NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|16127588|ref|NP_422152|]
View 

methyl-accepting chemotaxis protein McpL [Caulobacter crescentus CB15]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
367-566 7.59e-54

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


:

Pssm-ID: 206779  Cd Length: 200  Bit Score: 183.21  E-value: 7.59e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588 367 EQQAAGLEQTAAALDEVTATIKTTAINARTAYNEVAVSRDLIGASSAVASEAGVAMERIDTSSRKIGQIITVVDEIAFQT 446
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588 447 NLLALNAGVEAARAGEAGRGFAVVAMEVRALAQRSADAAKEIKTLVEEAGRSVENGVELVGRVGNELTGVVAQFGKIQTL 526
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 16127588 527 VEGIAQAAHDQATGLGEVNSAVGQMDQVTQQNAAMVEETT 566
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
HAMP pfam00672
HAMP domain;
188-249 1.62e-04

HAMP domain;


:

Pssm-ID: 250044  Cd Length: 70  Bit Score: 40.29  E-value: 1.62e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 16127588   188 LGVVAVAMLGMILLGVGALRKRIIQPLAGMTAYMGRLAEGDYSQEPPmRERKDEVGEMAAAV 249
Cdd:pfam00672   1 LLLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVP-VSGPDEIGELARAF 61
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
221-588 5.77e-71

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


:

Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 236.43  E-value: 5.77e-71
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588 221 MGRLAEGDYSQE-PPMRERKDEVGEMAAAVSVFRAAAIERRQAV--QLEKDREAAAREEAFVAAEAEARGRRSFV--VDA 295
Cdd:COG0840  11 LIELAAGEADAGlLKLKKLIDELGKLLLSLNLILDDAASAEAAAlkAVLKFLLISLLVAIIVVLVLAILLLRAILepISD 90
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588 296 LDEGLRRLAQGDLSQRIDAAFPEEFERLRRNFNDSIVTLRETIHQVVSSASAVGGGARQITVAADDLARRTEQQAAGLEQ 375
Cdd:COG0840  91 LLEVVERIAAGDLTKRIDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEE 170
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588 376 TAAALDEVTATIKTTAINARTAYNEV-----------AVSRDLIGASSAVASEAGVAMERIDTSSRKIGQIITVVDEIAF 444
Cdd:COG0840 171 VASAIEELSETVKEVAFNAKEAAALAseasqvaeeggEEVRQAVEQMQEIAEELAEVVKKLSESSQEIEEITSVINSIAE 250
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588 445 QTNLLALNAGVEAARAGEAGRGFAVVAMEVRALAQRSADAAKEIKTLVEEAGRS--------------VENGVELVGRVG 510
Cdd:COG0840 251 QTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEaadavehmeesaseVSEGVKLVEETG 330
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 16127588 511 NELTGVVAQFGKIQTLVEGIAQAAHDQATGLGEVNSAVGQMDQVTQQNAAMVEETTAASHSLTNEARQLAQLMDRFKT 588
Cdd:COG0840 331 SSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
367-566 7.59e-54

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 183.21  E-value: 7.59e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588 367 EQQAAGLEQTAAALDEVTATIKTTAINARTAYNEVAVSRDLIGASSAVASEAGVAMERIDTSSRKIGQIITVVDEIAFQT 446
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588 447 NLLALNAGVEAARAGEAGRGFAVVAMEVRALAQRSADAAKEIKTLVEEAGRSVENGVELVGRVGNELTGVVAQFGKIQTL 526
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 16127588 527 VEGIAQAAHDQATGLGEVNSAVGQMDQVTQQNAAMVEETT 566
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
HAMP pfam00672
HAMP domain;
188-249 1.62e-04

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 40.29  E-value: 1.62e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 16127588   188 LGVVAVAMLGMILLGVGALRKRIIQPLAGMTAYMGRLAEGDYSQEPPmRERKDEVGEMAAAV 249
Cdd:pfam00672   1 LLLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVP-VSGPDEIGELARAF 61
HAMP smart00304
HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;
208-261 6.29e-03

HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;


Pssm-ID: 197640  Cd Length: 53  Bit Score: 35.30  E-value: 6.29e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
gi 16127588    208 KRIIQPLAGMTAYMGRLAEGDYSQEPPMrERKDEVGEMAAAVSVFRAAAIERRQ 261
Cdd:smart00304   1 RRLLRPLRRLAEAAQRIADGDLTVRLPV-DGRDEIGELARAFNEMADRLEETIA 53
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
221-588 5.77e-71

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 236.43  E-value: 5.77e-71
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588 221 MGRLAEGDYSQE-PPMRERKDEVGEMAAAVSVFRAAAIERRQAV--QLEKDREAAAREEAFVAAEAEARGRRSFV--VDA 295
Cdd:COG0840  11 LIELAAGEADAGlLKLKKLIDELGKLLLSLNLILDDAASAEAAAlkAVLKFLLISLLVAIIVVLVLAILLLRAILepISD 90
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588 296 LDEGLRRLAQGDLSQRIDAAFPEEFERLRRNFNDSIVTLRETIHQVVSSASAVGGGARQITVAADDLARRTEQQAAGLEQ 375
Cdd:COG0840  91 LLEVVERIAAGDLTKRIDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEE 170
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588 376 TAAALDEVTATIKTTAINARTAYNEV-----------AVSRDLIGASSAVASEAGVAMERIDTSSRKIGQIITVVDEIAF 444
Cdd:COG0840 171 VASAIEELSETVKEVAFNAKEAAALAseasqvaeeggEEVRQAVEQMQEIAEELAEVVKKLSESSQEIEEITSVINSIAE 250
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588 445 QTNLLALNAGVEAARAGEAGRGFAVVAMEVRALAQRSADAAKEIKTLVEEAGRS--------------VENGVELVGRVG 510
Cdd:COG0840 251 QTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEaadavehmeesaseVSEGVKLVEETG 330
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 16127588 511 NELTGVVAQFGKIQTLVEGIAQAAHDQATGLGEVNSAVGQMDQVTQQNAAMVEETTAASHSLTNEARQLAQLMDRFKT 588
Cdd:COG0840 331 SSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
340-587 1.15e-68

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 225.24  E-value: 1.15e-68
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588    340 QVVSSASAVGGGARQITVAADDLARRTEQQAAGLEQTAAALDEVTATIKTTAINARTAYNEVAVSRDLIGASSAVASEAG 419
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588    420 VAMERIDTSSRKIGQIITVVDEIAFQTNLLALNAGVEAARAGEAGRGFAVVAMEVRALAQRSADAAKEIKTLV------- 492
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIkeiqeet 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588    493 -------EEAGRSVENGVELVGRVGNELTGVVAQFGKIQTLVEGIAQAAHDQATGLGEVNSAVGQMDQVTQQNAAMVEET 565
Cdd:smart00283 161 neavaamEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260
                   ....*....|....*....|..
gi 16127588    566 TAASHSLTNEARQLAQLMDRFK 587
Cdd:smart00283 241 SAAAEELSGLAEELDELVERFK 262
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
296-589 1.94e-65

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 225.22  E-value: 1.94e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588  296 LDEGLRRLAQGDLSQRIDAAFPEEFERLRRNFNDSIVTLRETIHQVVSSASAVGGGARQITVAADDLARRTEQQAAGLEQ 375
Cdd:PRK15041 225 LIDSIRHIAGGDLVKPIEVDGSNEMGQLAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEE 304
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588  376 TAAALDEVTATIKTTAINARTAYNEVAVSRDLIGASSAVASEAGVAMERIDTSSRKIGQIITVVDEIAFQTNLLALNAGV 455
Cdd:PRK15041 305 TAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAV 384
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588  456 EAARAGEAGRGFAVVAMEVRALAQRSADAAKEIKTLVEEAGRSVENGVELVGRVGNELTGVVAQFGKIQTLVEGIAQAAH 535
Cdd:PRK15041 385 EAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASD 464
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....
gi 16127588  536 DQATGLGEVNSAVGQMDQVTQQNAAMVEETTAASHSLTNEARQLAQLMDRFKTE 589
Cdd:PRK15041 465 EQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRIQ 518
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
414-589 5.26e-50

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 173.40  E-value: 5.26e-50
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588   414 VASEAGVAMERIDTSSRKIGQIITVVDEIAFQTNLLALNAGVEAARAGEAGRGFAVVAMEVRALAQRSADAAKEIKTLVE 493
Cdd:pfam00015  24 VVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAAKEIEALIE 103
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588   494 E--------------AGRSVENGVELVGRVGNELTGVVAQFGKIQTLVEGIAQAAHDQATGLGEVNSAVGQMDQVTQQNA 559
Cdd:pfam00015 104 EivkqtndstasiqqTRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQSAGIDQVNQAVARIDQVTQQNA 183
                         170       180       190
                  ....*....|....*....|....*....|
gi 16127588   560 AMVEETTAASHSLTNEARQLAQLMDRFKTE 589
Cdd:pfam00015 184 ALVEESAAAAETLEEQAEELTASVAQFRIK 213
sensor_protein_TorS TIGR02956
TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the ...
186-261 2.49e-03

TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems]


Pssm-ID: 274362 [Multi-domain]  Cd Length: 968  Bit Score: 39.38  E-value: 2.49e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 16127588   186 AGLGVVAVAMLGMILLGVGALR---KRIIQPLAGMTAYMGRLAEGDYSQEPPMRErKDEVGEMAAAVSVFRAAAIERRQ 261
Cdd:TIGR02956 329 AQFGLLITGMLGLVILVFIMWRvvyRSVILRLNQHTQALLRLALGDLDISLDARG-DDELAHMGRAIEAFRDTAAHNLK 406
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
367-566 7.59e-54

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 183.21  E-value: 7.59e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588 367 EQQAAGLEQTAAALDEVTATIKTTAINARTAYNEVAVSRDLIGASSAVASEAGVAMERIDTSSRKIGQIITVVDEIAFQT 446
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588 447 NLLALNAGVEAARAGEAGRGFAVVAMEVRALAQRSADAAKEIKTLVEEAGRSVENGVELVGRVGNELTGVVAQFGKIQTL 526
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 16127588 527 VEGIAQAAHDQATGLGEVNSAVGQMDQVTQQNAAMVEETT 566
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
HAMP pfam00672
HAMP domain;
188-249 1.62e-04

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 40.29  E-value: 1.62e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 16127588   188 LGVVAVAMLGMILLGVGALRKRIIQPLAGMTAYMGRLAEGDYSQEPPmRERKDEVGEMAAAV 249
Cdd:pfam00672   1 LLLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVP-VSGPDEIGELARAF 61
HAMP smart00304
HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;
208-261 6.29e-03

HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;


Pssm-ID: 197640  Cd Length: 53  Bit Score: 35.30  E-value: 6.29e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
gi 16127588    208 KRIIQPLAGMTAYMGRLAEGDYSQEPPMrERKDEVGEMAAAVSVFRAAAIERRQ 261
Cdd:smart00304   1 RRLLRPLRRLAEAAQRIADGDLTVRLPV-DGRDEIGELARAFNEMADRLEETIA 53
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
221-588 5.77e-71

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 236.43  E-value: 5.77e-71
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588 221 MGRLAEGDYSQE-PPMRERKDEVGEMAAAVSVFRAAAIERRQAV--QLEKDREAAAREEAFVAAEAEARGRRSFV--VDA 295
Cdd:COG0840  11 LIELAAGEADAGlLKLKKLIDELGKLLLSLNLILDDAASAEAAAlkAVLKFLLISLLVAIIVVLVLAILLLRAILepISD 90
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588 296 LDEGLRRLAQGDLSQRIDAAFPEEFERLRRNFNDSIVTLRETIHQVVSSASAVGGGARQITVAADDLARRTEQQAAGLEQ 375
Cdd:COG0840  91 LLEVVERIAAGDLTKRIDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEE 170
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588 376 TAAALDEVTATIKTTAINARTAYNEV-----------AVSRDLIGASSAVASEAGVAMERIDTSSRKIGQIITVVDEIAF 444
Cdd:COG0840 171 VASAIEELSETVKEVAFNAKEAAALAseasqvaeeggEEVRQAVEQMQEIAEELAEVVKKLSESSQEIEEITSVINSIAE 250
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588 445 QTNLLALNAGVEAARAGEAGRGFAVVAMEVRALAQRSADAAKEIKTLVEEAGRS--------------VENGVELVGRVG 510
Cdd:COG0840 251 QTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEaadavehmeesaseVSEGVKLVEETG 330
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 16127588 511 NELTGVVAQFGKIQTLVEGIAQAAHDQATGLGEVNSAVGQMDQVTQQNAAMVEETTAASHSLTNEARQLAQLMDRFKT 588
Cdd:COG0840 331 SSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
340-587 1.15e-68

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 225.24  E-value: 1.15e-68
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588    340 QVVSSASAVGGGARQITVAADDLARRTEQQAAGLEQTAAALDEVTATIKTTAINARTAYNEVAVSRDLIGASSAVASEAG 419
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588    420 VAMERIDTSSRKIGQIITVVDEIAFQTNLLALNAGVEAARAGEAGRGFAVVAMEVRALAQRSADAAKEIKTLV------- 492
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIkeiqeet 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588    493 -------EEAGRSVENGVELVGRVGNELTGVVAQFGKIQTLVEGIAQAAHDQATGLGEVNSAVGQMDQVTQQNAAMVEET 565
Cdd:smart00283 161 neavaamEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260
                   ....*....|....*....|..
gi 16127588    566 TAASHSLTNEARQLAQLMDRFK 587
Cdd:smart00283 241 SAAAEELSGLAEELDELVERFK 262
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
296-589 1.94e-65

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 225.22  E-value: 1.94e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588  296 LDEGLRRLAQGDLSQRIDAAFPEEFERLRRNFNDSIVTLRETIHQVVSSASAVGGGARQITVAADDLARRTEQQAAGLEQ 375
Cdd:PRK15041 225 LIDSIRHIAGGDLVKPIEVDGSNEMGQLAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEE 304
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588  376 TAAALDEVTATIKTTAINARTAYNEVAVSRDLIGASSAVASEAGVAMERIDTSSRKIGQIITVVDEIAFQTNLLALNAGV 455
Cdd:PRK15041 305 TAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAV 384
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588  456 EAARAGEAGRGFAVVAMEVRALAQRSADAAKEIKTLVEEAGRSVENGVELVGRVGNELTGVVAQFGKIQTLVEGIAQAAH 535
Cdd:PRK15041 385 EAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASD 464
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....
gi 16127588  536 DQATGLGEVNSAVGQMDQVTQQNAAMVEETTAASHSLTNEARQLAQLMDRFKTE 589
Cdd:PRK15041 465 EQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRIQ 518
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
303-589 8.02e-65

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 223.02  E-value: 8.02e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588  303 LAQGDLSQRIDAAFPEEFERLRRNFNDSIVTLRETIHQVVSSASAVGGGARQITVAADDLARRTEQQAAGLEQTAAALDE 382
Cdd:PRK09793 228 IAAGNLARPIAVYGRNEITAIFASLKTMQQALRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAASLAQTAASMEQ 307
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588  383 VTATIKTTAINARTAYNEVAVSRDLIGASSAVASEAGVAMERIDTSSRKIGQIITVVDEIAFQTNLLALNAGVEAARAGE 462
Cdd:PRK09793 308 LTATVGQNADNARQASELAKNAATTAQAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGE 387
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588  463 AGRGFAVVAMEVRALAQRSADAAKEIKTLVEEAGRSVENGVELVGRVGNELTGVVAQFGKIQTLVEGIAQAAHDQATGLG 542
Cdd:PRK09793 388 QGRGFAVVAGEVRNLASRSAQAAKEIKGLIEESVNRVQQGSKLVNNAAATMTDIVSSVTRVNDIMGEIASASEEQRRGIE 467
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 16127588  543 EVNSAVGQMDQVTQQNAAMVEETTAASHSLTNEARQLAQLMDRFKTE 589
Cdd:PRK09793 468 QVAQAVSQMDQVTQQNASLVEEAAVATEQLANQADHLSSRVAVFTLE 514
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
300-594 8.99e-63

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 217.95  E-value: 8.99e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588  300 LRRLAQGDLSQRIDAAFPEEFERLRRNFNDSIVTLRETIHQVVSSASAVGGGARQITVAADDLARRTEQQAAGLEQTAAA 379
Cdd:PRK15048 227 IREIAGGNLANTLTIDGRSEMGDLAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASALEETAAS 306
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588  380 LDEVTATIKTTAINARTAYNEVAVSRDLIGASSAVASEAGVAMERIDTSSRKIGQIITVVDEIAFQTNLLALNAGVEAAR 459
Cdd:PRK15048 307 MEQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDGVVKTMHEIADSSKKIADIISVIDGIAFQTNILALNAAVEAAR 386
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588  460 AGEAGRGFAVVAMEVRALAQRSADAAKEIKTLVEEAGRSVENGVELVGRVGNELTGVVAQFGKIQTLVEGIAQAAHDQAT 539
Cdd:PRK15048 387 AGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDSVSRVDTGSVLVESAGETMNNIVNAVTRVTDIMGEIASASDEQSR 466
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 16127588  540 GLGEVNSAVGQMDQVTQQNAAMVEETTAASHSLTNEARQLAQLMDRFKTEGGAAT 594
Cdd:PRK15048 467 GIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQASRLTQAVSAFRLAASPLT 521
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
414-589 5.26e-50

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 173.40  E-value: 5.26e-50
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588   414 VASEAGVAMERIDTSSRKIGQIITVVDEIAFQTNLLALNAGVEAARAGEAGRGFAVVAMEVRALAQRSADAAKEIKTLVE 493
Cdd:pfam00015  24 VVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAAKEIEALIE 103
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127588   494 E--------------AGRSVENGVELVGRVGNELTGVVAQFGKIQTLVEGIAQAAHDQATGLGEVNSAVGQMDQVTQQNA 559
Cdd:pfam00015 104 EivkqtndstasiqqTRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQSAGIDQVNQAVARIDQVTQQNA 183
                         170       180       190
                  ....*....|....*....|....*....|
gi 16127588   560 AMVEETTAASHSLTNEARQLAQLMDRFKTE 589
Cdd:pfam00015 184 ALVEESAAAAETLEEQAEELTASVAQFRIK 213
sensor_protein_TorS TIGR02956
TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the ...
186-261 2.49e-03

TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems]


Pssm-ID: 274362 [Multi-domain]  Cd Length: 968  Bit Score: 39.38  E-value: 2.49e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 16127588   186 AGLGVVAVAMLGMILLGVGALR---KRIIQPLAGMTAYMGRLAEGDYSQEPPMRErKDEVGEMAAAVSVFRAAAIERRQ 261
Cdd:TIGR02956 329 AQFGLLITGMLGLVILVFIMWRvvyRSVILRLNQHTQALLRLALGDLDISLDARG-DDELAHMGRAIEAFRDTAAHNLK 406
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH