NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|159487219|ref|XP_001701631|]
View 

TPR protein [Chlamydomonas reinhardtii]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TPR cd00189
Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2) ...
13-116 1.62e-11

Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here


:

Pssm-ID: 238112 [Multi-domain]  Cd Length: 100  Bit Score: 57.39  E-value: 1.62e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159487219  13 EEFKREGNELFGSGQWEAASVKYNQALDEAPSSAakqraIYFANLAACNIKTQQYAAAVQSCTEAIALDGGYEKAYMRRS 92
Cdd:cd00189    1 EALLNLGNLYYKLGDYDEALEYYEKALELDPDNA-----DAYYNLAAAYYKLGKYEEALEDYEKALELDPDNAKAYYNLG 75
                         90       100
                 ....*....|....*....|....
gi 159487219  93 EAFEKLDELDHALADAKKLLELAP 116
Cdd:cd00189   76 LAYYKLGKYEEALEAYEKALELDP 99
TPR_11 pfam13414
TPR repeat;
11-81 2.72e-06

TPR repeat;


:

Pssm-ID: 257739 [Multi-domain]  Cd Length: 69  Bit Score: 42.30  E-value: 2.72e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 159487219   11 QAEEFKREGNELFGSGQWEAASVKYNQALDEAPSSAAkqraiYFANLAACNIKT-QQYAAAVQSCTEAIALD 81
Cdd:pfam13414   2 NAEALKNLGNALFKLGDYDEAIEAYEKALELDPDNAE-----AYLNLALAYLKLgKDYEEALEDLEKALELD 68
TPR_11 pfam13414
TPR repeat;
49-116 1.25e-05

TPR repeat;


:

Pssm-ID: 257739 [Multi-domain]  Cd Length: 69  Bit Score: 40.37  E-value: 1.25e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 159487219   49 QRAIYFANLAACNIKTQQYAAAVQSCTEAIALDGGYEKAYMRRSEAFEKL-DELDHALADAKKLLELAP 116
Cdd:pfam13414   1 ENAEALKNLGNALFKLGDYDEAIEAYEKALELDPDNAEAYLNLALAYLKLgKDYEEALEDLEKALELDP 69
 
Name Accession Description Interval E-value
TPR cd00189
Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2) ...
13-116 1.62e-11

Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here


Pssm-ID: 238112 [Multi-domain]  Cd Length: 100  Bit Score: 57.39  E-value: 1.62e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159487219  13 EEFKREGNELFGSGQWEAASVKYNQALDEAPSSAakqraIYFANLAACNIKTQQYAAAVQSCTEAIALDGGYEKAYMRRS 92
Cdd:cd00189    1 EALLNLGNLYYKLGDYDEALEYYEKALELDPDNA-----DAYYNLAAAYYKLGKYEEALEDYEKALELDPDNAKAYYNLG 75
                         90       100
                 ....*....|....*....|....
gi 159487219  93 EAFEKLDELDHALADAKKLLELAP 116
Cdd:cd00189   76 LAYYKLGKYEEALEAYEKALELDP 99
TPR_11 pfam13414
TPR repeat;
11-81 2.72e-06

TPR repeat;


Pssm-ID: 257739 [Multi-domain]  Cd Length: 69  Bit Score: 42.30  E-value: 2.72e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 159487219   11 QAEEFKREGNELFGSGQWEAASVKYNQALDEAPSSAAkqraiYFANLAACNIKT-QQYAAAVQSCTEAIALD 81
Cdd:pfam13414   2 NAEALKNLGNALFKLGDYDEAIEAYEKALELDPDNAE-----AYLNLALAYLKLgKDYEEALEDLEKALELD 68
TPR_11 pfam13414
TPR repeat;
49-116 1.25e-05

TPR repeat;


Pssm-ID: 257739 [Multi-domain]  Cd Length: 69  Bit Score: 40.37  E-value: 1.25e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 159487219   49 QRAIYFANLAACNIKTQQYAAAVQSCTEAIALDGGYEKAYMRRSEAFEKL-DELDHALADAKKLLELAP 116
Cdd:pfam13414   1 ENAEALKNLGNALFKLGDYDEAIEAYEKALELDPDNAEAYLNLALAYLKLgKDYEEALEDLEKALELDP 69
PLN03088 PLN03088
SGT1, suppressor of G2 allele of SKP1; Provisional
12-143 2.84e-10

SGT1, suppressor of G2 allele of SKP1; Provisional


Pssm-ID: 215568 [Multi-domain]  Cd Length: 356  Bit Score: 56.72  E-value: 2.84e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159487219  12 AEEFKREGNELFGSGQWEAASVKYNQALDEAPSSAAkqraiYFANLAACNIKTQQYAAAVQSCTEAIALDGGYEKAYMRR 91
Cdd:PLN03088   2 AKDLEDKAKEAFVDDDFALAVDLYTQAIDLDPNNAE-----LYADRAQANIKLGNFTEAVADANKAIELDPSLAKAYLRK 76
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 159487219  92 SEAFEKLDELDhalaDAKKLLELAPANAWAKAKVAALqpvVDERTEKLKTEM 143
Cdd:PLN03088  77 GTACMKLEEYQ----TAKAALEKGASLAPGDSRFTKL---IKECDEKIAEEE 121
3a0801s09 TIGR00990
mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) ...
8-107 4.90e-10

mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70); [Transport and binding proteins, Amino acids, peptides and amines].


Pssm-ID: 233223 [Multi-domain]  Cd Length: 615  Bit Score: 56.54  E-value: 4.90e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159487219    8 RLAQAEEFKREGNELFGSGQWEAASVKYNQALDeapssaAKQRAIYFANLAACNIKTQQYAAAVQSCTEAIALDGGYEKA 87
Cdd:TIGR00990 123 RKKYAAKLKEKGNKAYRNKDFNKAIKLYSKAIE------CKPDPVYYSNRAACHNALGDWEKVVEDTTAALELDPDYSKA 196
                          90       100
                  ....*....|....*....|
gi 159487219   88 YMRRSEAFEKLDELDHALAD 107
Cdd:TIGR00990 197 LNRRANAYDGLGKYADALLD 216
 
Name Accession Description Interval E-value
TPR cd00189
Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2) ...
13-116 1.62e-11

Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here


Pssm-ID: 238112 [Multi-domain]  Cd Length: 100  Bit Score: 57.39  E-value: 1.62e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159487219  13 EEFKREGNELFGSGQWEAASVKYNQALDEAPSSAakqraIYFANLAACNIKTQQYAAAVQSCTEAIALDGGYEKAYMRRS 92
Cdd:cd00189    1 EALLNLGNLYYKLGDYDEALEYYEKALELDPDNA-----DAYYNLAAAYYKLGKYEEALEDYEKALELDPDNAKAYYNLG 75
                         90       100
                 ....*....|....*....|....
gi 159487219  93 EAFEKLDELDHALADAKKLLELAP 116
Cdd:cd00189   76 LAYYKLGKYEEALEAYEKALELDP 99
TPR cd00189
Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2) ...
56-121 1.14e-06

Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here


Pssm-ID: 238112 [Multi-domain]  Cd Length: 100  Bit Score: 43.91  E-value: 1.14e-06
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 159487219  56 NLAACNIKTQQYAAAVQSCTEAIALDGGYEKAYMRRSEAFEKLDELDHALADAKKLLELAPANAWA 121
Cdd:cd00189    5 NLGNLYYKLGDYDEALEYYEKALELDPDNADAYYNLAAAYYKLGKYEEALEDYEKALELDPDNAKA 70
TPR_11 pfam13414
TPR repeat;
11-81 2.72e-06

TPR repeat;


Pssm-ID: 257739 [Multi-domain]  Cd Length: 69  Bit Score: 42.30  E-value: 2.72e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 159487219   11 QAEEFKREGNELFGSGQWEAASVKYNQALDEAPSSAAkqraiYFANLAACNIKT-QQYAAAVQSCTEAIALD 81
Cdd:pfam13414   2 NAEALKNLGNALFKLGDYDEAIEAYEKALELDPDNAE-----AYLNLALAYLKLgKDYEEALEDLEKALELD 68
TPR_11 pfam13414
TPR repeat;
49-116 1.25e-05

TPR repeat;


Pssm-ID: 257739 [Multi-domain]  Cd Length: 69  Bit Score: 40.37  E-value: 1.25e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 159487219   49 QRAIYFANLAACNIKTQQYAAAVQSCTEAIALDGGYEKAYMRRSEAFEKL-DELDHALADAKKLLELAP 116
Cdd:pfam13414   1 ENAEALKNLGNALFKLGDYDEAIEAYEKALELDPDNAEAYLNLALAYLKLgKDYEEALEDLEKALELDP 69
PLN03088 PLN03088
SGT1, suppressor of G2 allele of SKP1; Provisional
12-143 2.84e-10

SGT1, suppressor of G2 allele of SKP1; Provisional


Pssm-ID: 215568 [Multi-domain]  Cd Length: 356  Bit Score: 56.72  E-value: 2.84e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159487219  12 AEEFKREGNELFGSGQWEAASVKYNQALDEAPSSAAkqraiYFANLAACNIKTQQYAAAVQSCTEAIALDGGYEKAYMRR 91
Cdd:PLN03088   2 AKDLEDKAKEAFVDDDFALAVDLYTQAIDLDPNNAE-----LYADRAQANIKLGNFTEAVADANKAIELDPSLAKAYLRK 76
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 159487219  92 SEAFEKLDELDhalaDAKKLLELAPANAWAKAKVAALqpvVDERTEKLKTEM 143
Cdd:PLN03088  77 GTACMKLEEYQ----TAKAALEKGASLAPGDSRFTKL---IKECDEKIAEEE 121
3a0801s09 TIGR00990
mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) ...
8-107 4.90e-10

mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70); [Transport and binding proteins, Amino acids, peptides and amines].


Pssm-ID: 233223 [Multi-domain]  Cd Length: 615  Bit Score: 56.54  E-value: 4.90e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159487219    8 RLAQAEEFKREGNELFGSGQWEAASVKYNQALDeapssaAKQRAIYFANLAACNIKTQQYAAAVQSCTEAIALDGGYEKA 87
Cdd:TIGR00990 123 RKKYAAKLKEKGNKAYRNKDFNKAIKLYSKAIE------CKPDPVYYSNRAACHNALGDWEKVVEDTTAALELDPDYSKA 196
                          90       100
                  ....*....|....*....|
gi 159487219   88 YMRRSEAFEKLDELDHALAD 107
Cdd:TIGR00990 197 LNRRANAYDGLGKYADALLD 216
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH