NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|15964169|ref|NP_384522|]
View 

chemoreceptor methyl-accepting chemotaxis transmembrane protein [Sinorhizobium meliloti 1021]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
502-701 1.36e-60

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


:

Pssm-ID: 206779  Cd Length: 200  Bit Score: 204.01  E-value: 1.36e-60
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 502 EQQAASLEETAAALDELTSQVNASAENAKVAAKSVEVASSDAEQSGEVVQKAIAAMQGIEQSSHEVSRIIGVIDEIAFQT 581
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 582 NLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSANAAKEIKTLINTSAGQVREGVDLVGKAGGALEKIAEQVVQINGL 661
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 15964169 662 IRQISSSASEQAVGLKEINSAVNQMDQVTQQNAAMVEETT 701
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
Cache_1 super family cl03691
Cache domain;
173-242 1.99e-09

Cache domain;


The actual alignment was detected with superfamily member pfam02743:

Pssm-ID: 251508  Cd Length: 80  Bit Score: 55.35  E-value: 1.99e-09
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169   173 ITQPYLAEGTDVPttMTSIAYPVMSNGRMIGVSGVDISLAALADRLSAVKPFGSGRVYLLSQSGKWLAAP 242
Cdd:pfam02743   1 VTEPYVDAATGDL--VITIAQPVYDNGDLLGVIGLDVPLEDLLKITKSIKLGKTGYAFIIDNNGKVLAHP 68
HAMP smart00304
HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;
428-474 3.88e-06

HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;


:

Pssm-ID: 197640  Cd Length: 53  Bit Score: 45.32  E-value: 3.88e-06
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*..
gi 15964169    428 VARLGKALSHLSAGDLAFRLTGDFPGEYAQLKRDFNATMESLEETIR 474
Cdd:smart00304   7 LRRLAEAAQRIADGDLTVRLPVDGRDEIGELARAFNEMADRLEETIA 53
HAMP pfam00672
HAMP domain;
321-391 5.45e-03

HAMP domain;


:

Pssm-ID: 250044  Cd Length: 70  Bit Score: 36.05  E-value: 5.45e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 15964169   321 IVGGLVVLGAVLAGLYFAVRRFVQKPLAGLVGDVETLSNGEYTRPISGQeRSDETGAVARSLEGFRHQLAD 391
Cdd:pfam00672   1 LLLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVPVS-GPDEIGELARAFNQMADRLRE 70
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
369-721 4.09e-79

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


:

Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 262.23  E-value: 4.09e-79
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 369 QERSDETGAVARSLEGFRHQLADNRRLESEARHEREQAELERGRSEnERTEASALQRDIV---ARLGKALSHLSAGDLAF 445
Cdd:COG0840  27 KKLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIV-VLVLAILLLRAILepiSDLLEVVERIAAGDLTK 105
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 446 RLTGDFPGEYAQLKRDFNATMESLEETIRTVNHSVVNIGSGTSEISGAANDLSHRTEQQAASLEETAAALDELTSQVNAS 525
Cdd:COG0840 106 RIDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEV 185
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 526 AENAKVAAKSVEVASSDAEQSGEVVQKAIAAMQGIE-----------QSSHEVSRIIGVIDEIAFQTNLLALNAGVEAAR 594
Cdd:COG0840 186 AFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAeelaevvkklsESSQEIEEITSVINSIAEQTNLLALNAAIEAAR 265
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 595 AGDAGKGFAVVAQEVRELAQRSANAAKEIKTLI--------------NTSAGQVREGVDLVGKAGGALEKIAEQVVQING 660
Cdd:COG0840 266 AGEAGRGFAVVADEVRKLAERSADSAKEIGLLIeeiqneaadavehmEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQ 345
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 15964169 661 LIRQISSSASEQAVGLKEINSAVNQMDQVTQQNAAMVEETTAASMALNDEARALSALVARF 721
Cdd:COG0840 346 LISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKF 406
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
502-701 1.36e-60

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 204.01  E-value: 1.36e-60
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 502 EQQAASLEETAAALDELTSQVNASAENAKVAAKSVEVASSDAEQSGEVVQKAIAAMQGIEQSSHEVSRIIGVIDEIAFQT 581
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 582 NLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSANAAKEIKTLINTSAGQVREGVDLVGKAGGALEKIAEQVVQINGL 661
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 15964169 662 IRQISSSASEQAVGLKEINSAVNQMDQVTQQNAAMVEETT 701
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
Cache_1 pfam02743
Cache domain;
173-242 1.99e-09

Cache domain;


Pssm-ID: 251508  Cd Length: 80  Bit Score: 55.35  E-value: 1.99e-09
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169   173 ITQPYLAEGTDVPttMTSIAYPVMSNGRMIGVSGVDISLAALADRLSAVKPFGSGRVYLLSQSGKWLAAP 242
Cdd:pfam02743   1 VTEPYVDAATGDL--VITIAQPVYDNGDLLGVIGLDVPLEDLLKITKSIKLGKTGYAFIIDNNGKVLAHP 68
HAMP smart00304
HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;
428-474 3.88e-06

HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;


Pssm-ID: 197640  Cd Length: 53  Bit Score: 45.32  E-value: 3.88e-06
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*..
gi 15964169    428 VARLGKALSHLSAGDLAFRLTGDFPGEYAQLKRDFNATMESLEETIR 474
Cdd:smart00304   7 LRRLAEAAQRIADGDLTVRLPVDGRDEIGELARAFNEMADRLEETIA 53
HAMP pfam00672
HAMP domain;
321-391 5.45e-03

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 36.05  E-value: 5.45e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 15964169   321 IVGGLVVLGAVLAGLYFAVRRFVQKPLAGLVGDVETLSNGEYTRPISGQeRSDETGAVARSLEGFRHQLAD 391
Cdd:pfam00672   1 LLLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVPVS-GPDEIGELARAFNQMADRLRE 70
PRK15373 PRK15373
pathogenicity island 1 effector protein SipC; Provisional
482-574 9.38e-03

pathogenicity island 1 effector protein SipC; Provisional


Pssm-ID: 185271  Cd Length: 411  Bit Score: 37.75  E-value: 9.38e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169  482 NIGSGTSEISGAANDLSHRTEQQAASLEETaaalDELTSQVNAsaenaKVAAKSVEVASSDAEQSGEVVQKAIAAMQGIE 561
Cdd:PRK15373 325 MTGDAIMKNSATAGNIAGASGRYAATLERS----EQQISQASS-----RVASTASDEARESSRKSTSLIQELLKTMESIN 395
                         90
                 ....*....|....
gi 15964169  562 QS-SHEVSRIIGVI 574
Cdd:PRK15373 396 QSkASALAAIAGNI 409
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
369-721 4.09e-79

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 262.23  E-value: 4.09e-79
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 369 QERSDETGAVARSLEGFRHQLADNRRLESEARHEREQAELERGRSEnERTEASALQRDIV---ARLGKALSHLSAGDLAF 445
Cdd:COG0840  27 KKLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIV-VLVLAILLLRAILepiSDLLEVVERIAAGDLTK 105
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 446 RLTGDFPGEYAQLKRDFNATMESLEETIRTVNHSVVNIGSGTSEISGAANDLSHRTEQQAASLEETAAALDELTSQVNAS 525
Cdd:COG0840 106 RIDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEV 185
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 526 AENAKVAAKSVEVASSDAEQSGEVVQKAIAAMQGIE-----------QSSHEVSRIIGVIDEIAFQTNLLALNAGVEAAR 594
Cdd:COG0840 186 AFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAeelaevvkklsESSQEIEEITSVINSIAEQTNLLALNAAIEAAR 265
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 595 AGDAGKGFAVVAQEVRELAQRSANAAKEIKTLI--------------NTSAGQVREGVDLVGKAGGALEKIAEQVVQING 660
Cdd:COG0840 266 AGEAGRGFAVVADEVRKLAERSADSAKEIGLLIeeiqneaadavehmEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQ 345
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 15964169 661 LIRQISSSASEQAVGLKEINSAVNQMDQVTQQNAAMVEETTAASMALNDEARALSALVARF 721
Cdd:COG0840 346 LISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKF 406
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
475-721 1.41e-76

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 250.28  E-value: 1.41e-76
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169    475 TVNHSVVNIGSGTSEISGAANDLSHRTEQQAASLEETAAALDELTSQVNASAENAKVAAKSVEVASSDAEQSGEVVQKAI 554
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169    555 AAMQGIEQSSHEVSRIIGVIDEIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSANAAKEIKTLINT----- 629
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEiqeet 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169    630 ---------SAGQVREGVDLVGKAGGALEKIAEQVVQINGLIRQISSSASEQAVGLKEINSAVNQMDQVTQQNAAMVEET 700
Cdd:smart00283 161 neavaameeSSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260
                   ....*....|....*....|.
gi 15964169    701 TAASMALNDEARALSALVARF 721
Cdd:smart00283 241 SAAAEELSGLAEELDELVERF 261
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
423-788 2.69e-75

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 256.09  E-value: 2.69e-75
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169  423 LQRDIVARLGKALSHL---SAGDLAFRLTGDFPGEYAQLKRDFNATMESLEETIRTVNHSVVNIGSGTSEISGAANDLSH 499
Cdd:PRK15048 212 IRRMLLTPLAKIIAHIreiAGGNLANTLTIDGRSEMGDLAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSS 291
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169  500 RTEQQAASLEETAAALDELTSQVNASAENAKVAAKSVEVASSDAEQSGEVVQKAIAAMQGIEQSSHEVSRIIGVIDEIAF 579
Cdd:PRK15048 292 RTEQQASALEETAASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDGVVKTMHEIADSSKKIADIISVIDGIAF 371
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169  580 QTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSANAAKEIKTLINTSAGQVREGVDLVGKAGGALEKIAEQVVQIN 659
Cdd:PRK15048 372 QTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDSVSRVDTGSVLVESAGETMNNIVNAVTRVT 451
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169  660 GLIRQISSSASEQAVGLKEINSAVNQMDQVTQQNAAMVEETTAASMALNDEARALSALVARFqiapqaaqaqasaemlRG 739
Cdd:PRK15048 452 DIMGEIASASDEQSRGIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQASRLTQAVSAF----------------RL 515
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*....
gi 15964169  740 TAERMRAAAPAENRPAQAPRSaaysnstqrvlAKTSGANALAQDNWEEF 788
Cdd:PRK15048 516 AASPLTNKPQTPSRPASEQPP-----------AQPRLRIAEQDPNWETF 553
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
529-721 3.63e-57

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 194.97  E-value: 3.63e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169   529 AKVAAKSVEVASSDAEQSGEVVQKAIAAMQGIEQSSHEVSRIIGVIDEIAFQTNLLALNAGVEAARAGDAGKGFAVVAQE 608
Cdd:pfam00015   4 SDLAQLASEEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADE 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169   609 VRELAQRSANAAKEIKTLI-------NTSAG-------QVREGVDLVGKAGGALEKIAEQVVQINGLIRQISSSASEQAV 674
Cdd:pfam00015  84 VRKLAERSAQAAKEIEALIeeivkqtNDSTAsiqqtrtEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQSA 163
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*..
gi 15964169   675 GLKEINSAVNQMDQVTQQNAAMVEETTAASMALNDEARALSALVARF 721
Cdd:pfam00015 164 GIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQF 210
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
387-631 1.47e-05

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 47.36  E-value: 1.47e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169    387 HQLADNRRLESEARHEREQAELERGRSENERTEASALQRDIVARLGKALSHLSAGDLAFRltgDFPGEYAQLKRDFNA-- 464
Cdd:TIGR02168  747 ERIAQLSKELTELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALD---ELRAELTLLNEEAANlr 823
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169    465 -TMESLEETIRTVNHSVVNIGSGTSEISGAANDLSHRTEQQAASLEETAAALDELTSQVNASAENAKVAAKSVEVASSDA 543
Cdd:TIGR02168  824 eRLESLERRIAATERRLEDLEEQIEELSEDIESLAAEIEELEELIEELESELEALLNERASLEEALALLRSELEELSEEL 903
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169    544 EQSGEVVQKAIAAMQGIEQSSHEVSRIIGVIdEIAFQTNLLALNAGVEAArAGDAGKGFAVVAQEVRELAQRSANAAKEI 623
Cdd:TIGR02168  904 RELESKRSELRRELEELREKLAQLELRLEGL-EVRIDNLQERLSEEYSLT-LEEAEALENKIEDDEEEARRRLKRLENKI 981
                          250
                   ....*....|
gi 15964169    624 KTL--INTSA 631
Cdd:TIGR02168  982 KELgpVNLAA 991
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
502-701 1.36e-60

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 204.01  E-value: 1.36e-60
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 502 EQQAASLEETAAALDELTSQVNASAENAKVAAKSVEVASSDAEQSGEVVQKAIAAMQGIEQSSHEVSRIIGVIDEIAFQT 581
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 582 NLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSANAAKEIKTLINTSAGQVREGVDLVGKAGGALEKIAEQVVQINGL 661
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 15964169 662 IRQISSSASEQAVGLKEINSAVNQMDQVTQQNAAMVEETT 701
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
Cache_1 pfam02743
Cache domain;
173-242 1.99e-09

Cache domain;


Pssm-ID: 251508  Cd Length: 80  Bit Score: 55.35  E-value: 1.99e-09
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169   173 ITQPYLAEGTDVPttMTSIAYPVMSNGRMIGVSGVDISLAALADRLSAVKPFGSGRVYLLSQSGKWLAAP 242
Cdd:pfam02743   1 VTEPYVDAATGDL--VITIAQPVYDNGDLLGVIGLDVPLEDLLKITKSIKLGKTGYAFIIDNNGKVLAHP 68
HAMP smart00304
HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;
428-474 3.88e-06

HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;


Pssm-ID: 197640  Cd Length: 53  Bit Score: 45.32  E-value: 3.88e-06
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*..
gi 15964169    428 VARLGKALSHLSAGDLAFRLTGDFPGEYAQLKRDFNATMESLEETIR 474
Cdd:smart00304   7 LRRLAEAAQRIADGDLTVRLPVDGRDEIGELARAFNEMADRLEETIA 53
HAMP pfam00672
HAMP domain;
321-391 5.45e-03

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 36.05  E-value: 5.45e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 15964169   321 IVGGLVVLGAVLAGLYFAVRRFVQKPLAGLVGDVETLSNGEYTRPISGQeRSDETGAVARSLEGFRHQLAD 391
Cdd:pfam00672   1 LLLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVPVS-GPDEIGELARAFNQMADRLRE 70
PRK15373 PRK15373
pathogenicity island 1 effector protein SipC; Provisional
482-574 9.38e-03

pathogenicity island 1 effector protein SipC; Provisional


Pssm-ID: 185271  Cd Length: 411  Bit Score: 37.75  E-value: 9.38e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169  482 NIGSGTSEISGAANDLSHRTEQQAASLEETaaalDELTSQVNAsaenaKVAAKSVEVASSDAEQSGEVVQKAIAAMQGIE 561
Cdd:PRK15373 325 MTGDAIMKNSATAGNIAGASGRYAATLERS----EQQISQASS-----RVASTASDEARESSRKSTSLIQELLKTMESIN 395
                         90
                 ....*....|....
gi 15964169  562 QS-SHEVSRIIGVI 574
Cdd:PRK15373 396 QSkASALAAIAGNI 409
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
369-721 4.09e-79

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 262.23  E-value: 4.09e-79
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 369 QERSDETGAVARSLEGFRHQLADNRRLESEARHEREQAELERGRSEnERTEASALQRDIV---ARLGKALSHLSAGDLAF 445
Cdd:COG0840  27 KKLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIV-VLVLAILLLRAILepiSDLLEVVERIAAGDLTK 105
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 446 RLTGDFPGEYAQLKRDFNATMESLEETIRTVNHSVVNIGSGTSEISGAANDLSHRTEQQAASLEETAAALDELTSQVNAS 525
Cdd:COG0840 106 RIDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEV 185
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 526 AENAKVAAKSVEVASSDAEQSGEVVQKAIAAMQGIE-----------QSSHEVSRIIGVIDEIAFQTNLLALNAGVEAAR 594
Cdd:COG0840 186 AFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAeelaevvkklsESSQEIEEITSVINSIAEQTNLLALNAAIEAAR 265
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 595 AGDAGKGFAVVAQEVRELAQRSANAAKEIKTLI--------------NTSAGQVREGVDLVGKAGGALEKIAEQVVQING 660
Cdd:COG0840 266 AGEAGRGFAVVADEVRKLAERSADSAKEIGLLIeeiqneaadavehmEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQ 345
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 15964169 661 LIRQISSSASEQAVGLKEINSAVNQMDQVTQQNAAMVEETTAASMALNDEARALSALVARF 721
Cdd:COG0840 346 LISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKF 406
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
475-721 1.41e-76

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 250.28  E-value: 1.41e-76
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169    475 TVNHSVVNIGSGTSEISGAANDLSHRTEQQAASLEETAAALDELTSQVNASAENAKVAAKSVEVASSDAEQSGEVVQKAI 554
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169    555 AAMQGIEQSSHEVSRIIGVIDEIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSANAAKEIKTLINT----- 629
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEiqeet 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169    630 ---------SAGQVREGVDLVGKAGGALEKIAEQVVQINGLIRQISSSASEQAVGLKEINSAVNQMDQVTQQNAAMVEET 700
Cdd:smart00283 161 neavaameeSSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260
                   ....*....|....*....|.
gi 15964169    701 TAASMALNDEARALSALVARF 721
Cdd:smart00283 241 SAAAEELSGLAEELDELVERF 261
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
423-788 2.69e-75

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 256.09  E-value: 2.69e-75
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169  423 LQRDIVARLGKALSHL---SAGDLAFRLTGDFPGEYAQLKRDFNATMESLEETIRTVNHSVVNIGSGTSEISGAANDLSH 499
Cdd:PRK15048 212 IRRMLLTPLAKIIAHIreiAGGNLANTLTIDGRSEMGDLAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSS 291
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169  500 RTEQQAASLEETAAALDELTSQVNASAENAKVAAKSVEVASSDAEQSGEVVQKAIAAMQGIEQSSHEVSRIIGVIDEIAF 579
Cdd:PRK15048 292 RTEQQASALEETAASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDGVVKTMHEIADSSKKIADIISVIDGIAF 371
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169  580 QTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSANAAKEIKTLINTSAGQVREGVDLVGKAGGALEKIAEQVVQIN 659
Cdd:PRK15048 372 QTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDSVSRVDTGSVLVESAGETMNNIVNAVTRVT 451
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169  660 GLIRQISSSASEQAVGLKEINSAVNQMDQVTQQNAAMVEETTAASMALNDEARALSALVARFqiapqaaqaqasaemlRG 739
Cdd:PRK15048 452 DIMGEIASASDEQSRGIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQASRLTQAVSAF----------------RL 515
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*....
gi 15964169  740 TAERMRAAAPAENRPAQAPRSaaysnstqrvlAKTSGANALAQDNWEEF 788
Cdd:PRK15048 516 AASPLTNKPQTPSRPASEQPP-----------AQPRLRIAEQDPNWETF 553
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
430-788 5.84e-75

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 255.26  E-value: 5.84e-75
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169  430 RLGKALSHLSAGDLAFRLTGDFPGEYAQLKRDFNATMESLEETIRTVNHSVVNIGSGTSEISGAANDLSHRTEQQAASLE 509
Cdd:PRK15041 224 RLIDSIRHIAGGDLVKPIEVDGSNEMGQLAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLE 303
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169  510 ETAAALDELTSQVNASAENAKVAAKSVEVASSDAEQSGEVVQKAIAAMQGIEQSSHEVSRIIGVIDEIAFQTNLLALNAG 589
Cdd:PRK15041 304 ETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAA 383
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169  590 VEAARAGDAGKGFAVVAQEVRELAQRSANAAKEIKTLINTSAGQVREGVDLVGKAGGALEKIAEQVVQINGLIRQISSSA 669
Cdd:PRK15041 384 VEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASAS 463
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169  670 SEQAVGLKEINSAVNQMDQVTQQNAAMVEETTAASMALNDEARALSALVARFQiapqaaqaqasaemLRGTAERMRAAAP 749
Cdd:PRK15041 464 DEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFR--------------IQQQQQQQRETSA 529
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|
gi 15964169  750 AENRPAQA-PRSAAYSNSTqrvlaktsganalaqDNWEEF 788
Cdd:PRK15041 530 VVKTVTPAtPRKMAVADSG---------------ENWETF 554
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
428-721 1.68e-70

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 242.28  E-value: 1.68e-70
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169  428 VARLGKALSHLSAGDLAFRLTGDFPGEYAQLKRDFNATMESLEETIRTVNHSVVNIGSGTSEISGAANDLSHRTEQQAAS 507
Cdd:PRK09793 218 LAIIGSHFDSIAAGNLARPIAVYGRNEITAIFASLKTMQQALRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAAS 297
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169  508 LEETAAALDELTSQVNASAENAKVAAKSVEVASSDAEQSGEVVQKAIAAMQGIEQSSHEVSRIIGVIDEIAFQTNLLALN 587
Cdd:PRK09793 298 LAQTAASMEQLTATVGQNADNARQASELAKNAATTAQAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALN 377
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169  588 AGVEAARAGDAGKGFAVVAQEVRELAQRSANAAKEIKTLINTSAGQVREGVDLVGKAGGALEKIAEQVVQINGLIRQISS 667
Cdd:PRK09793 378 AAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKGLIEESVNRVQQGSKLVNNAAATMTDIVSSVTRVNDIMGEIAS 457
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....
gi 15964169  668 SASEQAVGLKEINSAVNQMDQVTQQNAAMVEETTAASMALNDEARALSALVARF 721
Cdd:PRK09793 458 ASEEQRRGIEQVAQAVSQMDQVTQQNASLVEEAAVATEQLANQADHLSSRVAVF 511
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
529-721 3.63e-57

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 194.97  E-value: 3.63e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169   529 AKVAAKSVEVASSDAEQSGEVVQKAIAAMQGIEQSSHEVSRIIGVIDEIAFQTNLLALNAGVEAARAGDAGKGFAVVAQE 608
Cdd:pfam00015   4 SDLAQLASEEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADE 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169   609 VRELAQRSANAAKEIKTLI-------NTSAG-------QVREGVDLVGKAGGALEKIAEQVVQINGLIRQISSSASEQAV 674
Cdd:pfam00015  84 VRKLAERSAQAAKEIEALIeeivkqtNDSTAsiqqtrtEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQSA 163
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*..
gi 15964169   675 GLKEINSAVNQMDQVTQQNAAMVEETTAASMALNDEARALSALVARF 721
Cdd:pfam00015 164 GIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQF 210
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
387-631 1.47e-05

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 47.36  E-value: 1.47e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169    387 HQLADNRRLESEARHEREQAELERGRSENERTEASALQRDIVARLGKALSHLSAGDLAFRltgDFPGEYAQLKRDFNA-- 464
Cdd:TIGR02168  747 ERIAQLSKELTELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALD---ELRAELTLLNEEAANlr 823
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169    465 -TMESLEETIRTVNHSVVNIGSGTSEISGAANDLSHRTEQQAASLEETAAALDELTSQVNASAENAKVAAKSVEVASSDA 543
Cdd:TIGR02168  824 eRLESLERRIAATERRLEDLEEQIEELSEDIESLAAEIEELEELIEELESELEALLNERASLEEALALLRSELEELSEEL 903
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169    544 EQSGEVVQKAIAAMQGIEQSSHEVSRIIGVIdEIAFQTNLLALNAGVEAArAGDAGKGFAVVAQEVRELAQRSANAAKEI 623
Cdd:TIGR02168  904 RELESKRSELRRELEELREKLAQLELRLEGL-EVRIDNLQERLSEEYSLT-LEEAEALENKIEDDEEEARRRLKRLENKI 981
                          250
                   ....*....|
gi 15964169    624 KTL--INTSA 631
Cdd:TIGR02168  982 KELgpVNLAA 991
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
489-717 8.17e-05

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 45.05  E-value: 8.17e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169    489 EISGAANDLSHRTEQQAASLEETAAALDELTSQVNASAENAKVAAKSVEVASSDAEQSGEVVQKAIAAMQGIEQSSHEVS 568
Cdd:TIGR02168  695 ELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEIEELEERLEEAE 774
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169    569 -RIIGVIDEIAfqtnllALNAGVEAA--RAGDAGKGFAVVAQEVRELAQRSANAAKEIKTLINTSAGQVREGVDLVGKag 645
Cdd:TIGR02168  775 eELAEAEAEIE------ELEAQIEQLkeELKALREALDELRAELTLLNEEAANLRERLESLERRIAATERRLEDLEEQ-- 846
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 15964169    646 gaLEKIAEQVVQINGLIRQISSSASEQAvglKEINSAVNQMDQVTQQNAAMVEETTAASMALNDEARALSAL 717
Cdd:TIGR02168  847 --IEELSEDIESLAAEIEELEELIEELE---SELEALLNERASLEEALALLRSELEELSEELRELESKRSEL 913
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
380-562 1.02e-04

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 44.71  E-value: 1.02e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169  380 RSLEGFRHQLADNRRLESEARHEREQAELERGRSENERTEASALQRDIVARLGKALSHLSAG-DLAFRLTGDFpGEYAQL 458
Cdd:COG1196  709 RQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLeEALAKLKEEI-EELEEK 787
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169  459 KRDFNATMESLEETIRTVNHSVvnigsgtSEISGAANDLSHRTEQQAASLEETAAALDELTSQVNASAENAKVAAKSVEV 538
Cdd:COG1196  788 RQALQEELEELEEELEEAERRL-------DALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEE 860
                        170       180
                 ....*....|....*....|....
gi 15964169  539 ASSDAEQSGEVVQKAIAAMQGIEQ 562
Cdd:COG1196  861 LKEELEELEAEKEELEDELKELEE 884
COG1511 COG1511
Predicted membrane protein [Function unknown]
518-716 1.14e-04

Predicted membrane protein [Function unknown]


Pssm-ID: 224428 [Multi-domain]  Cd Length: 780  Bit Score: 44.42  E-value: 1.14e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 518 LTSQVNASAENAKVAAKSVEVASSDAeqsGEVVQKAIAAMQgiEQSShevSRIIGVIDEIAFQTNLLALNAGVEAARAGd 597
Cdd:COG1511 116 ALSLTNKTPKKATIDYKVNEKLNAVA---PKITEKAADKLL--NEIS---KELTETYTKVVAFPTIYDLGGGVKGAADG- 186
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169 598 agkgfavvAQEVRELAQRSANAAKEIKTLINTSAGQVREGVDLVGKAGGALEKIAEQVVQINGLIRQISSSASEQAVGLK 677
Cdd:COG1511 187 --------AEKLKDGTDEASNGNKKLSDLLNTLNNSSATFSDGLNALTSGLTTLTDGLNQLDSGLGTLAAGIGELKQGAE 258
                       170       180       190
                ....*....|....*....|....*....|....*....
gi 15964169 678 EINSAVNQMDQVTQQNAAMVEETTAASMALNDEARALSA 716
Cdd:COG1511 259 QLNEGIGEFSSGLSELNSGVQDLAAGVPQLNQGISALAA 297
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
393-756 6.87e-03

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233758 [Multi-domain]  Cd Length: 1164  Bit Score: 38.51  E-value: 6.87e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169    393 RRLESEARHEREQAELERGRSENERTEASALQRDIVARLGKALSHLSAGDLAFRLTGDFPGEYAQLKRDFNATMESLEET 472
Cdd:TIGR02169  663 RGGILFSRSEPAELQRLRERLEGLKRELSSLQSELRRIENRLDELSQELSDASRKIGEIEKEIEQLEQEEEKLKERLEEL 742
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169    473 IRtvnhsvvnigsgtsEISgaanDLSHRTEQQAASLEETAAALDELTSQVNASAEnakvaaksvEVASSDAEQSGEVVQK 552
Cdd:TIGR02169  743 EE--------------DLS----SLEQEIENVKSELKELEARIEELEEDLHKLEE---------ALNDLEARLSHSRIPE 795
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169    553 AIAAMQGIEQsshEVSRIIGVIDEIAFQTNLLALnagvEAARAGDAGKGfavVAQEVRELAQRSANAAKEIKTLIntsaG 632
Cdd:TIGR02169  796 IQAELSKLEE---EVSRIEARLREIEQKLNRLTL----EKEYLEKEIQE---LQEQRIDLKEQIKSIEKEIENLN----G 861
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15964169    633 QVREGVDLVGKAGGALEKIAEQVVQINGLIRQISSSASEQAVGLKEINSAVNQMDQvtqqnaaMVEETTAASMALNDEAR 712
Cdd:TIGR02169  862 KKEELEEELEELEAALRDLESRLGDLKKERDELEAQLRELERKIEELEAQIEKKRK-------RLSELKAKLEALEEELS 934
                          330       340       350       360
                   ....*....|....*....|....*....|....*....|....*
gi 15964169    713 ALSALVARFQIAPQAAQAQAS-AEMLRGTAERMRAAAPAENRPAQ 756
Cdd:TIGR02169  935 EIEDPKGEDEEIPEEELSLEDvQAELQRVEEEIRALEPVNMLAIQ 979
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH