NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|16124416|ref|NP_418980|]
View 

hypothetical protein CC_0161 [Caulobacter crescentus CB15]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCP_signal super family cl23763
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
33-106 2.03e-10

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


The actual alignment was detected with superfamily member cd11386:

Pssm-ID: 304920  Cd Length: 200  Bit Score: 58.40  E-value: 2.03e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16124416  33 ERILDLSERLSSVAGAkIGEIA-RVNraakMLAINALIVAARAGEAGKGFAIVAEEFKKIS-------TEIDAVAAALES 104
Cdd:cd11386  57 EELEESSAEIGEIVEV-IDDIAeQTN----LLALNAAIEAARAGEAGRGFAVVADEVRKLAeesaeaaKEIEELIEEIQE 131

                ..
gi 16124416 105 QV 106
Cdd:cd11386 132 QT 133
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
33-106 2.03e-10

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 58.40  E-value: 2.03e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16124416  33 ERILDLSERLSSVAGAkIGEIA-RVNraakMLAINALIVAARAGEAGKGFAIVAEEFKKIS-------TEIDAVAAALES 104
Cdd:cd11386  57 EELEESSAEIGEIVEV-IDDIAeQTN----LLALNAAIEAARAGEAGRGFAVVADEVRKLAeesaeaaKEIEELIEEIQE 131

                ..
gi 16124416 105 QV 106
Cdd:cd11386 132 QT 133
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
33-142 7.21e-11

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 60.76  E-value: 7.21e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16124416     33 ERILDLSERLSSVAGAkIGEIA-RVNraakMLAINALIVAARAGEAGKGFAIVAEEFKKI-------STEIDAVAAALES 104
Cdd:smart00283  84 EELEESSDEIGEIVSV-IDDIAdQTN----LLALNAAIEAARAGEAGRGFAVVADEVRKLaersaesAKEIESLIKEIQE 158
                           90       100       110
                   ....*....|....*....|....*....|....*....
gi 16124416    105 QVRSDLDELSAIGGAILghmRGQRLADLALNAIE-IVDR 142
Cdd:smart00283 159 ETNEAVAAMEESSSEVE---EGVELVEETGDALEeIVDS 194
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
33-120 6.08e-09

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 55.77  E-value: 6.08e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16124416  33 ERILDLSERLSSVAGA--KIGEIARvnrAAKMLAINALIVAARAGEAGKGFAIVAEEFKKISTEIDAVAAALESQVRSDL 110
Cdd:COG0840 226 EVVKKLSESSQEIEEItsVINSIAE---QTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQ 302
                        90
                ....*....|
gi 16124416 111 DELSAIGGAI 120
Cdd:COG0840 303 NEAADAVEHM 312
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
48-100 1.08e-07

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444 [Multi-domain]  Cd Length: 207  Bit Score: 50.52  E-value: 1.08e-07
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 16124416    48 AKIGEIARV-NRAA---KMLAINALIVAARAGEAGKGFAIVAEEFKKISTEiDAVAA 100
Cdd:pfam00015  37 KKISDIISViDEIAfqtNLLALNAAIEAARAGEQGRGFAVVADEVRKLAER-SAQAA 92
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
49-93 5.66e-05

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 43.52  E-value: 5.66e-05
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*....
gi 16124416   49 KIGEIARVNRA----AKMLAINALIVAARAGEAGKGFAIVAEEFKKIST 93
Cdd:PRK09793 356 KIGDIISVIDGiafqTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAS 404
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
33-106 2.03e-10

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 58.40  E-value: 2.03e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16124416  33 ERILDLSERLSSVAGAkIGEIA-RVNraakMLAINALIVAARAGEAGKGFAIVAEEFKKIS-------TEIDAVAAALES 104
Cdd:cd11386  57 EELEESSAEIGEIVEV-IDDIAeQTN----LLALNAAIEAARAGEAGRGFAVVADEVRKLAeesaeaaKEIEELIEEIQE 131

                ..
gi 16124416 105 QV 106
Cdd:cd11386 132 QT 133
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
33-142 7.21e-11

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 60.76  E-value: 7.21e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16124416     33 ERILDLSERLSSVAGAkIGEIA-RVNraakMLAINALIVAARAGEAGKGFAIVAEEFKKI-------STEIDAVAAALES 104
Cdd:smart00283  84 EELEESSDEIGEIVSV-IDDIAdQTN----LLALNAAIEAARAGEAGRGFAVVADEVRKLaersaesAKEIESLIKEIQE 158
                           90       100       110
                   ....*....|....*....|....*....|....*....
gi 16124416    105 QVRSDLDELSAIGGAILghmRGQRLADLALNAIE-IVDR 142
Cdd:smart00283 159 ETNEAVAAMEESSSEVE---EGVELVEETGDALEeIVDS 194
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
33-120 6.08e-09

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 55.77  E-value: 6.08e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16124416  33 ERILDLSERLSSVAGA--KIGEIARvnrAAKMLAINALIVAARAGEAGKGFAIVAEEFKKISTEIDAVAAALESQVRSDL 110
Cdd:COG0840 226 EVVKKLSESSQEIEEItsVINSIAE---QTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQ 302
                        90
                ....*....|
gi 16124416 111 DELSAIGGAI 120
Cdd:COG0840 303 NEAADAVEHM 312
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
48-100 1.08e-07

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444 [Multi-domain]  Cd Length: 207  Bit Score: 50.52  E-value: 1.08e-07
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 16124416    48 AKIGEIARV-NRAA---KMLAINALIVAARAGEAGKGFAIVAEEFKKISTEiDAVAA 100
Cdd:pfam00015  37 KKISDIISViDEIAfqtNLLALNAAIEAARAGEQGRGFAVVADEVRKLAER-SAQAA 92
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
49-93 5.66e-05

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 43.52  E-value: 5.66e-05
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*....
gi 16124416   49 KIGEIARVNRA----AKMLAINALIVAARAGEAGKGFAIVAEEFKKIST 93
Cdd:PRK09793 356 KIGDIISVIDGiafqTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAS 404
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
62-140 1.58e-04

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 42.30  E-value: 1.58e-04
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 16124416   62 MLAINALIVAARAGEAGKGFAIVAEEFKKISTEIDAVAAALESQVRSDLDELSAigGAILGHMRGQRLADLaLNAIEIV 140
Cdd:PRK15048 375 ILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDSVSRVDT--GSVLVESAGETMNNI-VNAVTRV 450
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
21-140 3.11e-04

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 41.09  E-value: 3.11e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16124416   21 ALSMEQDASLRPERILDLSERLSSVAGA--KIGEIARVNRA----AKMLAINALIVAARAGEAGKGFAIVAEEFKKISTE 94
Cdd:PRK15041 330 ALSASETAQRGGKVVDNVVQTMRDISTSsqKIADIISVIDGiafqTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQR 409
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 16124416   95 IDAVAAALESQVRSDLDELSAigGAILGHMRGQRLADLaLNAIEIV 140
Cdd:PRK15041 410 SAQAAREIKSLIEDSVGKVDV--GSTLVESAGETMAEI-VSAVTRV 452
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH