NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|15926802|ref|NP_374335|]
View 

hypothetical protein SA1062 [Staphylococcus aureus subsp. aureus N315]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
6-239 2.39e-60

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


:

Pssm-ID: 238083  Cd Length: 254  Bit Score: 192.93  E-value: 2.39e-60
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802   6 FFTDTGQHRDKNEDAGGIFYNQTNQQ--LLVLCDGMGGHKAGEVASKFVTDELKSRFEAENLIEEHQAENWLRNNIKDIN 83
Cdd:cd00143   4 GVSDKGGDRKTNEDAVVIKPNLNNEDggLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDIEEALRKAFLRAD 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802  84 FQLYHYAQENAEYKGMGTTCVCALVFEKSVVIANVGDSRAYVINSRQIEQITSDHSFVNhLVLTGQITPEEAFT----HP 159
Cdd:cd00143  84 EEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVN-EEERERIEKAGGRVsngrVP 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802 160 QRNIITKVMGtDKR------VSPDLFI-KRLNFYDYLLLNSDGLTDYVKDNEIKRLLVKEGTIED---HGDQLMQLALDN 229
Cdd:cd00143 163 GVLAVTRALG-DFDlkpgvsAEPDVTVvKLTEDDDFLILASDGLWDVLSNQEAVDIVRSELAKEDlqeAAQELVDLALRR 241
                       250
                ....*....|
gi 15926802 230 HSKDNVTFIL 239
Cdd:cd00143 242 GSHDNITVVV 251
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
6-239 2.39e-60

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 192.93  E-value: 2.39e-60
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802   6 FFTDTGQHRDKNEDAGGIFYNQTNQQ--LLVLCDGMGGHKAGEVASKFVTDELKSRFEAENLIEEHQAENWLRNNIKDIN 83
Cdd:cd00143   4 GVSDKGGDRKTNEDAVVIKPNLNNEDggLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDIEEALRKAFLRAD 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802  84 FQLYHYAQENAEYKGMGTTCVCALVFEKSVVIANVGDSRAYVINSRQIEQITSDHSFVNhLVLTGQITPEEAFT----HP 159
Cdd:cd00143  84 EEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVN-EEERERIEKAGGRVsngrVP 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802 160 QRNIITKVMGtDKR------VSPDLFI-KRLNFYDYLLLNSDGLTDYVKDNEIKRLLVKEGTIED---HGDQLMQLALDN 229
Cdd:cd00143 163 GVLAVTRALG-DFDlkpgvsAEPDVTVvKLTEDDDFLILASDGLWDVLSNQEAVDIVRSELAKEDlqeAAQELVDLALRR 241
                       250
                ....*....|
gi 15926802 230 HSKDNVTFIL 239
Cdd:cd00143 242 GSHDNITVVV 251
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
1-246 1.58e-90

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 270.77  E-value: 1.58e-90
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802   1 MLEAQFFTDTGQHRDKNEDAGGIFYNQTNQQ--LLVLCDGMGGHKAGEVASKFVTDELKSRFEAENLIEEHQA-ENWLRN 77
Cdd:COG0631   7 SLKVAGLSDVGTVRKHNEDAFLIKPNENGNLllLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSLNESlEELLKE 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802  78 NIKDINFQLYHYAQENAEYKGMGTTCVCALVFEKSVVIANVGDSRAYVINSRQIEQITSDHSFVNHLVLTGQITPEEAFT 157
Cdd:COG0631  87 AILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEEARS 166
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802 158 HPQRNIITKVMGTDKRVSPDLFIKRLNFYDYLLLNSDGLTDYVKDNEIKRLLVKEGTIEDHGDQLMQLALDNHSKDNVTF 237
Cdd:COG0631 167 HPRRNALTRALGDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILKNSETPQEAADKLIELALEGGGPDNITV 246

                ....*....
gi 15926802 238 ILAAIEGDK 246
Cdd:COG0631 247 VLVRLNGEG 255
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
7-239 4.53e-36

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 129.42  E-value: 4.53e-36
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802      7 FTDTGQHRDKNEDAGGIFYNQTNQQLLV-LCDGMGGHKAGEVASKFVTDELKSRFEAENlIEEHQAENWLRNNIKDINFQ 85
Cdd:smart00332  13 LSSMQGVRKPMEDAHVITPDLSDSGGFFgVFDGHGGSEAAKFLSKNLPEILAEELIKEK-DELEDVEEALRKAFLSTDEE 91
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802     86 LYHYAQEnaeykGMGTTCVCALVFEKSVVIANVGDSRAYVINSRQIEQITSDHSfVNHLVLTGQITPEEAFTHPQRNI-- 163
Cdd:smart00332  92 ILEELEA-----LSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHK-PSNEDERARIEAAGGFVINGRVNgv 165
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802    164 --ITKVMG---TDKRVSPDLFIKRLNFY---DYLLLNSDGLTDYVKDNEIKRLL--VKEGTIEDHGDQLMQLALDNHSKD 233
Cdd:smart00332 166 laLSRAIGdffLKPYVSAEPDVTVVELTekdDFLILASDGLWDVLSNQEVVDIVrkHLSKDPKEAAKRLIDLALARGSKD 245

                   ....*.
gi 15926802    234 NVTFIL 239
Cdd:smart00332 246 NITVVV 251
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
14-235 4.57e-19

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 82.41  E-value: 4.57e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802    14 RDKNEDAGGIFYNQTNQQ------LLVLCDGMGGHKAGEVASKFVTDELKSRFEAENLIEEhqaENWLRNNIKDINFQLY 87
Cdd:pfam00481  12 RKSMEDAHIDGKNLNSSSgkdswsFFAVFDGHGGSEAAKYAGKHLHTILALRRSFLTLRKL---EDALRESFLETDEELR 88
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802    88 HYAQeNAEYKGMGTTCVCALVFEKSVVIANVGDSRAYVINSRQ-IEQITSDHSfVNHLVLTGQITPEEAFtHPQRNIITK 166
Cdd:pfam00481  89 SDAA-NHEDLSSGSTAVVALIRGNKLYVANVGDSRAVLCRNGGaIKQLTEDHK-PSDEDERRRIRAAGGF-VSRNGRVNG 165
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802   167 VMGTDKRVSpDLFIKRLNFY----------------DYLLLNSDGLTDYVKDNE----IKRLLVKEGTIEDHGDQLMQLA 226
Cdd:pfam00481 166 VLAVSRAFG-DFDLKPGEQPvsaepditshkiteddEFLILACDGLWDVLSDQEvvdiVRSNLSDGGDPMEAAEKLVDEA 244

                  ....*....
gi 15926802   227 LDNHSKDNV 235
Cdd:pfam00481 245 IAYGSEDNI 253
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
2-239 3.35e-35

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 132.10  E-value: 3.35e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802    2 LEAQFFTDTGQHRDKNEDAGGIFYNQTNQQ-----------LLVLCDGMGGHKAGEVASKFVTDELKSRFeAENLIEEHQ 70
Cdd:PRK14559 375 LEDAGRTDVGRQRHHNEDYFGINTRIQKLEnphgrivqargLYILCDGMGGHAAGEVASALAVETLQQYF-QQHWQDELP 453
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802   71 AENWLRNNIKDINFQLYHYAQENAEYkG---MGTTCVCALVFEKSVVIANVGDSRAYVINSRQ-IEQITSDHSFVNHLVL 146
Cdd:PRK14559 454 DEETIREAIYLANEAIYDLNQQNARS-GsgrMGTTLVMALVQDTQVAVAHVGDSRLYRVTRKGgLEQLTVDHEVGQREIQ 532
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802  147 TGqITPEEAFTHPQRNIITKVMG--TDKRVSPDLFIKRLNFYDYLLLNSDGLTD--YVKDNEIKRL--LVKEGTIEDHG- 219
Cdd:PRK14559 533 RG-VEPQIAYARPDAYQLTQALGprDNSAIQPDIQFLEIEEDTLLLLCSDGLSDndLLETHWQTHLlpLLSSSANLDQGl 611
                        250       260
                 ....*....|....*....|
gi 15926802  220 DQLMQLALDNHSKDNVTFIL 239
Cdd:PRK14559 612 NKLIDLANQYNGHDNITAIL 631
PLN03145 PLN03145
Protein phosphatase 2c; Provisional
100-239 1.68e-04

Protein phosphatase 2c; Provisional


Pssm-ID: 215603 [Multi-domain]  Cd Length: 365  Bit Score: 40.67  E-value: 1.68e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802  100 GTTCVCALVFEKSVVIANVGDSRAYVINSRQIEQITSDHS---------------FVNHLVLTGQITPEEAFTHPQRNII 164
Cdd:PLN03145 167 GTTALAALVVGRSLVVANAGDCRAVLCRRGKAIEMSRDHKpmcskerkrieasggYVYDGYLNGQLNVARALGDWHMEGM 246
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802  165 TKVMGTDKRVSPDLFIKRLNFYD-YLLLNSDGLTD-YVKDNEI----KRLlvkegtiEDHGD------QLMQLALDNHSK 232
Cdd:PLN03145 247 KGSDGGPLSAEPELMTTQLTEEDeFLIIGCDGIWDvFRSQNAVdfarRRL-------QEHNDpvmcskELVDEALKRKSG 319

                 ....*..
gi 15926802  233 DNVTFIL 239
Cdd:PLN03145 320 DNLAVVV 326
PTZ00224 PTZ00224
protein phosphatase 2C; Provisional
13-138 5.16e-04

protein phosphatase 2C; Provisional


Pssm-ID: 240318 [Multi-domain]  Cd Length: 381  Bit Score: 39.37  E-value: 5.16e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802   13 HRDKNEDAggifynqtnqQLLVLCDGMG------GHKAGEvASKFVTDELKSRFEAENliEEHQAENwlrnnIKDINFQL 86
Cdd:PTZ00224  32 YRESMEDA----------HLLYLTDDWGffgvfdGHVNDE-CSQYLARAWPQALEKEP--EPMTDER-----MEELCLEI 93
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|...
gi 15926802   87 -YHYAQENAEYKGMGTTCVcaLVFEKSVVIANVGDSRAYVINSRQIEQITSDH 138
Cdd:PTZ00224  94 dEEWMDSGREGGSTGTFCV--IMKDVHLQVGNVGDSRVLVCRDGKLVFATEDH 144
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
6-239 2.39e-60

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 192.93  E-value: 2.39e-60
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802   6 FFTDTGQHRDKNEDAGGIFYNQTNQQ--LLVLCDGMGGHKAGEVASKFVTDELKSRFEAENLIEEHQAENWLRNNIKDIN 83
Cdd:cd00143   4 GVSDKGGDRKTNEDAVVIKPNLNNEDggLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDIEEALRKAFLRAD 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802  84 FQLYHYAQENAEYKGMGTTCVCALVFEKSVVIANVGDSRAYVINSRQIEQITSDHSFVNhLVLTGQITPEEAFT----HP 159
Cdd:cd00143  84 EEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVN-EEERERIEKAGGRVsngrVP 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802 160 QRNIITKVMGtDKR------VSPDLFI-KRLNFYDYLLLNSDGLTDYVKDNEIKRLLVKEGTIED---HGDQLMQLALDN 229
Cdd:cd00143 163 GVLAVTRALG-DFDlkpgvsAEPDVTVvKLTEDDDFLILASDGLWDVLSNQEAVDIVRSELAKEDlqeAAQELVDLALRR 241
                       250
                ....*....|
gi 15926802 230 HSKDNVTFIL 239
Cdd:cd00143 242 GSHDNITVVV 251
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
1-246 1.58e-90

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 270.77  E-value: 1.58e-90
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802   1 MLEAQFFTDTGQHRDKNEDAGGIFYNQTNQQ--LLVLCDGMGGHKAGEVASKFVTDELKSRFEAENLIEEHQA-ENWLRN 77
Cdd:COG0631   7 SLKVAGLSDVGTVRKHNEDAFLIKPNENGNLllLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSLNESlEELLKE 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802  78 NIKDINFQLYHYAQENAEYKGMGTTCVCALVFEKSVVIANVGDSRAYVINSRQIEQITSDHSFVNHLVLTGQITPEEAFT 157
Cdd:COG0631  87 AILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEEARS 166
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802 158 HPQRNIITKVMGTDKRVSPDLFIKRLNFYDYLLLNSDGLTDYVKDNEIKRLLVKEGTIEDHGDQLMQLALDNHSKDNVTF 237
Cdd:COG0631 167 HPRRNALTRALGDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILKNSETPQEAADKLIELALEGGGPDNITV 246

                ....*....
gi 15926802 238 ILAAIEGDK 246
Cdd:COG0631 247 VLVRLNGEG 255
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
7-239 4.53e-36

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 129.42  E-value: 4.53e-36
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802      7 FTDTGQHRDKNEDAGGIFYNQTNQQLLV-LCDGMGGHKAGEVASKFVTDELKSRFEAENlIEEHQAENWLRNNIKDINFQ 85
Cdd:smart00332  13 LSSMQGVRKPMEDAHVITPDLSDSGGFFgVFDGHGGSEAAKFLSKNLPEILAEELIKEK-DELEDVEEALRKAFLSTDEE 91
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802     86 LYHYAQEnaeykGMGTTCVCALVFEKSVVIANVGDSRAYVINSRQIEQITSDHSfVNHLVLTGQITPEEAFTHPQRNI-- 163
Cdd:smart00332  92 ILEELEA-----LSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHK-PSNEDERARIEAAGGFVINGRVNgv 165
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802    164 --ITKVMG---TDKRVSPDLFIKRLNFY---DYLLLNSDGLTDYVKDNEIKRLL--VKEGTIEDHGDQLMQLALDNHSKD 233
Cdd:smart00332 166 laLSRAIGdffLKPYVSAEPDVTVVELTekdDFLILASDGLWDVLSNQEVVDIVrkHLSKDPKEAAKRLIDLALARGSKD 245

                   ....*.
gi 15926802    234 NVTFIL 239
Cdd:smart00332 246 NITVVV 251
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
14-235 4.57e-19

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 82.41  E-value: 4.57e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802    14 RDKNEDAGGIFYNQTNQQ------LLVLCDGMGGHKAGEVASKFVTDELKSRFEAENLIEEhqaENWLRNNIKDINFQLY 87
Cdd:pfam00481  12 RKSMEDAHIDGKNLNSSSgkdswsFFAVFDGHGGSEAAKYAGKHLHTILALRRSFLTLRKL---EDALRESFLETDEELR 88
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802    88 HYAQeNAEYKGMGTTCVCALVFEKSVVIANVGDSRAYVINSRQ-IEQITSDHSfVNHLVLTGQITPEEAFtHPQRNIITK 166
Cdd:pfam00481  89 SDAA-NHEDLSSGSTAVVALIRGNKLYVANVGDSRAVLCRNGGaIKQLTEDHK-PSDEDERRRIRAAGGF-VSRNGRVNG 165
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802   167 VMGTDKRVSpDLFIKRLNFY----------------DYLLLNSDGLTDYVKDNE----IKRLLVKEGTIEDHGDQLMQLA 226
Cdd:pfam00481 166 VLAVSRAFG-DFDLKPGEQPvsaepditshkiteddEFLILACDGLWDVLSDQEvvdiVRSNLSDGGDPMEAAEKLVDEA 244

                  ....*....
gi 15926802   227 LDNHSKDNV 235
Cdd:pfam00481 245 IAYGSEDNI 253
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
13-204 4.22e-15

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 70.42  E-value: 4.22e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802    13 HRDK---NEDAGGIFYNQtNQQLLVLCDGMGGHKAGEVASKFVTDELKSRFEAENLIEEHQAENWLRNNIK-DINFQLY- 87
Cdd:pfam13672   5 HIRRglpCQDAFAYRVLS-DGWLIAVADGAGSAKYSDVGARLAVEAAVEALRELLDSGELPELEALVRQILnDILALVRq 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802    88 HYAQENAEYKGMGTTCVCALVFEKSVVIANVGDSRAYVINS-RQIEQITSDHS--FVNHlvlTGQITPEEAFTHPQRNII 164
Cdd:pfam13672  84 EAAAQGLEPRDYATTLLLAVITPGGIVFFQIGDGAIVVRDRdGELQLLSEPDSgeYANE---TTFLTSPDALEEFRIRRL 160
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 15926802   165 TkvmgtdkrvspdlfikrLNFYDYLLLNSDGLTDYVKDNE 204
Cdd:pfam13672 161 T-----------------LEPGDALALMTDGLSDSLVTEE 183
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
8-209 3.93e-12

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 61.60  E-value: 3.93e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802      8 TDTGQHRDKNEDA---GGIFYN--QTN--QQLLVLCDGMGGHKAGEVASKFVTDELKsrfeaenliEEHQAENWLRNNIK 80
Cdd:smart00331   1 DDGGLIAQYYEDAtqvGGDFYDvvKLPegRLLIAIADVMGKGLAAALAMSMARSALR---------TLLSEGISLSQILE 71
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802     81 DINfqLYHYAQENaeyKGMGTTCVCALVF--EKSVVIANVGDSRAYVINSRQIEQITSDHSfvnhlvltgqitpeeafth 158
Cdd:smart00331  72 RLN--RAIYENGE---DGMFATLFLALYDfaGGTLSYANAGHSPPYLLRADGGLVEDLDDL------------------- 127
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|.
gi 15926802    159 pqrniiTKVMGTDKRVSPDLFIKRLNFYDYLLLNSDGLTDYVKDNEIKRLL 209
Cdd:smart00331 128 ------GAPLGLEPDVEVDVRELTLEPGDLLLLYTDGLTEARNPERLEELL 172
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
2-239 3.35e-35

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 132.10  E-value: 3.35e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802    2 LEAQFFTDTGQHRDKNEDAGGIFYNQTNQQ-----------LLVLCDGMGGHKAGEVASKFVTDELKSRFeAENLIEEHQ 70
Cdd:PRK14559 375 LEDAGRTDVGRQRHHNEDYFGINTRIQKLEnphgrivqargLYILCDGMGGHAAGEVASALAVETLQQYF-QQHWQDELP 453
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802   71 AENWLRNNIKDINFQLYHYAQENAEYkG---MGTTCVCALVFEKSVVIANVGDSRAYVINSRQ-IEQITSDHSFVNHLVL 146
Cdd:PRK14559 454 DEETIREAIYLANEAIYDLNQQNARS-GsgrMGTTLVMALVQDTQVAVAHVGDSRLYRVTRKGgLEQLTVDHEVGQREIQ 532
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802  147 TGqITPEEAFTHPQRNIITKVMG--TDKRVSPDLFIKRLNFYDYLLLNSDGLTD--YVKDNEIKRL--LVKEGTIEDHG- 219
Cdd:PRK14559 533 RG-VEPQIAYARPDAYQLTQALGprDNSAIQPDIQFLEIEEDTLLLLCSDGLSDndLLETHWQTHLlpLLSSSANLDQGl 611
                        250       260
                 ....*....|....*....|
gi 15926802  220 DQLMQLALDNHSKDNVTFIL 239
Cdd:PRK14559 612 NKLIDLANQYNGHDNITAIL 631
PLN03145 PLN03145
Protein phosphatase 2c; Provisional
100-239 1.68e-04

Protein phosphatase 2c; Provisional


Pssm-ID: 215603 [Multi-domain]  Cd Length: 365  Bit Score: 40.67  E-value: 1.68e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802  100 GTTCVCALVFEKSVVIANVGDSRAYVINSRQIEQITSDHS---------------FVNHLVLTGQITPEEAFTHPQRNII 164
Cdd:PLN03145 167 GTTALAALVVGRSLVVANAGDCRAVLCRRGKAIEMSRDHKpmcskerkrieasggYVYDGYLNGQLNVARALGDWHMEGM 246
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802  165 TKVMGTDKRVSPDLFIKRLNFYD-YLLLNSDGLTD-YVKDNEI----KRLlvkegtiEDHGD------QLMQLALDNHSK 232
Cdd:PLN03145 247 KGSDGGPLSAEPELMTTQLTEEDeFLIIGCDGIWDvFRSQNAVdfarRRL-------QEHNDpvmcskELVDEALKRKSG 319

                 ....*..
gi 15926802  233 DNVTFIL 239
Cdd:PLN03145 320 DNLAVVV 326
PTZ00224 PTZ00224
protein phosphatase 2C; Provisional
13-138 5.16e-04

protein phosphatase 2C; Provisional


Pssm-ID: 240318 [Multi-domain]  Cd Length: 381  Bit Score: 39.37  E-value: 5.16e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15926802   13 HRDKNEDAggifynqtnqQLLVLCDGMG------GHKAGEvASKFVTDELKSRFEAENliEEHQAENwlrnnIKDINFQL 86
Cdd:PTZ00224  32 YRESMEDA----------HLLYLTDDWGffgvfdGHVNDE-CSQYLARAWPQALEKEP--EPMTDER-----MEELCLEI 93
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|...
gi 15926802   87 -YHYAQENAEYKGMGTTCVcaLVFEKSVVIANVGDSRAYVINSRQIEQITSDH 138
Cdd:PTZ00224  94 dEEWMDSGREGGSTGTFCV--IMKDVHLQVGNVGDSRVLVCRDGKLVFATEDH 144
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH