NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|15896748|ref|NP_350097|]
View 

methyl-accepting chemotaxis protein [Clostridium acetobutylicum ATCC 824]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
4HB_MCP_1 pfam12729
Four helix bundle sensory module for signal transduction; This family is a four helix bundle ...
7-186 8.10e-34

Four helix bundle sensory module for signal transduction; This family is a four helix bundle that operates as a ubiquitous sensory module in prokaryotic signal-transduction. The 4HB_MCP is always found between two predicted transmembrane helices indicating that it detects only extracellular signals. In many cases the domain is associated with a cytoplasmic HAMP domain suggesting that most proteins carrying the bundle might share the mechanism of transmembrane signalling which is well-characterized in E coli chemoreceptors.


:

Pssm-ID: 193205  Cd Length: 181  Bit Score: 126.57  E-value: 8.10e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748     7 NLKVVHKLILCFGIIITVIIMNGIMSYEKMTQVNDNINTIYSESLMKLSITKDIRAHMADLTSGSLILVNPDRKSIVDKT 86
Cdd:pfam12729   1 NLKIRTKLILLFLLLALLLIIVGIVGLYSLKKINKNSETMYEDRLLPIKWLGEIRSNLREIRANLLELILTTDPAERDEL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748    87 ISDMNGLIEKDNELTQKYESLINDEKDKKIFTQYLENLNGYNNAKDKFFETARTGDYN-AIKNQFSIFDGYRAKINDLLD 165
Cdd:pfam12729  81 LKDIEELRAEIDKLLKKYEKTILTEEEKKLFNEFKEQLKAYRKVRNKVLDLAKAGKNDeAYALYLTELEPARDAVIEALD 160
                         170       180
                  ....*....|....*....|.
gi 15896748   166 EEITYNQKVAKSKYEDSQKQY 186
Cdd:pfam12729 161 ELIDYNLKVAKEAYEDNKASY 181
MCP_signal super family cl21547
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
314-521 2.52e-32

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


The actual alignment was detected with superfamily member cd11386:

Pssm-ID: 206779  Cd Length: 200  Bit Score: 123.12  E-value: 2.52e-32
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 314 EQITASIEEINSAVNELTQRALMARNVASEARGNAENVQEKGKIAADTTESLykekrETIIKAIEEgkIVNKIKDMAAAI 393
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEA-----VSAVEELEE--SSAEIGEIVEVI 73
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 394 ESIADQTNLLALNAAIEAARAGENGKGFAVVADEVRKLAEQSKTEVNNINENIGKIDEAfgnISAGSNDIlvfinEKVIP 473
Cdd:cd11386  74 DDIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQ---TEEAVEAM-----EETSE 145
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*...
gi 15896748 474 EFNGFVKGGDYYYRDANYINKLSEELASTLEEFSATIGQISEAAQNVA 521
Cdd:cd11386 146 EVEEGVELVEETGRAFEEIVASVEEVADGIQEISAATQEQSASTQEIA 193
HAMP pfam00672
HAMP domain;
194-260 2.09e-05

HAMP domain;


:

Pssm-ID: 250044  Cd Length: 70  Bit Score: 42.60  E-value: 2.09e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 15896748   194 IMLTIVAIGVSVIFSYLLIKNINDALKKIKQFAGRNAKYDFSSSINIASKDEFGETSVSLNEAQSNV 260
Cdd:pfam00672   2 LLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVPVSGPDEIGELARAFNQMADRL 68
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
145-570 2.89e-49

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


:

Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 176.72  E-value: 2.89e-49
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 145 AIKNQFSIFDGYRAKINDL--LDEEITYNQKVAKSKYEDSQKQYKKALFITImltIVAIGVSVIFSYLLIKNINDALKKI 222
Cdd:COG0840  15 AAGEADAGLLKLKKLIDELgkLLLSLNLILDDAASAEAAALKAVLKFLLISL---LVAIIVVLVLAILLLRAILEPISDL 91
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 223 KQFAGRNAKYDFSSSINIASKDEFGETSVSLNEAQSNVVNLLKNISDSSDELKSDSEELSLTSNELVSkmedmntackti 302
Cdd:COG0840  92 LEVVERIAAGDLTKRIDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSA------------ 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 303 kvAIEENSAASEQITASIEEINSAVNELTQRALMARNVASEARGNAENVQEKGKIAADTTESLYKEKRETIIKAIEEgki 382
Cdd:COG0840 160 --RADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVKKLSES--- 234
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 383 VNKIKDMAAAIESIADQTNLLALNAAIEAARAGENGKGFAVVADEVRKLAEQSKTEVNNINENIGKIDEAFGNISAGSND 462
Cdd:COG0840 235 SQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEAADAVEHMEE 314
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 463 ILVFINEKVipefngfvkggdyyyRDANYINKLSEELASTLEEFSATIGQISEAAQNVALNEQKSSEKVAAVGNIVNDTT 542
Cdd:COG0840 315 SASEVSEGV---------------KLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENA 379
                       410       420
                ....*....|....*....|....*...
gi 15896748 543 KVALNVSKTSQNQAELSEELYVIVGKFK 570
Cdd:COG0840 380 AAVEELAAASEELKELAEKLLELVAKFK 407
 
Name Accession Description Interval E-value
4HB_MCP_1 pfam12729
Four helix bundle sensory module for signal transduction; This family is a four helix bundle ...
7-186 8.10e-34

Four helix bundle sensory module for signal transduction; This family is a four helix bundle that operates as a ubiquitous sensory module in prokaryotic signal-transduction. The 4HB_MCP is always found between two predicted transmembrane helices indicating that it detects only extracellular signals. In many cases the domain is associated with a cytoplasmic HAMP domain suggesting that most proteins carrying the bundle might share the mechanism of transmembrane signalling which is well-characterized in E coli chemoreceptors.


Pssm-ID: 193205  Cd Length: 181  Bit Score: 126.57  E-value: 8.10e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748     7 NLKVVHKLILCFGIIITVIIMNGIMSYEKMTQVNDNINTIYSESLMKLSITKDIRAHMADLTSGSLILVNPDRKSIVDKT 86
Cdd:pfam12729   1 NLKIRTKLILLFLLLALLLIIVGIVGLYSLKKINKNSETMYEDRLLPIKWLGEIRSNLREIRANLLELILTTDPAERDEL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748    87 ISDMNGLIEKDNELTQKYESLINDEKDKKIFTQYLENLNGYNNAKDKFFETARTGDYN-AIKNQFSIFDGYRAKINDLLD 165
Cdd:pfam12729  81 LKDIEELRAEIDKLLKKYEKTILTEEEKKLFNEFKEQLKAYRKVRNKVLDLAKAGKNDeAYALYLTELEPARDAVIEALD 160
                         170       180
                  ....*....|....*....|.
gi 15896748   166 EEITYNQKVAKSKYEDSQKQY 186
Cdd:pfam12729 161 ELIDYNLKVAKEAYEDNKASY 181
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
314-521 2.52e-32

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 123.12  E-value: 2.52e-32
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 314 EQITASIEEINSAVNELTQRALMARNVASEARGNAENVQEKGKIAADTTESLykekrETIIKAIEEgkIVNKIKDMAAAI 393
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEA-----VSAVEELEE--SSAEIGEIVEVI 73
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 394 ESIADQTNLLALNAAIEAARAGENGKGFAVVADEVRKLAEQSKTEVNNINENIGKIDEAfgnISAGSNDIlvfinEKVIP 473
Cdd:cd11386  74 DDIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQ---TEEAVEAM-----EETSE 145
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*...
gi 15896748 474 EFNGFVKGGDYYYRDANYINKLSEELASTLEEFSATIGQISEAAQNVA 521
Cdd:cd11386 146 EVEEGVELVEETGRAFEEIVASVEEVADGIQEISAATQEQSASTQEIA 193
HAMP pfam00672
HAMP domain;
194-260 2.09e-05

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 42.60  E-value: 2.09e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 15896748   194 IMLTIVAIGVSVIFSYLLIKNINDALKKIKQFAGRNAKYDFSSSINIASKDEFGETSVSLNEAQSNV 260
Cdd:pfam00672   2 LLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVPVSGPDEIGELARAFNQMADRL 68
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
145-570 2.89e-49

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 176.72  E-value: 2.89e-49
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 145 AIKNQFSIFDGYRAKINDL--LDEEITYNQKVAKSKYEDSQKQYKKALFITImltIVAIGVSVIFSYLLIKNINDALKKI 222
Cdd:COG0840  15 AAGEADAGLLKLKKLIDELgkLLLSLNLILDDAASAEAAALKAVLKFLLISL---LVAIIVVLVLAILLLRAILEPISDL 91
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 223 KQFAGRNAKYDFSSSINIASKDEFGETSVSLNEAQSNVVNLLKNISDSSDELKSDSEELSLTSNELVSkmedmntackti 302
Cdd:COG0840  92 LEVVERIAAGDLTKRIDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSA------------ 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 303 kvAIEENSAASEQITASIEEINSAVNELTQRALMARNVASEARGNAENVQEKGKIAADTTESLYKEKRETIIKAIEEgki 382
Cdd:COG0840 160 --RADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVKKLSES--- 234
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 383 VNKIKDMAAAIESIADQTNLLALNAAIEAARAGENGKGFAVVADEVRKLAEQSKTEVNNINENIGKIDEAFGNISAGSND 462
Cdd:COG0840 235 SQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEAADAVEHMEE 314
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 463 ILVFINEKVipefngfvkggdyyyRDANYINKLSEELASTLEEFSATIGQISEAAQNVALNEQKSSEKVAAVGNIVNDTT 542
Cdd:COG0840 315 SASEVSEGV---------------KLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENA 379
                       410       420
                ....*....|....*....|....*...
gi 15896748 543 KVALNVSKTSQNQAELSEELYVIVGKFK 570
Cdd:COG0840 380 AAVEELAAASEELKELAEKLLELVAKFK 407
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
266-570 6.52e-37

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 137.42  E-value: 6.52e-37
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748    266 NISDSSDELKSDSEELSLTSNELVSKMEDMntacktikvaieenSAASEQITASIEEINSAVNELTQRALMARNVASEAR 345
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEEL--------------SASIEEVAANADEIAATAQSAAEAAEEGREAVEDAI 66
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748    346 GNAENVQEKGKIAADTteslykekretiIKAIEEGkiVNKIKDMAAAIESIADQTNLLALNAAIEAARAGENGKGFAVVA 425
Cdd:smart00283  67 TAMDQIREVVEEAVSA------------VEELEES--SDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVA 132
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748    426 DEVRKLAEQSKTEVNNINENIGKIDEAfgniSAGSNDILVFINEKVipefngfvkggdyyyrdaNYINKLSEELASTLEE 505
Cdd:smart00283 133 DEVRKLAERSAESAKEIESLIKEIQEE----TNEAVAAMEESSSEV------------------EEGVELVEETGDALEE 190
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 15896748    506 FSATIGQISEAAQNV--ALNEQKSS--EKVAAVGNI---VNDTTKVALNVSKTSQNQAELSEELYVIVGKFK 570
Cdd:smart00283 191 IVDSVEEIADLVQEIaaATDEQAAGseEVNAAIDEIaqvTQETAAMSEEISAAAEELSGLAEELDELVERFK 262
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
133-549 1.51e-30

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 124.35  E-value: 1.51e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  133 KFFETARTGDYNAIKNQfsifdGYRAKINDLLDEEITYNQKVAKSKYEDSQKQYKKALF----ITIMLTIVAIGVSVIFS 208
Cdd:PRK15048 139 DYLDYGNTGAYFAQPTQ-----GMQNAMGEAFAQYALSSEKLYRDIVTDNADDYRFAQWqlavIALVVVLILLVAWYGIR 213
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  209 YLLIKNINDALKKIKQFAGRNakydFSSSINIASKDEFGETSVSLNEAQSNVVNLLKNISDSSDELKSDSEELSLTSNEL 288
Cdd:PRK15048 214 RMLLTPLAKIIAHIREIAGGN----LANTLTIDGRSEMGDLAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDL 289
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  289 VSKMEDMNTAcktikvaIEENSAASEQITASIEeinsavneltQRALMARNVASEARGNAENVQEKGKIAADTTESLYke 368
Cdd:PRK15048 290 SSRTEQQASA-------LEETAASMEQLTATVK----------QNADNARQASQLAQSASDTAQHGGKVVDGVVKTMH-- 350
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  369 kretiikaiEEGKIVNKIKDMAAAIESIADQTNLLALNAAIEAARAGENGKGFAVVADEVRKLAEQSKTEVNNINeniGK 448
Cdd:PRK15048 351 ---------EIADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIK---AL 418
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  449 IDEAFGNISAGSndilvfinekVIPEfngfvKGGDYYYRDANYINKLSE---ELASTLEEFSATIGQISEAAQNV-ALNE 524
Cdd:PRK15048 419 IEDSVSRVDTGS----------VLVE-----SAGETMNNIVNAVTRVTDimgEIASASDEQSRGIDQVALAVSEMdRVTQ 483
                        410       420
                 ....*....|....*....|....*...
gi 15896748  525 QKSS---EKVAAVGNIVNDTTKVALNVS 549
Cdd:PRK15048 484 QNASlvqESAAAAAALEEQASRLTQAVS 511
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
385-572 1.99e-23

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 98.29  E-value: 1.99e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748   385 KIKDMAAAIESIADQTNLLALNAAIEAARAGENGKGFAVVADEVRKLAEQSKTEVNNINENIGKideafgnISAGSNDIL 464
Cdd:pfam00015  41 KISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAAKEIEALIEE-------IVKQTNDST 113
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748   465 VFINEKVIPEFNGFVKGGDyYYRDANYINKLSEELASTLEEFSATIGQISEAAQNVALNeqkssekVAAVGNIVNDTTKV 544
Cdd:pfam00015 114 ASIQQTRTEVEVGSTIVES-TGEALKEIVDAVAEIADIVQEIAAASDEQSAGIDQVNQA-------VARIDQVTQQNAAL 185
                         170       180
                  ....*....|....*....|....*...
gi 15896748   545 ALNVSKTSQNQAELSEELYVIVGKFKME 572
Cdd:pfam00015 186 VEESAAAAETLEEQAEELTASVAQFRIK 213
PTZ00121 PTZ00121
MAEBL; Provisional
271-469 8.71e-05

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 44.36  E-value: 8.71e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748   271 SDELKSDSEELSLTSNELVSKMEDMNTACKTIKVAIEENSAASEQITASIEEINSAVNELTQRALMARNVASEARgNAEN 350
Cdd:PTZ00121 1628 AEEEKKKVEQLKKKEAEEKKKAEELKKAEEENKIKAAEEAKKAEEDKKKAEEAKKAEEDEKKAAEALKKEAEEAK-KAEE 1706
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748   351 VQEKGKIAADTTESLYKEKRETIIKAIEEGKIVNKIKDMAAAIESIADQTNLLALNAAIEAARAGENGK-GFAVVADEVR 429
Cdd:PTZ00121 1707 LKKKEAEEKKKAEELKKAEEENKIKAEEAKKEAEEDKKKAEEAKKDEEEKKKIAHLKKEEEKKAEEIRKeKEAVIEEELD 1786
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 15896748   430 KLAEQSKTEVnniNENIGKIDEAFGNISAGSNDILVFINE 469
Cdd:PTZ00121 1787 EEDEKRRMEV---DKKIKDIFDNFANIIEGGKEGNLVIND 1823
 
Name Accession Description Interval E-value
4HB_MCP_1 pfam12729
Four helix bundle sensory module for signal transduction; This family is a four helix bundle ...
7-186 8.10e-34

Four helix bundle sensory module for signal transduction; This family is a four helix bundle that operates as a ubiquitous sensory module in prokaryotic signal-transduction. The 4HB_MCP is always found between two predicted transmembrane helices indicating that it detects only extracellular signals. In many cases the domain is associated with a cytoplasmic HAMP domain suggesting that most proteins carrying the bundle might share the mechanism of transmembrane signalling which is well-characterized in E coli chemoreceptors.


Pssm-ID: 193205  Cd Length: 181  Bit Score: 126.57  E-value: 8.10e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748     7 NLKVVHKLILCFGIIITVIIMNGIMSYEKMTQVNDNINTIYSESLMKLSITKDIRAHMADLTSGSLILVNPDRKSIVDKT 86
Cdd:pfam12729   1 NLKIRTKLILLFLLLALLLIIVGIVGLYSLKKINKNSETMYEDRLLPIKWLGEIRSNLREIRANLLELILTTDPAERDEL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748    87 ISDMNGLIEKDNELTQKYESLINDEKDKKIFTQYLENLNGYNNAKDKFFETARTGDYN-AIKNQFSIFDGYRAKINDLLD 165
Cdd:pfam12729  81 LKDIEELRAEIDKLLKKYEKTILTEEEKKLFNEFKEQLKAYRKVRNKVLDLAKAGKNDeAYALYLTELEPARDAVIEALD 160
                         170       180
                  ....*....|....*....|.
gi 15896748   166 EEITYNQKVAKSKYEDSQKQY 186
Cdd:pfam12729 161 ELIDYNLKVAKEAYEDNKASY 181
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
314-521 2.52e-32

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 123.12  E-value: 2.52e-32
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 314 EQITASIEEINSAVNELTQRALMARNVASEARGNAENVQEKGKIAADTTESLykekrETIIKAIEEgkIVNKIKDMAAAI 393
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEA-----VSAVEELEE--SSAEIGEIVEVI 73
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 394 ESIADQTNLLALNAAIEAARAGENGKGFAVVADEVRKLAEQSKTEVNNINENIGKIDEAfgnISAGSNDIlvfinEKVIP 473
Cdd:cd11386  74 DDIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQ---TEEAVEAM-----EETSE 145
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*...
gi 15896748 474 EFNGFVKGGDYYYRDANYINKLSEELASTLEEFSATIGQISEAAQNVA 521
Cdd:cd11386 146 EVEEGVELVEETGRAFEEIVASVEEVADGIQEISAATQEQSASTQEIA 193
HAMP pfam00672
HAMP domain;
194-260 2.09e-05

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 42.60  E-value: 2.09e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 15896748   194 IMLTIVAIGVSVIFSYLLIKNINDALKKIKQFAGRNAKYDFSSSINIASKDEFGETSVSLNEAQSNV 260
Cdd:pfam00672   2 LLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVPVSGPDEIGELARAFNQMADRL 68
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
145-570 2.89e-49

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 176.72  E-value: 2.89e-49
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 145 AIKNQFSIFDGYRAKINDL--LDEEITYNQKVAKSKYEDSQKQYKKALFITImltIVAIGVSVIFSYLLIKNINDALKKI 222
Cdd:COG0840  15 AAGEADAGLLKLKKLIDELgkLLLSLNLILDDAASAEAAALKAVLKFLLISL---LVAIIVVLVLAILLLRAILEPISDL 91
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 223 KQFAGRNAKYDFSSSINIASKDEFGETSVSLNEAQSNVVNLLKNISDSSDELKSDSEELSLTSNELVSkmedmntackti 302
Cdd:COG0840  92 LEVVERIAAGDLTKRIDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSA------------ 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 303 kvAIEENSAASEQITASIEEINSAVNELTQRALMARNVASEARGNAENVQEKGKIAADTTESLYKEKRETIIKAIEEgki 382
Cdd:COG0840 160 --RADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVKKLSES--- 234
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 383 VNKIKDMAAAIESIADQTNLLALNAAIEAARAGENGKGFAVVADEVRKLAEQSKTEVNNINENIGKIDEAFGNISAGSND 462
Cdd:COG0840 235 SQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEAADAVEHMEE 314
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 463 ILVFINEKVipefngfvkggdyyyRDANYINKLSEELASTLEEFSATIGQISEAAQNVALNEQKSSEKVAAVGNIVNDTT 542
Cdd:COG0840 315 SASEVSEGV---------------KLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENA 379
                       410       420
                ....*....|....*....|....*...
gi 15896748 543 KVALNVSKTSQNQAELSEELYVIVGKFK 570
Cdd:COG0840 380 AAVEELAAASEELKELAEKLLELVAKFK 407
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
266-570 6.52e-37

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 137.42  E-value: 6.52e-37
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748    266 NISDSSDELKSDSEELSLTSNELVSKMEDMntacktikvaieenSAASEQITASIEEINSAVNELTQRALMARNVASEAR 345
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEEL--------------SASIEEVAANADEIAATAQSAAEAAEEGREAVEDAI 66
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748    346 GNAENVQEKGKIAADTteslykekretiIKAIEEGkiVNKIKDMAAAIESIADQTNLLALNAAIEAARAGENGKGFAVVA 425
Cdd:smart00283  67 TAMDQIREVVEEAVSA------------VEELEES--SDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVA 132
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748    426 DEVRKLAEQSKTEVNNINENIGKIDEAfgniSAGSNDILVFINEKVipefngfvkggdyyyrdaNYINKLSEELASTLEE 505
Cdd:smart00283 133 DEVRKLAERSAESAKEIESLIKEIQEE----TNEAVAAMEESSSEV------------------EEGVELVEETGDALEE 190
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 15896748    506 FSATIGQISEAAQNV--ALNEQKSS--EKVAAVGNI---VNDTTKVALNVSKTSQNQAELSEELYVIVGKFK 570
Cdd:smart00283 191 IVDSVEEIADLVQEIaaATDEQAAGseEVNAAIDEIaqvTQETAAMSEEISAAAEELSGLAEELDELVERFK 262
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
133-549 1.51e-30

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 124.35  E-value: 1.51e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  133 KFFETARTGDYNAIKNQfsifdGYRAKINDLLDEEITYNQKVAKSKYEDSQKQYKKALF----ITIMLTIVAIGVSVIFS 208
Cdd:PRK15048 139 DYLDYGNTGAYFAQPTQ-----GMQNAMGEAFAQYALSSEKLYRDIVTDNADDYRFAQWqlavIALVVVLILLVAWYGIR 213
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  209 YLLIKNINDALKKIKQFAGRNakydFSSSINIASKDEFGETSVSLNEAQSNVVNLLKNISDSSDELKSDSEELSLTSNEL 288
Cdd:PRK15048 214 RMLLTPLAKIIAHIREIAGGN----LANTLTIDGRSEMGDLAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDL 289
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  289 VSKMEDMNTAcktikvaIEENSAASEQITASIEeinsavneltQRALMARNVASEARGNAENVQEKGKIAADTTESLYke 368
Cdd:PRK15048 290 SSRTEQQASA-------LEETAASMEQLTATVK----------QNADNARQASQLAQSASDTAQHGGKVVDGVVKTMH-- 350
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  369 kretiikaiEEGKIVNKIKDMAAAIESIADQTNLLALNAAIEAARAGENGKGFAVVADEVRKLAEQSKTEVNNINeniGK 448
Cdd:PRK15048 351 ---------EIADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIK---AL 418
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  449 IDEAFGNISAGSndilvfinekVIPEfngfvKGGDYYYRDANYINKLSE---ELASTLEEFSATIGQISEAAQNV-ALNE 524
Cdd:PRK15048 419 IEDSVSRVDTGS----------VLVE-----SAGETMNNIVNAVTRVTDimgEIASASDEQSRGIDQVALAVSEMdRVTQ 483
                        410       420
                 ....*....|....*....|....*...
gi 15896748  525 QKSS---EKVAAVGNIVNDTTKVALNVS 549
Cdd:PRK15048 484 QNASlvqESAAAAAALEEQASRLTQAVS 511
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
104-460 2.79e-30

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 123.53  E-value: 2.79e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  104 YESLINDEKDKKIFTQYLE-NLNGYNNAKDKFFETARTGDYNAIKNQFSifDGYRAKINDLLDEEITYNQKVAKSKYEDS 182
Cdd:PRK15041 108 YEALPRDPRQSTAAAAEIKrNYDIYHNALAELIQLLGAGKINEFFDQPT--QGYQDGFEKQYVAYMEQNDRLYDIAVSDN 185
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  183 QKQYKKALFI--TIMLTIVAIGVSVIF--SYLLIKNINDALKKIKQFAGRnakyDFSSSINIASKDEFGETSVSLNEAQS 258
Cdd:PRK15041 186 NASYSQAMWIlvGVMIVVLAVIFAVWFgiKASLVAPMNRLIDSIRHIAGG----DLVKPIEVDGSNEMGQLAESLRHMQG 261
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  259 NVVNLLKNISDSSDELKSDSEELSLTSNELVSKMEDMntacktiKVAIEENSAASEQITASIEeinsavneltQRALMAR 338
Cdd:PRK15041 262 ELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQ-------AASLEETAASMEQLTATVK----------QNAENAR 324
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  339 NVASEARGNAENVQEKGKIAADTTESLykekRETIIKAieegkivNKIKDMAAAIESIADQTNLLALNAAIEAARAGENG 418
Cdd:PRK15041 325 QASHLALSASETAQRGGKVVDNVVQTM----RDISTSS-------QKIADIISVIDGIAFQTNILALNAAVEAARAGEQG 393
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|..
gi 15896748  419 KGFAVVADEVRKLAEQSKTEVNNINeniGKIDEAFGNISAGS 460
Cdd:PRK15041 394 RGFAVVAGEVRNLAQRSAQAAREIK---SLIEDSVGKVDVGS 432
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
171-557 9.61e-26

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 110.16  E-value: 9.61e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  171 NQKVAKSKyEDSQKQYKKALFITIMLTIVA---IGVSVIFSYlliKNINDALKKIKQFAGRNAKYDFSSSINIASKDEFG 247
Cdd:PRK09793 171 NHVLEAAS-AQSQRNYQISALVFISMIIVAaiyISSALWWTR---KMIVQPLAIIGSHFDSIAAGNLARPIAVYGRNEIT 246
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  248 ETSVSLNEAQSNVVNLLKNISDSSDELKSDSEELSLTSNELVSKMEdmntacktikvaieENSAASEQITASIEEINSAV 327
Cdd:PRK09793 247 AIFASLKTMQQALRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTE--------------QQAASLAQTAASMEQLTATV 312
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  328 nelTQRALMARNvASEARGNAENVQEKGKIAADTTESLYKEkretiIKAIEEgkivnKIKDMAAAIESIADQTNLLALNA 407
Cdd:PRK09793 313 ---GQNADNARQ-ASELAKNAATTAQAGGVQVSTMTHTMQE-----IATSSQ-----KIGDIISVIDGIAFQTNILALNA 378
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  408 AIEAARAGENGKGFAVVADEVRKLAEQSKTEVNNINeniGKIDEAFGNISAGSNdiLVFINEKVIPEFNGFVkggdyyyr 487
Cdd:PRK09793 379 AVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIK---GLIEESVNRVQQGSK--LVNNAAATMTDIVSSV-------- 445
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 15896748  488 daNYINKLSEELASTLEEFSATIGQISEA-AQNVALNEQKSS---EKVAAVGNIVND----TTKVAL-NVSKTSQNQAE 557
Cdd:PRK09793 446 --TRVNDIMGEIASASEEQRRGIEQVAQAvSQMDQVTQQNASlveEAAVATEQLANQadhlSSRVAVfTLEEHEVARHE 522
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
385-572 1.99e-23

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 98.29  E-value: 1.99e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748   385 KIKDMAAAIESIADQTNLLALNAAIEAARAGENGKGFAVVADEVRKLAEQSKTEVNNINENIGKideafgnISAGSNDIL 464
Cdd:pfam00015  41 KISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAAKEIEALIEE-------IVKQTNDST 113
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748   465 VFINEKVIPEFNGFVKGGDyYYRDANYINKLSEELASTLEEFSATIGQISEAAQNVALNeqkssekVAAVGNIVNDTTKV 544
Cdd:pfam00015 114 ASIQQTRTEVEVGSTIVES-TGEALKEIVDAVAEIADIVQEIAAASDEQSAGIDQVNQA-------VARIDQVTQQNAAL 185
                         170       180
                  ....*....|....*....|....*...
gi 15896748   545 ALNVSKTSQNQAELSEELYVIVGKFKME 572
Cdd:pfam00015 186 VEESAAAAETLEEQAEELTASVAQFRIK 213
PTZ00121 PTZ00121
MAEBL; Provisional
271-469 8.71e-05

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 44.36  E-value: 8.71e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748   271 SDELKSDSEELSLTSNELVSKMEDMNTACKTIKVAIEENSAASEQITASIEEINSAVNELTQRALMARNVASEARgNAEN 350
Cdd:PTZ00121 1628 AEEEKKKVEQLKKKEAEEKKKAEELKKAEEENKIKAAEEAKKAEEDKKKAEEAKKAEEDEKKAAEALKKEAEEAK-KAEE 1706
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748   351 VQEKGKIAADTTESLYKEKRETIIKAIEEGKIVNKIKDMAAAIESIADQTNLLALNAAIEAARAGENGK-GFAVVADEVR 429
Cdd:PTZ00121 1707 LKKKEAEEKKKAEELKKAEEENKIKAEEAKKEAEEDKKKAEEAKKDEEEKKKIAHLKKEEEKKAEEIRKeKEAVIEEELD 1786
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 15896748   430 KLAEQSKTEVnniNENIGKIDEAFGNISAGSNDILVFINE 469
Cdd:PTZ00121 1787 EEDEKRRMEV---DKKIKDIFDNFANIIEGGKEGNLVIND 1823
PTZ00121 PTZ00121
MAEBL; Provisional
271-451 5.77e-04

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 41.67  E-value: 5.77e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748   271 SDELKSDSEELSlTSNELVSKMEDMNTACKTIKVAIEENSAAsEQITASIEEINSAvNELTQRALMARNvASEARGNAEn 350
Cdd:PTZ00121 1380 ADAAKKKAEEKK-KADEAKKKAEEDKKKADELKKAAAAKKKA-DEAKKKAEEKKKA-DEAKKKAEEAKK-ADEAKKKAE- 1454
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748   351 vqEKGKIAADTTESLYKEKRETIIKAIEEGKIVNKIKDMAAAIESIADQTNLLA--LNAAIEAARAGENGKgfavvADEV 428
Cdd:PTZ00121 1455 --EAKKAEEAKKKAEEAKKADEAKKKAEEAKKADEAKKKAEEAKKKADEAKKAAeaKKKADEAKKAEEAKK-----ADEA 1527
                         170       180
                  ....*....|....*....|...
gi 15896748   429 RKLAEQSKTEVNNINENIGKIDE 451
Cdd:PTZ00121 1528 KKAEEAKKADEAKKAEEKKKADE 1550
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
264-332 7.98e-04

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 39.96  E-value: 7.98e-04
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 15896748    264 LKNISDSSDELKSDSEELSLTSNELVSKMEDMNTACKTIKVAIEENSAASEQITASIEEINSAVNELTQ 332
Cdd:smart00283 188 LEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEISAAAEELSGLAEELDE 256
COG1511 COG1511
Predicted membrane protein [Function unknown]
192-529 2.98e-03

Predicted membrane protein [Function unknown]


Pssm-ID: 224428 [Multi-domain]  Cd Length: 780  Bit Score: 39.03  E-value: 2.98e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 192 ITIMLTIVAIGVSVIFSYLLIKNINDALKKIKQFAGR-NAKYDFSSSINIASKDEFGETSVSLNEAQSNVVNL---LKNI 267
Cdd:COG1511 160 LTETYTKVVAFPTIYDLGGGVKGAADGAEKLKDGTDEaSNGNKKLSDLLNTLNNSSATFSDGLNALTSGLTTLtdgLNQL 239
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 268 SDSSDELKSDSEELSLTSNELVSKMEDMNTACKTIKVAIEENSAASEQITASIEEINSAVNELTQRALMARNVASEARGN 347
Cdd:COG1511 240 DSGLGTLAAGIGELKQGAEQLNEGIGEFSSGLSELNSGVQDLAAGVPQLNQGISALAAGLSLPDSLGDQFSSLQEALTQI 319
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 348 AENVQEKGKIAADTTES-----LYKEKRETIIKAIEEGKIVNKIKDMAAAIESIADQTNLLALNA----AIEAARAGENG 418
Cdd:COG1511 320 AQGLKQKTSSSLEAAQGslsslQSMLALSKSLDLTAEGATVDALGAPDGVQWLDESQKTLATLSEllstGIDGVSEGLDA 399
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748 419 KGFAVVADevRKLAEQSKTEVNNINENIGKIDEAFGNI-----SAGSNDILVFINEKVIPEFNGFVKGGDyyyrdaNYIN 493
Cdd:COG1511 400 LEQASAQL--AKSLAKLKTAVAQIAASIAQLLPGASEVlktlkSKGLDKLLNQLNGALAKGSNALVQGLS------DAND 471
                       330       340       350
                ....*....|....*....|....*....|....*.
gi 15896748 494 KLSEELASTLEEFSATIGQISEAAQNVALNEQKSSE 529
Cdd:COG1511 472 SFRSITSAQLKAGLNTLADGSNDLSSLGPGLGQLAD 507
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
212-451 6.31e-03

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 38.16  E-value: 6.31e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  212 IKNINDALKKI-KQFAGRNAKYDFSSSINIASKDEFGETSVSLNEAQSNVVNL---LKNISDSSDELKSDSEELSLTSNE 287
Cdd:COG1196  760 LEELEEELESLeEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALereLESLEQRRERLEQEIEELEEEIEE 839
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  288 LVSKMEDMNTACKTIKVAIEENSAASEQITASIEEINSAVNELTQRALMARNVASEARGNAENVQEKGKIAADTTESLYK 367
Cdd:COG1196  840 LEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAELKEEIEKLRERLEELEA 919
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896748  368 EKR--ETIIKAIEE-----------GKIVNKIKDMAAAIESIaDQTNLLALNAaieaaragengkgFAVVADEVRKLAEQ 434
Cdd:COG1196  920 KLErlEVELPELEEeleeeyedtleTELEREIERLEEEIEAL-GPVNLRAIEE-------------YEEVEERYEELKSQ 985
                        250       260
                 ....*....|....*....|
gi 15896748  435 S---KTEVNNINENIGKIDE 451
Cdd:COG1196  986 RedlEEAKEKLLEVIEELDK 1005
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
255-327 9.68e-03

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 36.65  E-value: 9.68e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 15896748   255 EAQSNVVNLLKNISDSSDELKSDSEELSLTSNELVSKMEDMNTACKTIKVAIEENSAASEQITASIEEINSAV 327
Cdd:pfam00015 135 EALKEIVDAVAEIADIVQEIAAASDEQSAGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASV 207
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH