLNQKLR 173
Cdd:smart00065  76 ADPLFAEDLLGRYQGVRSFLAVPLVADGELVGVLALHNKKSPRPFTEEDEELLQALANQLAIALANAQLYEELR 149
GAF_3 pfam13492
GAF domain;
34-165 1.52e-10

GAF domain;


Pssm-ID: 257816  Cd Length: 129  Bit Score: 58.22  E-value: 1.52e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875    34 NLNQFLELTPLMATRVTDADGSALVLMREG--EISIFEQIHGHKNsLKGTIKgalQKARQVNLTLDSSTVLSYFDRQLRQ 111
Cdd:pfam13492   1 DPDELLERALELLAELLGADRAALYLLDEDglELRLVAGSGGEPR-LSESLP---EDSPLAQRALEKGEPVSVPAGDNRD 76
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 16329875   112 ELPAIACYNTPILSHQEEVGRLYIFSqDRNYSWTPTRRKLLQLISDQTAVAIAN 165
Cdd:pfam13492  77 LLPSESLLAVPLRAGGEVIGVLVLES-TPEEAFTPEDLELLELLASQIAIALEN 129
FhlA COG2203
FOG: GAF domain [Signal transduction mechanisms]
106-176 9.76e-08

FOG: GAF domain [Signal transduction mechanisms]


Pssm-ID: 225113  Cd Length: 175  Bit Score: 50.36  E-value: 9.76e-08
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 16329875 106 DRQLRQELPAIACYNTPILSHQEEVGRLYIFSQDRNYSWTPTRRKLLQLISDQTAVAIANSDLNQKLRSRE 176
Cdd:COG2203 105 NPLVLLEPPIRSYLGVPLIAQGELLGLLCVHDSEPRRQWSEEELELLEELAEQVAIAIERARLYEELQEAE 175
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
62-450 1.30e-99

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 305.48  E-value: 1.30e-99
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875  62 EGEISIFEQIHGHKNSLKGTIKGALQKA-RQVNLTLDSS---TVLSYFDRQLRQ--ELPAIACYNTPILSHQEEVGRLYI 135
Cdd:COG2208   2 FNGDLIMQAGRPEGGMLVGLIDKTLKGLyAQISAEPLTEmffLQTEKGLRQAELlyEINDILERFLPVEVLLGVSGKLRA 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875 136 FSQDRNYSWTPTRRKLLQLISDQTAVAIANSDLNQKLRSRESQDRELEIASEIQNQLLPRCCPQINGLDIAAQCKTASRV 215
Cdd:COG2208  82 LSEEIKHWRGGLPLVAELLVEINRAVGLVSAHNELLLLEQNNISAELEVARQIQQNLLPKALPLFPGIDIEAILVPASEV 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875 216 GGDYYDFIPANYDQLRqgdwlcrntshlgvpwsIVIGDVMGKGVPAGLIMTMTRGMLRA-EVLNRHSPAQILNHLNRVMY 294
Cdd:COG2208 162 GGDYYDFIQLGEKRLR-----------------IGIGDVSGKGVPAALLMLMPKLALRLlLESGPLDPADVLETLNRVLK 224
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875 295 ADLENSHrFVTLFYSEYNPETSILSYSNAAHNPPLLWRAGSDSpqCLIPLDTEGALIGLESDSNYRDAQIQLVPGDVVLY 374
Cdd:COG2208 225 QNLEEDM-FVTLFLGVYDLDSGELTYSNAGHEPALILSADGEI--EVEDLTALGLPIGLLPDYQYEVASLQLEPGDLLVL 301
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 16329875 375 YTDGLTDAGNAKGDRFDDKNLRIAFQRAceTAQTAQGILTEIFTSVEAFVGSDnshqtdkiPARDDMTLVVLRVKS 450
Cdd:COG2208 302 YTDGVTEARNSDGEFFGLERLLKILGRL--LGQPAEEILEAILESLEELQGDQ--------IQDDDITLLVLKVKK 367
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
247-449 5.88e-60

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 196.36  E-value: 5.88e-60
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875   247 WSIVIGDVMGKGVPAGLIMTMTRGMLRAEVLNRHSPAQILNHLNRVMYADLENShRFVTLFYSEYNPETSILSYSNAAHN 326
Cdd:pfam07228   5 VALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGE-RFATAVLAVYDPETGTLEYANAGHP 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875   327 PPLLWRAgsdSPQCLIPLDTEGALIGLESDSNYRDAQIQLVPGDVVLYYTDGLTDAGNAKGDRFDDKNLRIAFQRAceTA 406
Cdd:pfam07228  84 PPLLLRP---DGGVVELLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAER--HG 158
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|...
gi 16329875   407 QTAQGILTEIFTSVEAFvgsdnshqtDKIPARDDMTLVVLRVK 449
Cdd:pfam07228 159 LSPEELLDALLEDLLRL---------GGGELEDDITLLVLRVR 192
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
202-418 3.17e-50

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 170.61  E-value: 3.17e-50
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875    202 GLDIAAQCKTASRVGGDYYDFIPANYDQLRqgdwlcrntshlgvpwsIVIGDVMGKGVPAGLIMTMTRGMLRAEVLNRHS 281
Cdd:smart00331   3 GGLIAQYYEDATQVGGDFYDVVKLPEGRLL-----------------IAIADVMGKGLAAALAMSMARSALRTLLSEGIS 65
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875    282 PAQILNHLNRVMYaDLENSHRFVTLFYSEYNPETSILSYSNAAHNPPLLWRAGSDSpqcLIPLDTEGALIGLESDSNYRD 361
Cdd:smart00331  66 LSQILERLNRAIY-ENGEDGMFATLFLALYDFAGGTLSYANAGHSPPYLLRADGGL---VEDLDDLGAPLGLEPDVEVDV 141
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 16329875    362 AQIQLVPGDVVLYYTDGLTDAGNAkgdrFDDKNLRIAFQrACETAQTAQGILTEIFT 418
Cdd:smart00331 142 RELTLEPGDLLLLYTDGLTEARNP----ERLEELLEELL-GSPPAEIAQRILEELLE 193
GAF smart00065
Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these ...
20-173 7.30e-15

Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these domains in PDE6B result in autosomal recessive inheritance of retinitis pigmentosa.


Pssm-ID: 214500  Cd Length: 149  Bit Score: 71.26  E-value: 7.30e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875     20 DLLGAMGYALRSLHnlnQFLELTPLMATRVTDADGSALVLMREGEISIFEQIHGHKNSlKGTIKGALQKARQVNLTlDSS 99
Cdd:smart00065   1 DLEELLQTILEELR---QLLGADRVLIYLVDENDRGELVLVAADGLTLPTLGIRFPLD-EGLAGRVAETGRPLNIP-DVE 75
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 16329875    100 TVLSYFDRQLRQELPAIACYNTPILSHQEEVGRLYIFSQDRNYSWTPTRRKLLQLISDQTAVAIANSDLNQKLR 173
Cdd:smart00065  76 ADPLFAEDLLGRYQGVRSFLAVPLVADGELVGVLALHNKKSPRPFTEEDEELLQALANQLAIALANAQLYEELR 149
GAF_3 pfam13492
GAF domain;
34-165 1.52e-10

GAF domain;


Pssm-ID: 257816  Cd Length: 129  Bit Score: 58.22  E-value: 1.52e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875    34 NLNQFLELTPLMATRVTDADGSALVLMREG--EISIFEQIHGHKNsLKGTIKgalQKARQVNLTLDSSTVLSYFDRQLRQ 111
Cdd:pfam13492   1 DPDELLERALELLAELLGADRAALYLLDEDglELRLVAGSGGEPR-LSESLP---EDSPLAQRALEKGEPVSVPAGDNRD 76
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 16329875   112 ELPAIACYNTPILSHQEEVGRLYIFSqDRNYSWTPTRRKLLQLISDQTAVAIAN 165
Cdd:pfam13492  77 LLPSESLLAVPLRAGGEVIGVLVLES-TPEEAFTPEDLELLELLASQIAIALEN 129
FhlA COG2203
FOG: GAF domain [Signal transduction mechanisms]
106-176 9.76e-08

FOG: GAF domain [Signal transduction mechanisms]


Pssm-ID: 225113  Cd Length: 175  Bit Score: 50.36  E-value: 9.76e-08
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 16329875 106 DRQLRQELPAIACYNTPILSHQEEVGRLYIFSQDRNYSWTPTRRKLLQLISDQTAVAIANSDLNQKLRSRE 176
Cdd:COG2203 105 NPLVLLEPPIRSYLGVPLIAQGELLGLLCVHDSEPRRQWSEEELELLEELAEQVAIAIERARLYEELQEAE 175
GAF pfam01590
GAF domain; This domain is present in cGMP-specific phosphodiesterases, adenylyl and guanylyl ...
34-163 4.80e-04

GAF domain; This domain is present in cGMP-specific phosphodiesterases, adenylyl and guanylyl cyclases, phytochromes, FhlA and NifA. Adenylyl and guanylyl cyclases catalyse ATP and GTP to the second messengers cAMP and cGMP, respectively, these products up-regulating catalytic activity by binding to the regulatory GAF domain(s). The opposite hydrolysis reaction is catalysed by phosphodiesterase. cGMP-dependent 3',5'-cyclic phosphodiesterase catalyses the conversion of guanosine 3',5'-cyclic phosphate to guanosine 5'-phosphate. Here too, cGMP regulates catalytic activity by GAF-domain binding. Phytochromes are regulatory photoreceptors in plants and bacteria which exist in two thermally-stable states that are reversibly inter-convertible by light: the Pr state absorbs maximally in the red region of the spectrum, while the Pfr state absorbs maximally in the far-red region. This domain is also found in FhlA (formate hydrogen lyase transcriptional activator) and NifA, a transcriptional activator which is required for activation of most Nif operons which are directly involved in nitrogen fixation. NifA interacts with sigma-54.


Pssm-ID: 250726  Cd Length: 146  Bit Score: 39.10  E-value: 4.80e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875    34 NLNQFLELTPLMATRVTDADGSALVLMREGEISIFEQIHGHKN---------SLKGTIKGALQKARQVNLTLDSS----- 99
Cdd:pfam01590   1 DLEELLQTILEELRELLGADRVAIYLADADGLLLYLVAGDGLSdiplaarglPLGGGVVGEVIAGGNPIVVPDVQddprf 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 16329875   100 ---TVLSYFDRQLRQELPAIACYNTPILSHQEEVGRLYIfSQDRNYSWTPTRRKLLQLISDQTAVAI 163
Cdd:pfam01590  81 rdlTALASDLPHFLRGLGIRSCLAVPLKGGGELIGVLVL-HSTSPRAFTEEELELLQALADQVAIAL 146
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
62-450 1.30e-99

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 305.48  E-value: 1.30e-99
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875  62 EGEISIFEQIHGHKNSLKGTIKGALQKA-RQVNLTLDSS---TVLSYFDRQLRQ--ELPAIACYNTPILSHQEEVGRLYI 135
Cdd:COG2208   2 FNGDLIMQAGRPEGGMLVGLIDKTLKGLyAQISAEPLTEmffLQTEKGLRQAELlyEINDILERFLPVEVLLGVSGKLRA 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875 136 FSQDRNYSWTPTRRKLLQLISDQTAVAIANSDLNQKLRSRESQDRELEIASEIQNQLLPRCCPQINGLDIAAQCKTASRV 215
Cdd:COG2208  82 LSEEIKHWRGGLPLVAELLVEINRAVGLVSAHNELLLLEQNNISAELEVARQIQQNLLPKALPLFPGIDIEAILVPASEV 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875 216 GGDYYDFIPANYDQLRqgdwlcrntshlgvpwsIVIGDVMGKGVPAGLIMTMTRGMLRA-EVLNRHSPAQILNHLNRVMY 294
Cdd:COG2208 162 GGDYYDFIQLGEKRLR-----------------IGIGDVSGKGVPAALLMLMPKLALRLlLESGPLDPADVLETLNRVLK 224
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875 295 ADLENSHrFVTLFYSEYNPETSILSYSNAAHNPPLLWRAGSDSpqCLIPLDTEGALIGLESDSNYRDAQIQLVPGDVVLY 374
Cdd:COG2208 225 QNLEEDM-FVTLFLGVYDLDSGELTYSNAGHEPALILSADGEI--EVEDLTALGLPIGLLPDYQYEVASLQLEPGDLLVL 301
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 16329875 375 YTDGLTDAGNAKGDRFDDKNLRIAFQRAceTAQTAQGILTEIFTSVEAFVGSDnshqtdkiPARDDMTLVVLRVKS 450
Cdd:COG2208 302 YTDGVTEARNSDGEFFGLERLLKILGRL--LGQPAEEILEAILESLEELQGDQ--------IQDDDITLLVLKVKK 367
KdpD COG2205
Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms]
112-193 9.29e-03

Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms]


Pssm-ID: 225115 [Multi-domain]  Cd Length: 890  Bit Score: 37.27  E-value: 9.29e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329875 112 ELPAIACYNTPILSHQEEVGRLYIFSQDRNYSwTPTRRKLLQLISDQTAVAIANSDLnqklrSRESQDRELEIASE-IQN 190
Cdd:COG2205 588 TLPGAKYLYLPLKSGGKVLGVLGVEPGLSPLL-APEQRRLLDAVLTQIALALERVTL-----AEEAEQARLAAERErLRS 661

                ...
gi 16329875 191 QLL 193
Cdd:COG2205 662 ALL 664
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH