NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|159479982|ref|XP_001698065|]
View 

receptor of activated protein kinase C 1 [Chlamydomonas reinhardtii]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
7-313 1.28e-90

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


:

Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 274.60  E-value: 1.28e-90
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982   7 LRATLKGHTNWVTAIAtpLDPSSNTLLSASRDKSVLVWELERSEsnygyARKALRGHSHFVQDVVISSDGQFCLTGSWDG 86
Cdd:cd00200    1 LRRTLKGHTGGVTCVA--FSPDGKLLATGSGDGTIKVWDLETGE-----LLRTLKGHTGPVRDVAASADGTYLASGSSDK 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982  87 TLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKLWNTL-GECKYTIgepEGHTEWVSCVRFSPmtTNP 165
Cdd:cd00200   74 TIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVEtGKCLTTL---RGHTDWVNSVAFSP--DGT 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 166 IIVSGGWDKMVKVWNLTNCKLKNNLVGHHGYVNTVTVSPDGSLCASGGKDGIAMLWDLAEGKRLYSLDA-GDVIHCLCFS 244
Cdd:cd00200  149 FVASSSQDGTIKLWDLRTGKCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLRGhENGVNSVAFS 228
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 245 PNRYWLCAATQ-SSIKIWDLESKSIVDDLRPEFNItskkaqvpyCVSLAWSADGSTLYSGYTDGQIRVWA 313
Cdd:cd00200  229 PDGYLLASGSEdGTIRVWDLRTGECVQTLSGHTNS---------VTSLAWSPDGKRLASGSADGTIRIWD 289
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
9-312 9.72e-39

FOG: WD40 repeat [General function prediction only]


:

Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 142.92  E-value: 9.72e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982   9 ATLKGHTNWVTAIATPLDPSSNTLLSA--SRDKSVLVWELERSESNYgyarKALRGHSHFVQDVVISSDGQFCLTGS-WD 85
Cdd:COG2319  102 KSLEGLHDSSVSKLALSSPDGNSILLAssSLDGTVKLWDLSTPGKLI----RTLEGHSESVTSLAFSPDGKLLASGSsLD 177
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982  86 GTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNR-QIVSGSRDKTIKLWNTL-GECKYTIGepEGHTEWVSCVrFSPmtT 163
Cdd:COG2319  178 GTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGGlLIASGSSDGTIRLWDLStGKLLRSTL--SGHSDSVVSS-FSP--D 252
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 164 NPIIVSGGWDKMVKVWNL-TNCKLKNNLVGHHGYVNTVTVSPDGSLCASGGKDGIAMLWDLAEGKRLYSLDA---GDVIH 239
Cdd:COG2319  253 GSLLASGSSDGTIRLWDLrSSSSLLRTLSGHSSSVLSVAFSPDGKLLASGSSDGTVRLWDLETGKLLSSLTLkghEGPVS 332
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 159479982 240 CLCFSPNRYWLCAATQS--SIKIWDLESKSIVDDLRPEFNITskkaqvpycvSLAWSADGSTLYSGYTDGQIRVW 312
Cdd:COG2319  333 SLSFSPDGSLLVSGGSDdgTIRLWDLRTGKPLKTLEGHSNVL----------SVSFSPDGRVVSSGSTDGTVRLW 397
 
Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
7-313 1.28e-90

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 274.60  E-value: 1.28e-90
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982   7 LRATLKGHTNWVTAIAtpLDPSSNTLLSASRDKSVLVWELERSEsnygyARKALRGHSHFVQDVVISSDGQFCLTGSWDG 86
Cdd:cd00200    1 LRRTLKGHTGGVTCVA--FSPDGKLLATGSGDGTIKVWDLETGE-----LLRTLKGHTGPVRDVAASADGTYLASGSSDK 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982  87 TLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKLWNTL-GECKYTIgepEGHTEWVSCVRFSPmtTNP 165
Cdd:cd00200   74 TIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVEtGKCLTTL---RGHTDWVNSVAFSP--DGT 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 166 IIVSGGWDKMVKVWNLTNCKLKNNLVGHHGYVNTVTVSPDGSLCASGGKDGIAMLWDLAEGKRLYSLDA-GDVIHCLCFS 244
Cdd:cd00200  149 FVASSSQDGTIKLWDLRTGKCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLRGhENGVNSVAFS 228
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 245 PNRYWLCAATQ-SSIKIWDLESKSIVDDLRPEFNItskkaqvpyCVSLAWSADGSTLYSGYTDGQIRVWA 313
Cdd:cd00200  229 PDGYLLASGSEdGTIRVWDLRTGECVQTLSGHTNS---------VTSLAWSPDGKRLASGSADGTIRIWD 289
WD40 pfam00400
WD domain, G-beta repeat;
96-134 4.06e-08

WD domain, G-beta repeat;


Pssm-ID: 249832  Cd Length: 39  Bit Score: 48.89  E-value: 4.06e-08
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 159479982   96 GTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKLWN 134
Cdd:pfam00400   1 GKLLRTLKGHTGPVTSVAFSPDGNLLASGSDDGTVRVWD 39
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
95-134 1.51e-07

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651  Cd Length: 40  Bit Score: 47.31  E-value: 1.51e-07
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 159479982    95 TGTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKLWN 134
Cdd:smart00320   1 SGELLKTLKGHTGPVTSVAFSPDGKYLASGSDDGTIKLWD 40
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
9-312 9.72e-39

FOG: WD40 repeat [General function prediction only]


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 142.92  E-value: 9.72e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982   9 ATLKGHTNWVTAIATPLDPSSNTLLSA--SRDKSVLVWELERSESNYgyarKALRGHSHFVQDVVISSDGQFCLTGS-WD 85
Cdd:COG2319  102 KSLEGLHDSSVSKLALSSPDGNSILLAssSLDGTVKLWDLSTPGKLI----RTLEGHSESVTSLAFSPDGKLLASGSsLD 177
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982  86 GTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNR-QIVSGSRDKTIKLWNTL-GECKYTIGepEGHTEWVSCVrFSPmtT 163
Cdd:COG2319  178 GTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGGlLIASGSSDGTIRLWDLStGKLLRSTL--SGHSDSVVSS-FSP--D 252
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 164 NPIIVSGGWDKMVKVWNL-TNCKLKNNLVGHHGYVNTVTVSPDGSLCASGGKDGIAMLWDLAEGKRLYSLDA---GDVIH 239
Cdd:COG2319  253 GSLLASGSSDGTIRLWDLrSSSSLLRTLSGHSSSVLSVAFSPDGKLLASGSSDGTVRLWDLETGKLLSSLTLkghEGPVS 332
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 159479982 240 CLCFSPNRYWLCAATQS--SIKIWDLESKSIVDDLRPEFNITskkaqvpycvSLAWSADGSTLYSGYTDGQIRVW 312
Cdd:COG2319  333 SLSFSPDGSLLVSGGSDdgTIRLWDLRTGKPLKTLEGHSNVL----------SVSFSPDGRVVSSGSTDGTVRLW 397
PTZ00421 PTZ00421
coronin; Provisional
103-272 1.31e-08

coronin; Provisional


Pssm-ID: 173611 [Multi-domain]  Cd Length: 493  Bit Score: 54.51  E-value: 1.31e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 103 VGHTKDVLSVAFS-VDNRQIVSGSRDKTIKLWNTLGE-----CKYTIGEPEGHTEWVSCVRFSPMTTNpIIVSGGWDKMV 176
Cdd:PTZ00421  72 LGQEGPIIDVAFNpFDPQKLFTASEDGTIMGWGIPEEgltqnISDPIVHLQGHTKKVGIVSFHPSAMN-VLASAGADMVV 150
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 177 KVWNLTNCKLKNNLVGHHGYVNTVTVSPDGSLCASGGKDGIAMLWDLAEGKRLYSLDA--------------GDVIHCLC 242
Cdd:PTZ00421 151 NVWDVERGKAVEVIKCHSDQITSLEWNLDGSLLCTTSKDKKLNIIDPRDGTIVSSVEAhasaksqrclwakrKDLIITLG 230
                        170       180       190
                 ....*....|....*....|....*....|...
gi 159479982 243 FSpnrywlcAATQSSIKIWD---LESKSIVDDL 272
Cdd:PTZ00421 231 CS-------KSQQRQIMLWDtrkMASPYSTVDL 256
PLN00181 PLN00181
protein SPA1-RELATED; Provisional
34-214 2.19e-08

protein SPA1-RELATED; Provisional


Pssm-ID: 177776 [Multi-domain]  Cd Length: 793  Bit Score: 53.94  E-value: 2.19e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982  34 SASRDKSVLVWELERSEsnygyARKALRGHSHFVQDVVISS-DGQFCLTGSWDGTLRLWDLNTGTTtrrfVGHTK---DV 109
Cdd:PLN00181 550 SSNFEGVVQVWDVARSQ-----LVTEMKEHEKRVWSIDYSSaDPTLLASGSDDGSVKLWSINQGVS----IGTIKtkaNI 620
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 110 LSVAFSVDN-RQIVSGSRDKTIKLWNtLGECKYTIGEPEGHTEWVSCVRFSPMTTnpiIVSGGWDKMVKVWNLT------ 182
Cdd:PLN00181 621 CCVQFPSESgRSLAFGSADHKVYYYD-LRNPKLPLCTMIGHSKTVSYVRFVDSST---LVSSSTDNTLKLWDLSmsisgi 696
                        170       180       190
                 ....*....|....*....|....*....|..
gi 159479982 183 NCKLKNNLVGHHGYVNTVTVSPDGSLCASGGK 214
Cdd:PLN00181 697 NETPLHSFMGHTNVKNFVGLSVSDGYIATGSE 728
 
Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
7-313 1.28e-90

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 274.60  E-value: 1.28e-90
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982   7 LRATLKGHTNWVTAIAtpLDPSSNTLLSASRDKSVLVWELERSEsnygyARKALRGHSHFVQDVVISSDGQFCLTGSWDG 86
Cdd:cd00200    1 LRRTLKGHTGGVTCVA--FSPDGKLLATGSGDGTIKVWDLETGE-----LLRTLKGHTGPVRDVAASADGTYLASGSSDK 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982  87 TLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKLWNTL-GECKYTIgepEGHTEWVSCVRFSPmtTNP 165
Cdd:cd00200   74 TIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVEtGKCLTTL---RGHTDWVNSVAFSP--DGT 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 166 IIVSGGWDKMVKVWNLTNCKLKNNLVGHHGYVNTVTVSPDGSLCASGGKDGIAMLWDLAEGKRLYSLDA-GDVIHCLCFS 244
Cdd:cd00200  149 FVASSSQDGTIKLWDLRTGKCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLRGhENGVNSVAFS 228
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 245 PNRYWLCAATQ-SSIKIWDLESKSIVDDLRPEFNItskkaqvpyCVSLAWSADGSTLYSGYTDGQIRVWA 313
Cdd:cd00200  229 PDGYLLASGSEdGTIRVWDLRTGECVQTLSGHTNS---------VTSLAWSPDGKRLASGSADGTIRIWD 289
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
3-180 8.85e-41

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 145.17  E-value: 8.85e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982   3 ETLTLRATLKGHTNWVTAIAtpLDPSSNTLLSASRDKSVLVWELersesNYGYARKALRGHSHFVQDVVISSDGQFCLTG 82
Cdd:cd00200  123 ETGKCLTTLRGHTDWVNSVA--FSPDGTFVASSSQDGTIKLWDL-----RTGKCVATLTGHTGEVNSVAFSPDGEKLLSS 195
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982  83 SWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKLWNTL-GECKYTIgepEGHTEWVSCVRFSPm 161
Cdd:cd00200  196 SSDGTIKLWDLSTGKCLGTLRGHENGVNSVAFSPDGYLLASGSEDGTIRVWDLRtGECVQTL---SGHTNSVTSLAWSP- 271
                        170
                 ....*....|....*....
gi 159479982 162 tTNPIIVSGGWDKMVKVWN 180
Cdd:cd00200  272 -DGKRLASGSADGTIRIWD 289
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
2-134 7.13e-28

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 109.73  E-value: 7.13e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982   2 AETLTLRATLKGHTNWVTAIAtpLDPSSNTLLSASRDKSVLVWELERSESnygyaRKALRGHSHFVQDVVISSDGQFCLT 81
Cdd:cd00200  164 LRTGKCVATLTGHTGEVNSVA--FSPDGEKLLSSSSDGTIKLWDLSTGKC-----LGTLRGHENGVNSVAFSPDGYLLAS 236
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|...
gi 159479982  82 GSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKLWN 134
Cdd:cd00200  237 GSEDGTIRVWDLRTGECVQTLSGHTNSVTSLAWSPDGKRLASGSADGTIRIWD 289
WD40 pfam00400
WD domain, G-beta repeat;
96-134 4.06e-08

WD domain, G-beta repeat;


Pssm-ID: 249832  Cd Length: 39  Bit Score: 48.89  E-value: 4.06e-08
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 159479982   96 GTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKLWN 134
Cdd:pfam00400   1 GKLLRTLKGHTGPVTSVAFSPDGNLLASGSDDGTVRVWD 39
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
95-134 1.51e-07

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651  Cd Length: 40  Bit Score: 47.31  E-value: 1.51e-07
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 159479982    95 TGTTTRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKLWN 134
Cdd:smart00320   1 SGELLKTLKGHTGPVTSVAFSPDGKYLASGSDDGTIKLWD 40
WD40 pfam00400
WD domain, G-beta repeat;
60-92 9.75e-07

WD domain, G-beta repeat;


Pssm-ID: 249832  Cd Length: 39  Bit Score: 45.04  E-value: 9.75e-07
                          10        20        30
                  ....*....|....*....|....*....|...
gi 159479982   60 LRGHSHFVQDVVISSDGQFCLTGSWDGTLRLWD 92
Cdd:pfam00400   7 LKGHTGPVTSVAFSPDGNLLASGSDDGTVRVWD 39
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
60-92 1.64e-06

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651  Cd Length: 40  Bit Score: 44.23  E-value: 1.64e-06
                           10        20        30
                   ....*....|....*....|....*....|...
gi 159479982    60 LRGHSHFVQDVVISSDGQFCLTGSWDGTLRLWD 92
Cdd:smart00320   8 LKGHTGPVTSVAFSPDGKYLASGSDDGTIKLWD 40
WD40 pfam00400
WD domain, G-beta repeat;
137-180 2.64e-06

WD domain, G-beta repeat;


Pssm-ID: 249832  Cd Length: 39  Bit Score: 43.50  E-value: 2.64e-06
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 159479982  137 GECKYTIgepEGHTEWVSCVRFSPmtTNPIIVSGGWDKMVKVWN 180
Cdd:pfam00400   1 GKLLRTL---KGHTGPVTSVAFSP--DGNLLASGSDDGTVRVWD 39
WD40 pfam00400
WD domain, G-beta repeat;
184-222 3.94e-06

WD domain, G-beta repeat;


Pssm-ID: 249832  Cd Length: 39  Bit Score: 43.12  E-value: 3.94e-06
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 159479982  184 CKLKNNLVGHHGYVNTVTVSPDGSLCASGGKDGIAMLWD 222
Cdd:pfam00400   1 GKLLRTLKGHTGPVTSVAFSPDGNLLASGSDDGTVRVWD 39
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
137-180 7.57e-06

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651  Cd Length: 40  Bit Score: 42.30  E-value: 7.57e-06
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....
gi 159479982   137 GECKYTIgepEGHTEWVSCVRFSPmtTNPIIVSGGWDKMVKVWN 180
Cdd:smart00320   2 GELLKTL---KGHTGPVTSVAFSP--DGKYLASGSDDGTIKLWD 40
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
185-222 8.35e-06

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651  Cd Length: 40  Bit Score: 42.30  E-value: 8.35e-06
                           10        20        30
                   ....*....|....*....|....*....|....*...
gi 159479982   185 KLKNNLVGHHGYVNTVTVSPDGSLCASGGKDGIAMLWD 222
Cdd:smart00320   3 ELLKTLKGHTGPVTSVAFSPDGKYLASGSDDGTIKLWD 40
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
4-45 1.94e-05

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651  Cd Length: 40  Bit Score: 41.14  E-value: 1.94e-05
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|..
gi 159479982     4 TLTLRATLKGHTNWVTAIAtpLDPSSNTLLSASRDKSVLVWE 45
Cdd:smart00320   1 SGELLKTLKGHTGPVTSVA--FSPDGKYLASGSDDGTIKLWD 40
WD40 pfam00400
WD domain, G-beta repeat;
6-44 2.22e-05

WD domain, G-beta repeat;


Pssm-ID: 249832  Cd Length: 39  Bit Score: 41.19  E-value: 2.22e-05
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 159479982    6 TLRATLKGHTNWVTAIAtpLDPSSNTLLSASRDKSVLVW 44
Cdd:pfam00400   2 KLLRTLKGHTGPVTSVA--FSPDGNLLASGSDDGTVRVW 38
WD40 pfam00400
WD domain, G-beta repeat;
290-312 3.14e-03

WD domain, G-beta repeat;


Pssm-ID: 249832  Cd Length: 39  Bit Score: 35.03  E-value: 3.14e-03
                          10        20
                  ....*....|....*....|...
gi 159479982  290 SLAWSADGSTLYSGYTDGQIRVW 312
Cdd:pfam00400  16 SVAFSPDGNLLASGSDDGTVRVW 38
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
9-312 9.72e-39

FOG: WD40 repeat [General function prediction only]


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 142.92  E-value: 9.72e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982   9 ATLKGHTNWVTAIATPLDPSSNTLLSA--SRDKSVLVWELERSESNYgyarKALRGHSHFVQDVVISSDGQFCLTGS-WD 85
Cdd:COG2319  102 KSLEGLHDSSVSKLALSSPDGNSILLAssSLDGTVKLWDLSTPGKLI----RTLEGHSESVTSLAFSPDGKLLASGSsLD 177
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982  86 GTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNR-QIVSGSRDKTIKLWNTL-GECKYTIGepEGHTEWVSCVrFSPmtT 163
Cdd:COG2319  178 GTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGGlLIASGSSDGTIRLWDLStGKLLRSTL--SGHSDSVVSS-FSP--D 252
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 164 NPIIVSGGWDKMVKVWNL-TNCKLKNNLVGHHGYVNTVTVSPDGSLCASGGKDGIAMLWDLAEGKRLYSLDA---GDVIH 239
Cdd:COG2319  253 GSLLASGSSDGTIRLWDLrSSSSLLRTLSGHSSSVLSVAFSPDGKLLASGSSDGTVRLWDLETGKLLSSLTLkghEGPVS 332
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 159479982 240 CLCFSPNRYWLCAATQS--SIKIWDLESKSIVDDLRPEFNITskkaqvpycvSLAWSADGSTLYSGYTDGQIRVW 312
Cdd:COG2319  333 SLSFSPDGSLLVSGGSDdgTIRLWDLRTGKPLKTLEGHSNVL----------SVSFSPDGRVVSSGSTDGTVRLW 397
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
6-312 1.13e-38

FOG: WD40 repeat [General function prediction only]


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 142.92  E-value: 1.13e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982   6 TLRATLKGHTNWVTAIAtpLDPSSNTLLSASR-DKSVLVWELERSESNYGYArkalrGHSHFVQDVVISSDGQF-CLTGS 83
Cdd:COG2319  146 KLIRTLEGHSESVTSLA--FSPDGKLLASGSSlDGTIKLWDLRTGKPLSTLA-----GHTDPVSSLAFSPDGGLlIASGS 218
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982  84 WDGTLRLWDLNTGTTTR-RFVGHTKDVLSvAFSVDNRQIVSGSRDKTIKLWNtLGECKYTIGEPEGHTEWVSCVRFSPMT 162
Cdd:COG2319  219 SDGTIRLWDLSTGKLLRsTLSGHSDSVVS-SFSPDGSLLASGSSDGTIRLWD-LRSSSSLLRTLSGHSSSVLSVAFSPDG 296
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 163 TnpIIVSGGWDKMVKVWNLTNCKLKN--NLVGHHGYVNTVTVSPDGSLCASGG-KDGIAMLWDLAEGKRLYSLDAGDVIH 239
Cdd:COG2319  297 K--LLASGSSDGTVRLWDLETGKLLSslTLKGHEGPVSSLSFSPDGSLLVSGGsDDGTIRLWDLRTGKPLKTLEGHSNVL 374
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 159479982 240 CLCFSPNRYWLC-AATQSSIKIWDLESKSIvddlrpefnITSKKAQVPYCVSLAWSADGSTLYSGYTDGQIRVW 312
Cdd:COG2319  375 SVSFSPDGRVVSsGSTDGTVRLWDLSTGSL---------LRNLDGHTSRVTSLDFSPDGKSLASGSSDNTIRLW 439
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
10-312 2.46e-38

FOG: WD40 repeat [General function prediction only]


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 141.76  E-value: 2.46e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982  10 TLKGHTNWVTAIAtpLDPSSNTLLSASRDKSVLVWELERSESNYgyarKALRG-HSHFVQDV-VISSDGQFCLT--GSWD 85
Cdd:COG2319   60 LLRGHEDSITSIA--FSPDGELLLSGSSDGTIKLWDLDNGEKLI----KSLEGlHDSSVSKLaLSSPDGNSILLasSSLD 133
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982  86 GTLRLWDLNT-GTTTRRFVGHTKDVLSVAFSVDNRQIVSGSR-DKTIKLWNTL-GECKYTIgepEGHTEWVSCVRFSPmT 162
Cdd:COG2319  134 GTVKLWDLSTpGKLIRTLEGHSESVTSLAFSPDGKLLASGSSlDGTIKLWDLRtGKPLSTL---AGHTDPVSSLAFSP-D 209
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 163 TNPIIVSGGWDKMVKVWNLTNCKLKNNLVGHHGYVNTVTVSPDGSLCASGGKDGIAMLWDLAEGKRLYSLDAG--DVIHC 240
Cdd:COG2319  210 GGLLIASGSSDGTIRLWDLSTGKLLRSTLSGHSDSVVSSFSPDGSLLASGSSDGTIRLWDLRSSSSLLRTLSGhsSSVLS 289
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 159479982 241 LCFSPN-RYWLCAATQSSIKIWDLESKsivdDLRPEFNITSKKAQVPycvSLAWSADGSTLYSGY-TDGQIRVW 312
Cdd:COG2319  290 VAFSPDgKLLASGSSDGTVRLWDLETG----KLLSSLTLKGHEGPVS---SLSFSPDGSLLVSGGsDDGTIRLW 356
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
2-282 1.92e-35

FOG: WD40 repeat [General function prediction only]


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 133.68  E-value: 1.92e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982   2 AETLTLRATLKGHTNWVTAIAtPLDPSSNTLLSASRDKSVLVWELERSESnygyARKALRGHShFVQDVVISSDGQFCLT 81
Cdd:COG2319  185 LRTGKPLSTLAGHTDPVSSLA-FSPDGGLLIASGSSDGTIRLWDLSTGKL----LRSTLSGHS-DSVVSSFSPDGSLLAS 258
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982  82 GSWDGTLRLWDLNTGTT-TRRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKLWNTLGECKYTIGEPEGHTEWVSCVRFSP 160
Cdd:COG2319  259 GSSDGTIRLWDLRSSSSlLRTLSGHSSSVLSVAFSPDGKLLASGSSDGTVRLWDLETGKLLSSLTLKGHEGPVSSLSFSP 338
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 161 mTTNPIIVSGGWDKMVKVWNLTNCKLKNNLVGHHGyVNTVTVSPDGSLCASGGKDGIAMLWDLAEGKRLYSLDA-GDVIH 239
Cdd:COG2319  339 -DGSLLVSGGSDDGTIRLWDLRTGKPLKTLEGHSN-VLSVSFSPDGRVVSSGSTDGTVRLWDLSTGSLLRNLDGhTSRVT 416
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 159479982 240 CLCFSPNRYWLCAATQS-SIKIWDLESKSIVDDLRPEFNITSKK 282
Cdd:COG2319  417 SLDFSPDGKSLASGSSDnTIRLWDLKTSLKSVSFSPDGKVLASK 460
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
46-312 3.81e-27

FOG: WD40 repeat [General function prediction only]


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 109.41  E-value: 3.81e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982  46 LERSESNYGYARKALRGHSHFVQDVVISSDGQFCLTGSWDGTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIVSGS 125
Cdd:COG2319    5 SSTSSENKSKLLKKSELGPSLNSLSLLSLGSSESGILLLALLSDSLVSLPDLSSLLLRGHEDSITSIAFSPDGELLLSGS 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 126 RDKTIKLWNTLGECKYTIGEPEGHTEWVSCVRF-SPMTTNPIIVSGGWDKMVKVWNLTNC-KLKNNLVGHHGYVNTVTVS 203
Cdd:COG2319   85 SDGTIKLWDLDNGEKLIKSLEGLHDSSVSKLALsSPDGNSILLASSSLDGTVKLWDLSTPgKLIRTLEGHSESVTSLAFS 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 204 PDGSLCASGG-KDGIAMLWDLAEGKRLYSLD-AGDVIHCLCFSPNRYW--LCAATQSSIKIWDLESKSIVDDLRPEFNIT 279
Cdd:COG2319  165 PDGKLLASGSsLDGTIKLWDLRTGKPLSTLAgHTDPVSSLAFSPDGGLliASGSSDGTIRLWDLSTGKLLRSTLSGHSDS 244
                        250       260       270
                 ....*....|....*....|....*....|...
gi 159479982 280 skkaqvpycVSLAWSADGSTLYSGYTDGQIRVW 312
Cdd:COG2319  245 ---------VVSSFSPDGSLLASGSSDGTIRLW 268
PTZ00421 PTZ00421
coronin; Provisional
103-272 1.31e-08

coronin; Provisional


Pssm-ID: 173611 [Multi-domain]  Cd Length: 493  Bit Score: 54.51  E-value: 1.31e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 103 VGHTKDVLSVAFS-VDNRQIVSGSRDKTIKLWNTLGE-----CKYTIGEPEGHTEWVSCVRFSPMTTNpIIVSGGWDKMV 176
Cdd:PTZ00421  72 LGQEGPIIDVAFNpFDPQKLFTASEDGTIMGWGIPEEgltqnISDPIVHLQGHTKKVGIVSFHPSAMN-VLASAGADMVV 150
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 177 KVWNLTNCKLKNNLVGHHGYVNTVTVSPDGSLCASGGKDGIAMLWDLAEGKRLYSLDA--------------GDVIHCLC 242
Cdd:PTZ00421 151 NVWDVERGKAVEVIKCHSDQITSLEWNLDGSLLCTTSKDKKLNIIDPRDGTIVSSVEAhasaksqrclwakrKDLIITLG 230
                        170       180       190
                 ....*....|....*....|....*....|...
gi 159479982 243 FSpnrywlcAATQSSIKIWD---LESKSIVDDL 272
Cdd:PTZ00421 231 CS-------KSQQRQIMLWDtrkMASPYSTVDL 256
PLN00181 PLN00181
protein SPA1-RELATED; Provisional
34-214 2.19e-08

protein SPA1-RELATED; Provisional


Pssm-ID: 177776 [Multi-domain]  Cd Length: 793  Bit Score: 53.94  E-value: 2.19e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982  34 SASRDKSVLVWELERSEsnygyARKALRGHSHFVQDVVISS-DGQFCLTGSWDGTLRLWDLNTGTTtrrfVGHTK---DV 109
Cdd:PLN00181 550 SSNFEGVVQVWDVARSQ-----LVTEMKEHEKRVWSIDYSSaDPTLLASGSDDGSVKLWSINQGVS----IGTIKtkaNI 620
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 110 LSVAFSVDN-RQIVSGSRDKTIKLWNtLGECKYTIGEPEGHTEWVSCVRFSPMTTnpiIVSGGWDKMVKVWNLT------ 182
Cdd:PLN00181 621 CCVQFPSESgRSLAFGSADHKVYYYD-LRNPKLPLCTMIGHSKTVSYVRFVDSST---LVSSSTDNTLKLWDLSmsisgi 696
                        170       180       190
                 ....*....|....*....|....*....|..
gi 159479982 183 NCKLKNNLVGHHGYVNTVTVSPDGSLCASGGK 214
Cdd:PLN00181 697 NETPLHSFMGHTNVKNFVGLSVSDGYIATGSE 728
PLN00181 PLN00181
protein SPA1-RELATED; Provisional
109-318 6.85e-08

protein SPA1-RELATED; Provisional


Pssm-ID: 177776 [Multi-domain]  Cd Length: 793  Bit Score: 52.40  E-value: 6.85e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 109 VLSVAFSVDNRQIVSGSRDKTIKLWntlgECKYTIGEPEG-H---TEWVSCVRFSPMTTNPII----VSGGWDKMVKVWN 180
Cdd:PLN00181 486 VCAIGFDRDGEFFATAGVNKKIKIF----ECESIIKDGRDiHypvVELASRSKLSGICWNSYIksqvASSNFEGVVQVWD 561
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 181 LTNCKLKNNLVGHHGYVNTVTVSP-DGSLCASGGKDGIAMLWDLAEGKRLYSLDAGDVIHCLCFSpnrywlcAATQSSIK 259
Cdd:PLN00181 562 VARSQLVTEMKEHEKRVWSIDYSSaDPTLLASGSDDGSVKLWSINQGVSIGTIKTKANICCVQFP-------SESGRSLA 634
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 159479982 260 IWDLESKSIVDDLRpefnitskKAQVPYC--------VSLAWSADGSTLYSGYTDGQIRVWAVGHSL 318
Cdd:PLN00181 635 FGSADHKVYYYDLR--------NPKLPLCtmighsktVSYVRFVDSSTLVSSSTDNTLKLWDLSMSI 693
PTZ00420 PTZ00420
coronin; Provisional
71-310 2.04e-05

coronin; Provisional


Pssm-ID: 240412 [Multi-domain]  Cd Length: 568  Bit Score: 44.56  E-value: 2.04e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982  71 VISSDGQFCLTG----SWD-------GTLRLWDLNTGTTTRRFVGHTKDVLSVAFSVDNRQIV-SGSRDKTIKLWN---- 134
Cdd:PTZ00420  28 VIDSCGIACSSGfvavPWEvegggliGAIRLENQMRKPPVIKLKGHTSSILDLQFNPCFSEILaSGSEDLTIRVWEiphn 107
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 135 --TLGECKYTIGEPEGHTEWVSCVRFSPMTTNpIIVSGGWDKMVKVWNLTNCK-----------------LKNNL----- 190
Cdd:PTZ00420 108 deSVKEIKDPQCILKGHKKKISIIDWNPMNYY-IMCSSGFDSFVNIWDIENEKrafqinmpkklsslkwnIKGNLlsgtc 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 191 VGHHGYVntvtVSP-DGSLCAS-----GGKDGIAMLWDLAEGKRLYSLDAGdvihclcFSPNRYwlcaatqSSIKIWDLE 264
Cdd:PTZ00420 187 VGKHMHI----IDPrKQEIASSfhihdGGKNTKNIWIDGLGGDDNYILSTG-------FSKNNM-------REMKLWDLK 248
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 159479982 265 SKSivddlRPEFNITSKKAQVPYC---------VSLAWSADGSTLYSGYTDGQIR 310
Cdd:PTZ00420 249 NTT-----SALVTMSIDNASAPLIphydestglIYLIGKGDGNCRYYQHSLGSIR 298
PTZ00421 PTZ00421
coronin; Provisional
11-188 7.22e-04

coronin; Provisional


Pssm-ID: 173611 [Multi-domain]  Cd Length: 493  Bit Score: 39.49  E-value: 7.22e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982  11 LKGHTNWVTAIAtpLDPSS-NTLLSASRDKSVLVWELERsesnyGYARKALRGHSHFVQDVVISSDGQFCLTGSWDGTLR 89
Cdd:PTZ00421 121 LQGHTKKVGIVS--FHPSAmNVLASAGADMVVNVWDVER-----GKAVEVIKCHSDQITSLEWNLDGSLLCTTSKDKKLN 193
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982  90 LWDLNTGTTTRRFVGH--TKDVLSVAFSVDNRQI---VSGSRDKTIKLWNTLGEckytigEPEGHTEWV--SCVRFSPM- 161
Cdd:PTZ00421 194 IIDPRDGTIVSSVEAHasAKSQRCLWAKRKDLIItlgCSKSQQRQIMLWDTRKM------ASPYSTVDLdqSSALFIPFf 267
                        170       180
                 ....*....|....*....|....*....
gi 159479982 162 --TTNPIIVSGGWDKMVKVWNLTNCKLKN 188
Cdd:PTZ00421 268 deDTNLLYIGSKGEGNIRCFELMNERLTF 296
PTZ00421 PTZ00421
coronin; Provisional
24-132 2.50e-03

coronin; Provisional


Pssm-ID: 173611 [Multi-domain]  Cd Length: 493  Bit Score: 37.95  E-value: 2.50e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982  24 PLDPSSntLLSASRDKSVLVWEL--ERSESNYGYARKALRGHSHFVQDVVI--SSDGQFCLTGSwDGTLRLWDLNTGTTT 99
Cdd:PTZ00421  85 PFDPQK--LFTASEDGTIMGWGIpeEGLTQNISDPIVHLQGHTKKVGIVSFhpSAMNVLASAGA-DMVVNVWDVERGKAV 161
                         90       100       110
                 ....*....|....*....|....*....|...
gi 159479982 100 RRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKL 132
Cdd:PTZ00421 162 EVIKCHSDQITSLEWNLDGSLLCTTSKDKKLNI 194
COG4946 COG4946
Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport ...
146-301 7.52e-03

Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]


Pssm-ID: 227282 [Multi-domain]  Cd Length: 668  Bit Score: 36.72  E-value: 7.52e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 146 PEGHTEWVSCVRFSPMTTNPIIVSGGWDKMVkVWNLTNCKLKNnLVGHHGYVNTVTVSPDGSLCASGGKDGIAMLWDLAE 225
Cdd:COG4946  355 QVGKKGGVRYRRIQVDPEGDVIGTNDGDKLG-IYDKDGGEVKR-IEKDLGNIEAVKVSPDGKKVVVANDRFELWVIDIDN 432
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159479982 226 GK-RLYSLDAGDVIHCLCFSPNRYWLCAA-----TQSSIKIWDLESKSIVDdlrpefnITSKKAqvpYCVSLAWSADGST 299
Cdd:COG4946  433 GNvRLIDKSEYGLITDFDWHPNSRWIAYAfpegyYTQSIKLYDMDGGKIYD-------VTTPTA---YDFSPAFDPDGRY 502

                 ..
gi 159479982 300 LY 301
Cdd:COG4946  503 LY 504
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH