NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|159463622|ref|XP_001690041.1|]
View 

subunit of retromer complex [Chlamydomonas reinhardtii]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Vps35 super family cl20256
Vacuolar protein sorting-associated protein 35; Vacuolar protein sorting-associated protein ...
14-667 0e+00

Vacuolar protein sorting-associated protein 35; Vacuolar protein sorting-associated protein (Vps) 35 is one of around 50 proteins involved in protein trafficking. In particular, Vps35 assembles into a retromer complex with at least four other proteins Vps5, Vps17, Vps26 and Vps29. Vps35 contains a central region of weaker sequence similarity, thought to indicate the presence of at least three domains.


The actual alignment was detected with superfamily member pfam03635:

Pssm-ID: 252074  Cd Length: 749  Bit Score: 611.57  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622   14 RILQDASTVIKRNAFHMRKAIEEDNMRDSLKHAAAMLGELRTSQLQPQKYYELYMLAFDQLSYLESFFADERGKGRAYSE 93
Cdd:pfam03635   1 KLLEEAIAVVKQQSFLMKRCLDQGKLMDALKHASNMLSELRTSSLSPKQYYELYMKVFDELQYLSTYLVDEHPKGHHLAD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622   94 LYELVQHAGNVLPRLYLMVAVGCLYIKSHEASPRDVLKDLVEMCKGVQHPTRGLFLRAYLCQRAKGLLPDTGSEFEGPaA 173
Cdd:pfam03635  81 LYELVQYAGNIVPRLYLLITVGSVYIKSKDAPAKEILKDMVEMCRGVQHPTRGLFLRYYLSQRTKDKLPDTGSYEEGG-G 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  174 GSIHDALDFLMTNFIEMNKLWVRLQHQGSARDKEKRERERQQLQDLVGKNLTYLSQLDGLSFELYRDQVLPRVLDQITSC 253
Cdd:pfam03635 160 GTVQDSIEFLLTNFIEMNKLWVRLQHQGPSREREKREKERKELRILVGSNLVRLSQLEGVDLEMYKETILPRILEQVVNC 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  254 KDDLAQLYLMQALIQGFPDRFHLGTLESLLGVLPQLQPGVKVRawlgprvhSVMAALMDRLARYASNASASAAGGGDPRV 333
Cdd:pfam03635 240 RDVLAQEYLLEVIIQVFPDEFHLATLDTLLSACLQLNPGVDVK--------KILITLMDRLAAYAERSNEGVAEVESRKE 311
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  334 LEELAA--IDAFSKFK---AAIAQVCPSIPLRG------------------------------------WGNGKEAEGSW 372
Cdd:pfam03635 312 EELEAPedVDLFEVFWnqlVKLIKARPDLPLQDiiallvsllnltlkcypdrldyvdqvlgfavekvsnYLGAKLNSSEI 391
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  373 GR-------------YGVDVALGLKEYPPLTRLLRYPTHKELAVKIVQRVRERGSsglgrgaargvraggcVISDVSKVK 439
Cdd:pfam03635 392 EQeivrlllapistyKNILTALELPNYQPLLSSLDYSTRKSVALAIIDNILKNNT----------------LITTLDDVE 455
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  440 MLFRFIAPLVAD-PDVPGEAGGAAdlddEDLDEEQVLVARLLHHLRSDDPDTHFTILSVAHDQLLAGGPRRLRTTLPSLV 518
Cdd:pfam03635 456 RLFELISPLIKDqPDQPSDELDET----EEFAEEQEKVARLIHLIRSDDVEKQFKILNTVRKHLGKGGPERIRYTLPTLV 531
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  519 FCGLALHRRL-----------LTSEQLLQFLLAAIGPLYgGPAGQPVTALRLLLAAGYVASeEARLELLAYTFFEEAIAL 587
Cdd:pfam03635 532 FAALRLARRLksqekkddkwdAKIKKIFKFIHSTISILY-NVAPAAELALKLYLQCAIVAD-QCGLEEIAYEFFTQAFTI 609
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  588 YDEALPDQRSRATGLFDIIGGLQRCRVFGSEHRDALTAAATAGCMRLVARREQCRALCAAAWLWWQ-------------- 653
Cdd:pfam03635 610 YEESISDSKAQFQAIVLIISTLQRTRSLPEENYETLATKLALYASKLLKKPDQCRAVYLCSHLFWAtelpstgefyrdgk 689
                         730
                  ....*....|....*
gi 159463622  654 -VVATLQRAAKVAGQ 667
Cdd:pfam03635 690 rVLECLQKALRIADS 704
 
Name Accession Description Interval E-value
Vps35 pfam03635
Vacuolar protein sorting-associated protein 35; Vacuolar protein sorting-associated protein ...
14-667 0e+00

Vacuolar protein sorting-associated protein 35; Vacuolar protein sorting-associated protein (Vps) 35 is one of around 50 proteins involved in protein trafficking. In particular, Vps35 assembles into a retromer complex with at least four other proteins Vps5, Vps17, Vps26 and Vps29. Vps35 contains a central region of weaker sequence similarity, thought to indicate the presence of at least three domains.


Pssm-ID: 252074  Cd Length: 749  Bit Score: 611.57  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622   14 RILQDASTVIKRNAFHMRKAIEEDNMRDSLKHAAAMLGELRTSQLQPQKYYELYMLAFDQLSYLESFFADERGKGRAYSE 93
Cdd:pfam03635   1 KLLEEAIAVVKQQSFLMKRCLDQGKLMDALKHASNMLSELRTSSLSPKQYYELYMKVFDELQYLSTYLVDEHPKGHHLAD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622   94 LYELVQHAGNVLPRLYLMVAVGCLYIKSHEASPRDVLKDLVEMCKGVQHPTRGLFLRAYLCQRAKGLLPDTGSEFEGPaA 173
Cdd:pfam03635  81 LYELVQYAGNIVPRLYLLITVGSVYIKSKDAPAKEILKDMVEMCRGVQHPTRGLFLRYYLSQRTKDKLPDTGSYEEGG-G 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  174 GSIHDALDFLMTNFIEMNKLWVRLQHQGSARDKEKRERERQQLQDLVGKNLTYLSQLDGLSFELYRDQVLPRVLDQITSC 253
Cdd:pfam03635 160 GTVQDSIEFLLTNFIEMNKLWVRLQHQGPSREREKREKERKELRILVGSNLVRLSQLEGVDLEMYKETILPRILEQVVNC 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  254 KDDLAQLYLMQALIQGFPDRFHLGTLESLLGVLPQLQPGVKVRawlgprvhSVMAALMDRLARYASNASASAAGGGDPRV 333
Cdd:pfam03635 240 RDVLAQEYLLEVIIQVFPDEFHLATLDTLLSACLQLNPGVDVK--------KILITLMDRLAAYAERSNEGVAEVESRKE 311
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  334 LEELAA--IDAFSKFK---AAIAQVCPSIPLRG------------------------------------WGNGKEAEGSW 372
Cdd:pfam03635 312 EELEAPedVDLFEVFWnqlVKLIKARPDLPLQDiiallvsllnltlkcypdrldyvdqvlgfavekvsnYLGAKLNSSEI 391
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  373 GR-------------YGVDVALGLKEYPPLTRLLRYPTHKELAVKIVQRVRERGSsglgrgaargvraggcVISDVSKVK 439
Cdd:pfam03635 392 EQeivrlllapistyKNILTALELPNYQPLLSSLDYSTRKSVALAIIDNILKNNT----------------LITTLDDVE 455
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  440 MLFRFIAPLVAD-PDVPGEAGGAAdlddEDLDEEQVLVARLLHHLRSDDPDTHFTILSVAHDQLLAGGPRRLRTTLPSLV 518
Cdd:pfam03635 456 RLFELISPLIKDqPDQPSDELDET----EEFAEEQEKVARLIHLIRSDDVEKQFKILNTVRKHLGKGGPERIRYTLPTLV 531
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  519 FCGLALHRRL-----------LTSEQLLQFLLAAIGPLYgGPAGQPVTALRLLLAAGYVASeEARLELLAYTFFEEAIAL 587
Cdd:pfam03635 532 FAALRLARRLksqekkddkwdAKIKKIFKFIHSTISILY-NVAPAAELALKLYLQCAIVAD-QCGLEEIAYEFFTQAFTI 609
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  588 YDEALPDQRSRATGLFDIIGGLQRCRVFGSEHRDALTAAATAGCMRLVARREQCRALCAAAWLWWQ-------------- 653
Cdd:pfam03635 610 YEESISDSKAQFQAIVLIISTLQRTRSLPEENYETLATKLALYASKLLKKPDQCRAVYLCSHLFWAtelpstgefyrdgk 689
                         730
                  ....*....|....*
gi 159463622  654 -VVATLQRAAKVAGQ 667
Cdd:pfam03635 690 rVLECLQKALRIADS 704
 
Name Accession Description Interval E-value
Vps35 pfam03635
Vacuolar protein sorting-associated protein 35; Vacuolar protein sorting-associated protein ...
14-667 0e+00

Vacuolar protein sorting-associated protein 35; Vacuolar protein sorting-associated protein (Vps) 35 is one of around 50 proteins involved in protein trafficking. In particular, Vps35 assembles into a retromer complex with at least four other proteins Vps5, Vps17, Vps26 and Vps29. Vps35 contains a central region of weaker sequence similarity, thought to indicate the presence of at least three domains.


Pssm-ID: 252074  Cd Length: 749  Bit Score: 611.57  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622   14 RILQDASTVIKRNAFHMRKAIEEDNMRDSLKHAAAMLGELRTSQLQPQKYYELYMLAFDQLSYLESFFADERGKGRAYSE 93
Cdd:pfam03635   1 KLLEEAIAVVKQQSFLMKRCLDQGKLMDALKHASNMLSELRTSSLSPKQYYELYMKVFDELQYLSTYLVDEHPKGHHLAD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622   94 LYELVQHAGNVLPRLYLMVAVGCLYIKSHEASPRDVLKDLVEMCKGVQHPTRGLFLRAYLCQRAKGLLPDTGSEFEGPaA 173
Cdd:pfam03635  81 LYELVQYAGNIVPRLYLLITVGSVYIKSKDAPAKEILKDMVEMCRGVQHPTRGLFLRYYLSQRTKDKLPDTGSYEEGG-G 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  174 GSIHDALDFLMTNFIEMNKLWVRLQHQGSARDKEKRERERQQLQDLVGKNLTYLSQLDGLSFELYRDQVLPRVLDQITSC 253
Cdd:pfam03635 160 GTVQDSIEFLLTNFIEMNKLWVRLQHQGPSREREKREKERKELRILVGSNLVRLSQLEGVDLEMYKETILPRILEQVVNC 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  254 KDDLAQLYLMQALIQGFPDRFHLGTLESLLGVLPQLQPGVKVRawlgprvhSVMAALMDRLARYASNASASAAGGGDPRV 333
Cdd:pfam03635 240 RDVLAQEYLLEVIIQVFPDEFHLATLDTLLSACLQLNPGVDVK--------KILITLMDRLAAYAERSNEGVAEVESRKE 311
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  334 LEELAA--IDAFSKFK---AAIAQVCPSIPLRG------------------------------------WGNGKEAEGSW 372
Cdd:pfam03635 312 EELEAPedVDLFEVFWnqlVKLIKARPDLPLQDiiallvsllnltlkcypdrldyvdqvlgfavekvsnYLGAKLNSSEI 391
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  373 GR-------------YGVDVALGLKEYPPLTRLLRYPTHKELAVKIVQRVRERGSsglgrgaargvraggcVISDVSKVK 439
Cdd:pfam03635 392 EQeivrlllapistyKNILTALELPNYQPLLSSLDYSTRKSVALAIIDNILKNNT----------------LITTLDDVE 455
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  440 MLFRFIAPLVAD-PDVPGEAGGAAdlddEDLDEEQVLVARLLHHLRSDDPDTHFTILSVAHDQLLAGGPRRLRTTLPSLV 518
Cdd:pfam03635 456 RLFELISPLIKDqPDQPSDELDET----EEFAEEQEKVARLIHLIRSDDVEKQFKILNTVRKHLGKGGPERIRYTLPTLV 531
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  519 FCGLALHRRL-----------LTSEQLLQFLLAAIGPLYgGPAGQPVTALRLLLAAGYVASeEARLELLAYTFFEEAIAL 587
Cdd:pfam03635 532 FAALRLARRLksqekkddkwdAKIKKIFKFIHSTISILY-NVAPAAELALKLYLQCAIVAD-QCGLEEIAYEFFTQAFTI 609
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159463622  588 YDEALPDQRSRATGLFDIIGGLQRCRVFGSEHRDALTAAATAGCMRLVARREQCRALCAAAWLWWQ-------------- 653
Cdd:pfam03635 610 YEESISDSKAQFQAIVLIISTLQRTRSLPEENYETLATKLALYASKLLKKPDQCRAVYLCSHLFWAtelpstgefyrdgk 689
                         730
                  ....*....|....*
gi 159463622  654 -VVATLQRAAKVAGQ 667
Cdd:pfam03635 690 rVLECLQKALRIADS 704
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH