NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|159465889|ref|XP_001691150|]
View 

hypothetical protein CHLREDRAFT_181520 [Chlamydomonas reinhardtii]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Helicase_C pfam00271
Helicase conserved C-terminal domain; The Prosite family is restricted to DEAD/H helicases, ...
53-111 3.29e-08

Helicase conserved C-terminal domain; The Prosite family is restricted to DEAD/H helicases, whereas this domain family is found in a wide variety of helicases and helicase related proteins. It may be that this is not an autonomously folding unit, but an integral part of the helicase.


:

Pssm-ID: 249733  Cd Length: 78  Bit Score: 46.74  E-value: 3.29e-08
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 159465889   53 RTRVLHAFKHNpDINTVFLSKVGDNSLDIPEANVLIQISSHaGSRRQEAQRLGRILRAK 111
Cdd:pfam00271  22 REEILEDFRNG-KSKVLVATDVAGRGIDLPDVNVVINYDLP-WNPESYIQRIGRAGRAG 78
 
Name Accession Description Interval E-value
Helicase_C pfam00271
Helicase conserved C-terminal domain; The Prosite family is restricted to DEAD/H helicases, ...
53-111 3.29e-08

Helicase conserved C-terminal domain; The Prosite family is restricted to DEAD/H helicases, whereas this domain family is found in a wide variety of helicases and helicase related proteins. It may be that this is not an autonomously folding unit, but an integral part of the helicase.


Pssm-ID: 249733  Cd Length: 78  Bit Score: 46.74  E-value: 3.29e-08
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 159465889   53 RTRVLHAFKHNpDINTVFLSKVGDNSLDIPEANVLIQISSHaGSRRQEAQRLGRILRAK 111
Cdd:pfam00271  22 REEILEDFRNG-KSKVLVATDVAGRGIDLPDVNVVINYDLP-WNPESYIQRIGRAGRAG 78
HELICc smart00490
helicase superfamily c-terminal domain;
53-111 7.14e-07

helicase superfamily c-terminal domain;


Pssm-ID: 197757  Cd Length: 82  Bit Score: 42.97  E-value: 7.14e-07
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 159465889    53 RTRVLHAFKhNPDINTVFLSKVGDNSLDIPEANVLIQISSHaGSRRQEAQRLGRILRAK 111
Cdd:smart00490  26 REEILDKFN-NGKIKVLVATDVAERGLDLPGVDLVIIYDLP-WSPASYIQRIGRAGRAG 82
HELICc cd00079
Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, ...
53-115 4.53e-03

Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process


Pssm-ID: 238034 [Multi-domain]  Cd Length: 131  Bit Score: 33.75  E-value: 4.53e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 159465889  53 RTRVLHAFKHNPdINTVFLSKVGDNSLDIPEANVLIQISSHAGSrRQEAQRLGRILRA-KRGKA 115
Cdd:cd00079   67 REEVLKDFREGE-IVVLVATDVIARGIDLPNVSVVINYDLPWSP-SSYLQRIGRAGRAgQKGTA 128
rad25 TIGR00603
DNA repair helicase rad25; All proteins in this family for which functions are known are ...
1-119 3.14e-49

DNA repair helicase rad25; All proteins in this family for which functions are known are DNA-DNA helicases used for the initiation of nucleotide excision repair and transacription as part of the TFIIH complex.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair].


Pssm-ID: 233046 [Multi-domain]  Cd Length: 732  Bit Score: 167.67  E-value: 3.14e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159465889    1 EAGVLVTTFTMIAFSGKRSEESERIMNIIRSREWGLLLMDEVHVVPAQMFR----------------------------- 51
Cdd:TIGR00603 343 EAGVVVSTYSMVAHTGKRSYESEKVMEWLTNREWGLILLDEVHVVPAAMFRrvltivqahcklgltatlvreddkitdln 422
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159465889      --------------------------------------------------------------------------------
Cdd:TIGR00603 423 fligpklyeanwmelqkkgfianvqcaevwcpmtpefyreylrensrkrmllyvmnpnkfracqflirfheqrgdkiivf 502
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159465889   52 --------------------------TRTRVLHAFKHNPDINTVFLSKVGDNSLDIPEANVLIQISSHAGSRRQEAQRLG 105
Cdd:TIGR00603 503 sdnvfalkeyaiklgkpfiygptsqqERMQILQNFQHNPKVNTIFLSKVGDTSIDLPEANVLIQISSHYGSRRQEAQRLG 582
                         250
                  ....*....|....
gi 159465889  106 RILRAKRGKAGSGH 119
Cdd:TIGR00603 583 RILRAKKGSDAEEY 596
SSL2 COG1061
DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and ...
53-114 7.54e-16

DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]


Pssm-ID: 223989 [Multi-domain]  Cd Length: 442  Bit Score: 72.47  E-value: 7.54e-16
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 159465889  53 RTRVLHAFKHNpDINTVFLSKVGDNSLDIPEANVLIQISShAGSRRQEAQRLGRILRAKRGK 114
Cdd:COG1061  321 REAILERFRTG-GIKVLVTVKVLDEGVDIPDADVLIILRP-TGSRRLFIQRLGRGLRPAEGK 380
 
Name Accession Description Interval E-value
Helicase_C pfam00271
Helicase conserved C-terminal domain; The Prosite family is restricted to DEAD/H helicases, ...
53-111 3.29e-08

Helicase conserved C-terminal domain; The Prosite family is restricted to DEAD/H helicases, whereas this domain family is found in a wide variety of helicases and helicase related proteins. It may be that this is not an autonomously folding unit, but an integral part of the helicase.


Pssm-ID: 249733  Cd Length: 78  Bit Score: 46.74  E-value: 3.29e-08
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 159465889   53 RTRVLHAFKHNpDINTVFLSKVGDNSLDIPEANVLIQISSHaGSRRQEAQRLGRILRAK 111
Cdd:pfam00271  22 REEILEDFRNG-KSKVLVATDVAGRGIDLPDVNVVINYDLP-WNPESYIQRIGRAGRAG 78
HELICc smart00490
helicase superfamily c-terminal domain;
53-111 7.14e-07

helicase superfamily c-terminal domain;


Pssm-ID: 197757  Cd Length: 82  Bit Score: 42.97  E-value: 7.14e-07
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 159465889    53 RTRVLHAFKhNPDINTVFLSKVGDNSLDIPEANVLIQISSHaGSRRQEAQRLGRILRAK 111
Cdd:smart00490  26 REEILDKFN-NGKIKVLVATDVAERGLDLPGVDLVIIYDLP-WSPASYIQRIGRAGRAG 82
HELICc cd00079
Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, ...
53-115 4.53e-03

Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process


Pssm-ID: 238034 [Multi-domain]  Cd Length: 131  Bit Score: 33.75  E-value: 4.53e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 159465889  53 RTRVLHAFKHNPdINTVFLSKVGDNSLDIPEANVLIQISSHAGSrRQEAQRLGRILRA-KRGKA 115
Cdd:cd00079   67 REEVLKDFREGE-IVVLVATDVIARGIDLPNVSVVINYDLPWSP-SSYLQRIGRAGRAgQKGTA 128
rad25 TIGR00603
DNA repair helicase rad25; All proteins in this family for which functions are known are ...
1-119 3.14e-49

DNA repair helicase rad25; All proteins in this family for which functions are known are DNA-DNA helicases used for the initiation of nucleotide excision repair and transacription as part of the TFIIH complex.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair].


Pssm-ID: 233046 [Multi-domain]  Cd Length: 732  Bit Score: 167.67  E-value: 3.14e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159465889    1 EAGVLVTTFTMIAFSGKRSEESERIMNIIRSREWGLLLMDEVHVVPAQMFR----------------------------- 51
Cdd:TIGR00603 343 EAGVVVSTYSMVAHTGKRSYESEKVMEWLTNREWGLILLDEVHVVPAAMFRrvltivqahcklgltatlvreddkitdln 422
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159465889      --------------------------------------------------------------------------------
Cdd:TIGR00603 423 fligpklyeanwmelqkkgfianvqcaevwcpmtpefyreylrensrkrmllyvmnpnkfracqflirfheqrgdkiivf 502
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159465889   52 --------------------------TRTRVLHAFKHNPDINTVFLSKVGDNSLDIPEANVLIQISSHAGSRRQEAQRLG 105
Cdd:TIGR00603 503 sdnvfalkeyaiklgkpfiygptsqqERMQILQNFQHNPKVNTIFLSKVGDTSIDLPEANVLIQISSHYGSRRQEAQRLG 582
                         250
                  ....*....|....
gi 159465889  106 RILRAKRGKAGSGH 119
Cdd:TIGR00603 583 RILRAKKGSDAEEY 596
SSL2 COG1061
DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and ...
53-114 7.54e-16

DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]


Pssm-ID: 223989 [Multi-domain]  Cd Length: 442  Bit Score: 72.47  E-value: 7.54e-16
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 159465889  53 RTRVLHAFKHNpDINTVFLSKVGDNSLDIPEANVLIQISShAGSRRQEAQRLGRILRAKRGK 114
Cdd:COG1061  321 REAILERFRTG-GIKVLVTVKVLDEGVDIPDADVLIILRP-TGSRRLFIQRLGRGLRPAEGK 380
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH