NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|15889567|ref|NP_355248.1|]
View 

conserved hypothetical protein [Agrobacterium fabrum str. C58]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
HDc cd00077
Metal dependent phosphohydrolases with conserved 'HD' motif
145-286 8.24e-29

Metal dependent phosphohydrolases with conserved 'HD' motif


:

Pssm-ID: 238032  Cd Length: 145  Bit Score: 108.97  E-value: 8.24e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567 145 ETTFVHSVSVSGLMILFGNYLGLNKETVNLLGVSGLLHDIGKVEIPSSILNkteglsiEEREIINLHPAFGRDILSRD-- 222
Cdd:cd00077   1 EHRFEHSLRVAQLARRLAEELGLSEEDIELLRLAALLHDIGKPGTPDAITE-------EESELEKDHAIVGAEILRELll 73
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 15889567 223 ----GQMPDMVLDVCFNHHERIDGGGYPSGRAGGEISLHARIAAICDVYDA-VTSVRPYKKPWTANDAL 286
Cdd:cd00077  74 eeviKLIDELILAVDASHHERLDGLGYPDGLKGEEITLEARIVKLADRLDAlRRDSREKRRRIAEEDLE 142
DUF3391 pfam11871
Domain of unknown function (DUF3391); This domain is functionally uncharacterized. This domain ...
1-100 6.39e-13

Domain of unknown function (DUF3391); This domain is functionally uncharacterized. This domain is found in bacteria. This presumed domain is typically between 122 to 139 amino acids in length. This domain is found associated with pfam01966.


:

Pssm-ID: 256688  Cd Length: 126  Bit Score: 63.85  E-value: 6.39e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567     1 MLKRISTQQLAVGMFIEAVEGTFSNHKITQkyRFLLQREEVVQQLKKSGAESIVINTAKGSDVGASQGPGSAGVSQTDPS 80
Cdd:pfam11871   1 MLKKIPVSQLQVGMYVSLLDSWLEHPFLRN--RFLIKSEADIERLRKSGVKYVWIDTSKSLDVPELKPPVEADAELEAEP 78
                          90       100
                  ....*....|....*....|...
gi 15889567    81 PSMVTA---VTQAVRSAADVIAE 100
Cdd:pfam11871  79 PAPYKKkvsFERELRRAKKLFQE 101
HDGYP COG2206
HD-GYP domain, c-di-GMP phosphodiesterase class II (or its inactivated variant) [Signal ...
31-309 2.58e-86

HD-GYP domain, c-di-GMP phosphodiesterase class II (or its inactivated variant) [Signal transduction mechanisms];


:

Pssm-ID: 225116 [Multi-domain]  Cd Length: 344  Bit Score: 265.51  E-value: 2.58e-86
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567  31 KYRFLLQREEVVQQLKKSGAESIVINTAKGSDVGAS-----------------------------QGPGSAGVSQTDPSP 81
Cdd:COG2206   1 LSLFSLDEQLGLAELAKAKIKELFIDGSLFVDRLASalalaaayllslegtllssellaeepaaaEEAFSALYAELSEEE 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567  82 SMVTAVTQAVRSAADVIAETFSVAEGGGCVSFQGMTAA---AGKISDAIQANPAVFIGVTRLKSKDETTFVHSVSVSGLM 158
Cdd:COG2206  81 EIRRAAAELYKVKAALVLNFEEIGEDILIAKLDATLAVrieLSKVAREIVKKALVALARGDIKAKDDYTYGHSVRVAELA 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567 159 ILFGNYLGLNKETVNLLGVSGLLHDIGKVEIPSSILNKTEGLSIEEREIINLHPAFGRDILSRDGQMPDMVLDVCFNHHE 238
Cdd:COG2206 161 EAIAKKLGLSEEKIEELALAGLLHDIGKIGIPDSILNKPGKLTEEEFEIIKKHPIYGYDILKDLPEFLESVRAVALRHHE 240
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 15889567 239 RIDGGGYPSGRAGGEISLHARIAAICDVYDAVTSVRPYKKPWTANDALTWMLR-RDGHFDIQLLKKFALCIS 309
Cdd:COG2206 241 RWDGTGYPRGLKGEEIPLEARIIAVADVYDALTSDRPYKKAKSPEEALEELRKnSGGKFDPKVVDAFLKALS 312
 
Name Accession Description Interval E-value
HDc cd00077
Metal dependent phosphohydrolases with conserved 'HD' motif
145-286 8.24e-29

Metal dependent phosphohydrolases with conserved 'HD' motif


Pssm-ID: 238032  Cd Length: 145  Bit Score: 108.97  E-value: 8.24e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567 145 ETTFVHSVSVSGLMILFGNYLGLNKETVNLLGVSGLLHDIGKVEIPSSILNkteglsiEEREIINLHPAFGRDILSRD-- 222
Cdd:cd00077   1 EHRFEHSLRVAQLARRLAEELGLSEEDIELLRLAALLHDIGKPGTPDAITE-------EESELEKDHAIVGAEILRELll 73
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 15889567 223 ----GQMPDMVLDVCFNHHERIDGGGYPSGRAGGEISLHARIAAICDVYDA-VTSVRPYKKPWTANDAL 286
Cdd:cd00077  74 eeviKLIDELILAVDASHHERLDGLGYPDGLKGEEITLEARIVKLADRLDAlRRDSREKRRRIAEEDLE 142
HDc smart00471
Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic ...
144-278 7.03e-16

Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic nucleotide phosphodiesterases (PDEc). This profile/HMM does not detect HD homologues in bacterial glycine aminoacyl-tRNA synthetases (beta subunit).


Pssm-ID: 214679  Cd Length: 124  Bit Score: 71.94  E-value: 7.03e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567    144 DETTFVHSVSVSGLMILFGNYLGLNKetVNLLGVSGLLHDIGKVEIPSSILNKTeglsieerEIINLHPAFGRDILSRDG 223
Cdd:smart00471   2 DYHVFEHSLRVAQLAAALAEELGLLD--IELLLLAALLHDIGKPGTPDSFLVKT--------SVLEDHHFIGAEILLEEE 71
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 15889567    224 ---QMPDMVLDVCFNHHERIDGGGYPsgraggEISLHARIAAICDVYDAVTSVRPYKK 278
Cdd:smart00471  72 eprILEEILRTAILSHHERPDGLRGE------PITLEARIVKVADRLDALRADRRYRR 123
HD_5 pfam13487
HD domain; HD domains are metal dependent phosphohydrolases.
200-260 1.30e-15

HD domain; HD domains are metal dependent phosphohydrolases.


Pssm-ID: 257811  Cd Length: 63  Bit Score: 69.90  E-value: 1.30e-15
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 15889567   200 LSIEEREIINLHPAFGRDILSRDGQMPDmVLDVCFNHHERIDGGGYPSGRAGGEISLHARI 260
Cdd:pfam13487   3 LTPEERAIINEHPEQTARLLEKIPRLPP-VAEIIGHHHERLDGSGYPRGLKGDEIPLGARI 62
DUF3391 pfam11871
Domain of unknown function (DUF3391); This domain is functionally uncharacterized. This domain ...
1-100 6.39e-13

Domain of unknown function (DUF3391); This domain is functionally uncharacterized. This domain is found in bacteria. This presumed domain is typically between 122 to 139 amino acids in length. This domain is found associated with pfam01966.


Pssm-ID: 256688  Cd Length: 126  Bit Score: 63.85  E-value: 6.39e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567     1 MLKRISTQQLAVGMFIEAVEGTFSNHKITQkyRFLLQREEVVQQLKKSGAESIVINTAKGSDVGASQGPGSAGVSQTDPS 80
Cdd:pfam11871   1 MLKKIPVSQLQVGMYVSLLDSWLEHPFLRN--RFLIKSEADIERLRKSGVKYVWIDTSKSLDVPELKPPVEADAELEAEP 78
                          90       100
                  ....*....|....*....|...
gi 15889567    81 PSMVTA---VTQAVRSAADVIAE 100
Cdd:pfam11871  79 PAPYKKkvsFERELRRAKKLFQE 101
HDGYP COG2206
HD-GYP domain, c-di-GMP phosphodiesterase class II (or its inactivated variant) [Signal ...
31-309 2.58e-86

HD-GYP domain, c-di-GMP phosphodiesterase class II (or its inactivated variant) [Signal transduction mechanisms];


Pssm-ID: 225116 [Multi-domain]  Cd Length: 344  Bit Score: 265.51  E-value: 2.58e-86
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567  31 KYRFLLQREEVVQQLKKSGAESIVINTAKGSDVGAS-----------------------------QGPGSAGVSQTDPSP 81
Cdd:COG2206   1 LSLFSLDEQLGLAELAKAKIKELFIDGSLFVDRLASalalaaayllslegtllssellaeepaaaEEAFSALYAELSEEE 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567  82 SMVTAVTQAVRSAADVIAETFSVAEGGGCVSFQGMTAA---AGKISDAIQANPAVFIGVTRLKSKDETTFVHSVSVSGLM 158
Cdd:COG2206  81 EIRRAAAELYKVKAALVLNFEEIGEDILIAKLDATLAVrieLSKVAREIVKKALVALARGDIKAKDDYTYGHSVRVAELA 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567 159 ILFGNYLGLNKETVNLLGVSGLLHDIGKVEIPSSILNKTEGLSIEEREIINLHPAFGRDILSRDGQMPDMVLDVCFNHHE 238
Cdd:COG2206 161 EAIAKKLGLSEEKIEELALAGLLHDIGKIGIPDSILNKPGKLTEEEFEIIKKHPIYGYDILKDLPEFLESVRAVALRHHE 240
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 15889567 239 RIDGGGYPSGRAGGEISLHARIAAICDVYDAVTSVRPYKKPWTANDALTWMLR-RDGHFDIQLLKKFALCIS 309
Cdd:COG2206 241 RWDGTGYPRGLKGEEIPLEARIIAVADVYDALTSDRPYKKAKSPEEALEELRKnSGGKFDPKVVDAFLKALS 312
RNase_Y TIGR03319
ribonuclease Y; Members of this family are RNase Y, an endoribonuclease. The member from ...
150-275 6.03e-04

ribonuclease Y; Members of this family are RNase Y, an endoribonuclease. The member from Bacillus subtilis, YmdA, has been shown to be involved in turnover of yitJ riboswitch. [Transcription, Degradation of RNA]


Pssm-ID: 188306 [Multi-domain]  Cd Length: 514  Bit Score: 39.91  E-value: 6.03e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567   150 HSVSVSGLMILFGNYLGLNketVNLLGVSGLLHDIGKVeipssilnkteglsiEEREIINLHPAFGRDILSRDGQMPDmV 229
Cdd:TIGR03319 333 HSIEVAHLAGIMAAELGED---VKLAKRAGLLHDIGKA---------------VDHEVEGSHVEIGAELAKKYKESPE-V 393
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 15889567   230 LDVCFNHHeridgggypsgragGEISLHARIAAICDVYDAVTSVRP 275
Cdd:TIGR03319 394 VNAIAAHH--------------GDVEPTSIEAVLVAAADALSAARP 425
HDOD pfam08668
HDOD domain;
150-238 1.45e-03

HDOD domain;


Pssm-ID: 254961 [Multi-domain]  Cd Length: 196  Bit Score: 37.98  E-value: 1.45e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567   150 HSVSVSGLMILFGNYLGLNKEtvNLLGVSGLLHDIGKV-------EIPSSILNK--TEGLSIE--EREIINL-HPAFGRD 217
Cdd:pfam08668  98 HSLACALAARLLARRLGLDDP--EEAFTAGLLHDIGKLillsllpDEYEEILERvaAEGISLLeaERELLGTdHAEVGAA 175
                          90       100
                  ....*....|....*....|.
gi 15889567   218 ILSRdGQMPDMVLDVCFNHHE 238
Cdd:pfam08668 176 LLER-WNLPEELVEAIAYHHD 195
PRK00106 PRK00106
hypothetical protein; Provisional
150-275 5.05e-03

hypothetical protein; Provisional


Pssm-ID: 178867 [Multi-domain]  Cd Length: 535  Bit Score: 37.16  E-value: 5.05e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567  150 HSVSVSGLMILFGNYLGlnkETVNLLGVSGLLHDIGKveipsSIlnkteglsieEREIINLHPAFGRDiLSRDGQMPDMV 229
Cdd:PRK00106 354 HSVEVGKLAGILAGELG---ENVALARRAGFLHDMGK-----AI----------DREVEGSHVEIGME-FARKYKEHPVV 414
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 15889567  230 LDVCFNHHeridgggypsgragGEISLHARIAAICDVYDAVTSVRP 275
Cdd:PRK00106 415 VNTIASHH--------------GDVEPESVIAVIVAAADALSSARP 446
 
Name Accession Description Interval E-value
HDc cd00077
Metal dependent phosphohydrolases with conserved 'HD' motif
145-286 8.24e-29

Metal dependent phosphohydrolases with conserved 'HD' motif


Pssm-ID: 238032  Cd Length: 145  Bit Score: 108.97  E-value: 8.24e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567 145 ETTFVHSVSVSGLMILFGNYLGLNKETVNLLGVSGLLHDIGKVEIPSSILNkteglsiEEREIINLHPAFGRDILSRD-- 222
Cdd:cd00077   1 EHRFEHSLRVAQLARRLAEELGLSEEDIELLRLAALLHDIGKPGTPDAITE-------EESELEKDHAIVGAEILRELll 73
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 15889567 223 ----GQMPDMVLDVCFNHHERIDGGGYPSGRAGGEISLHARIAAICDVYDA-VTSVRPYKKPWTANDAL 286
Cdd:cd00077  74 eeviKLIDELILAVDASHHERLDGLGYPDGLKGEEITLEARIVKLADRLDAlRRDSREKRRRIAEEDLE 142
HDc smart00471
Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic ...
144-278 7.03e-16

Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic nucleotide phosphodiesterases (PDEc). This profile/HMM does not detect HD homologues in bacterial glycine aminoacyl-tRNA synthetases (beta subunit).


Pssm-ID: 214679  Cd Length: 124  Bit Score: 71.94  E-value: 7.03e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567    144 DETTFVHSVSVSGLMILFGNYLGLNKetVNLLGVSGLLHDIGKVEIPSSILNKTeglsieerEIINLHPAFGRDILSRDG 223
Cdd:smart00471   2 DYHVFEHSLRVAQLAAALAEELGLLD--IELLLLAALLHDIGKPGTPDSFLVKT--------SVLEDHHFIGAEILLEEE 71
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 15889567    224 ---QMPDMVLDVCFNHHERIDGGGYPsgraggEISLHARIAAICDVYDAVTSVRPYKK 278
Cdd:smart00471  72 eprILEEILRTAILSHHERPDGLRGE------PITLEARIVKVADRLDALRADRRYRR 123
HD_5 pfam13487
HD domain; HD domains are metal dependent phosphohydrolases.
200-260 1.30e-15

HD domain; HD domains are metal dependent phosphohydrolases.


Pssm-ID: 257811  Cd Length: 63  Bit Score: 69.90  E-value: 1.30e-15
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 15889567   200 LSIEEREIINLHPAFGRDILSRDGQMPDmVLDVCFNHHERIDGGGYPSGRAGGEISLHARI 260
Cdd:pfam13487   3 LTPEERAIINEHPEQTARLLEKIPRLPP-VAEIIGHHHERLDGSGYPRGLKGDEIPLGARI 62
DUF3391 pfam11871
Domain of unknown function (DUF3391); This domain is functionally uncharacterized. This domain ...
1-100 6.39e-13

Domain of unknown function (DUF3391); This domain is functionally uncharacterized. This domain is found in bacteria. This presumed domain is typically between 122 to 139 amino acids in length. This domain is found associated with pfam01966.


Pssm-ID: 256688  Cd Length: 126  Bit Score: 63.85  E-value: 6.39e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567     1 MLKRISTQQLAVGMFIEAVEGTFSNHKITQkyRFLLQREEVVQQLKKSGAESIVINTAKGSDVGASQGPGSAGVSQTDPS 80
Cdd:pfam11871   1 MLKKIPVSQLQVGMYVSLLDSWLEHPFLRN--RFLIKSEADIERLRKSGVKYVWIDTSKSLDVPELKPPVEADAELEAEP 78
                          90       100
                  ....*....|....*....|...
gi 15889567    81 PSMVTA---VTQAVRSAADVIAE 100
Cdd:pfam11871  79 PAPYKKkvsFERELRRAKKLFQE 101
HD pfam01966
HD domain; HD domains are metal dependent phosphohydrolases.
147-269 1.10e-12

HD domain; HD domains are metal dependent phosphohydrolases.


Pssm-ID: 251000  Cd Length: 110  Bit Score: 63.02  E-value: 1.10e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567   147 TFVHSVSVSGLMILFGNYLGLnkETVNLLGVSGLLHDIGKVEIPSSIlnkteglsIEEREIINLHPAFGRDILSRDG--Q 224
Cdd:pfam01966   1 VLEHSLRVALLARELAEELGE--LDRELLLLAALLHDIGKPPFGDEK--------PLLFEIFLGHAVVGAEILRELEkpL 70
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 15889567   225 MPDMVLDVCFNHHERIDgggypsGRAGGEISLHARIAAICDVYDA 269
Cdd:pfam01966  71 GLEDVLKLILEHHESWE------GLYGEPISLEARIVKLADRLDA 109
HDGYP COG2206
HD-GYP domain, c-di-GMP phosphodiesterase class II (or its inactivated variant) [Signal ...
31-309 2.58e-86

HD-GYP domain, c-di-GMP phosphodiesterase class II (or its inactivated variant) [Signal transduction mechanisms];


Pssm-ID: 225116 [Multi-domain]  Cd Length: 344  Bit Score: 265.51  E-value: 2.58e-86
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567  31 KYRFLLQREEVVQQLKKSGAESIVINTAKGSDVGAS-----------------------------QGPGSAGVSQTDPSP 81
Cdd:COG2206   1 LSLFSLDEQLGLAELAKAKIKELFIDGSLFVDRLASalalaaayllslegtllssellaeepaaaEEAFSALYAELSEEE 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567  82 SMVTAVTQAVRSAADVIAETFSVAEGGGCVSFQGMTAA---AGKISDAIQANPAVFIGVTRLKSKDETTFVHSVSVSGLM 158
Cdd:COG2206  81 EIRRAAAELYKVKAALVLNFEEIGEDILIAKLDATLAVrieLSKVAREIVKKALVALARGDIKAKDDYTYGHSVRVAELA 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567 159 ILFGNYLGLNKETVNLLGVSGLLHDIGKVEIPSSILNKTEGLSIEEREIINLHPAFGRDILSRDGQMPDMVLDVCFNHHE 238
Cdd:COG2206 161 EAIAKKLGLSEEKIEELALAGLLHDIGKIGIPDSILNKPGKLTEEEFEIIKKHPIYGYDILKDLPEFLESVRAVALRHHE 240
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 15889567 239 RIDGGGYPSGRAGGEISLHARIAAICDVYDAVTSVRPYKKPWTANDALTWMLR-RDGHFDIQLLKKFALCIS 309
Cdd:COG2206 241 RWDGTGYPRGLKGEEIPLEARIIAVADVYDALTSDRPYKKAKSPEEALEELRKnSGGKFDPKVVDAFLKALS 312
RpfG COG3437
Response regulator c-di-GMP phosphodiesterase, RpfG family, contains REC and HD-GYP domains ...
132-304 2.59e-40

Response regulator c-di-GMP phosphodiesterase, RpfG family, contains REC and HD-GYP domains [Signal transduction mechanisms];


Pssm-ID: 225971 [Multi-domain]  Cd Length: 360  Bit Score: 145.58  E-value: 2.59e-40
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567 132 AVFIGVTRLKSKDETTFVHSVSVSGLMILFGNYLGLNKETVNLLGVSGLLHDIGKVEIPSSILNKTEGLSIEEREIINLH 211
Cdd:COG3437 171 TLEELAALLEVRDYETGDHLERVAQYSELLAELLGLSEEEVDLIKKAAPLHDIGKVAIPDSILLKPGKLTSEEFEIMKGH 250
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567 212 PAFGRDILSRDGQMPDMVLDVCFNHHERIDGGGYPSGRAGGEISLHARIAAICDVYDAVTSVRPYKKPWTANDALTWMLR 291
Cdd:COG3437 251 PILGAEILKSSERLMQVAAEIARHHHERWDGSGYPDGLKGDEIPLSARIVAIADVFDALVSGRPYKEAMSTEEALEIIRA 330
                       170
                ....*....|....
gi 15889567 292 RDG-HFDIQLLKKF 304
Cdd:COG3437 331 QSGrLFDPKLVEAF 344
RNase_Y TIGR03319
ribonuclease Y; Members of this family are RNase Y, an endoribonuclease. The member from ...
150-275 6.03e-04

ribonuclease Y; Members of this family are RNase Y, an endoribonuclease. The member from Bacillus subtilis, YmdA, has been shown to be involved in turnover of yitJ riboswitch. [Transcription, Degradation of RNA]


Pssm-ID: 188306 [Multi-domain]  Cd Length: 514  Bit Score: 39.91  E-value: 6.03e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567   150 HSVSVSGLMILFGNYLGLNketVNLLGVSGLLHDIGKVeipssilnkteglsiEEREIINLHPAFGRDILSRDGQMPDmV 229
Cdd:TIGR03319 333 HSIEVAHLAGIMAAELGED---VKLAKRAGLLHDIGKA---------------VDHEVEGSHVEIGAELAKKYKESPE-V 393
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 15889567   230 LDVCFNHHeridgggypsgragGEISLHARIAAICDVYDAVTSVRP 275
Cdd:TIGR03319 394 VNAIAAHH--------------GDVEPTSIEAVLVAAADALSAARP 425
HDOD pfam08668
HDOD domain;
150-238 1.45e-03

HDOD domain;


Pssm-ID: 254961 [Multi-domain]  Cd Length: 196  Bit Score: 37.98  E-value: 1.45e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567   150 HSVSVSGLMILFGNYLGLNKEtvNLLGVSGLLHDIGKV-------EIPSSILNK--TEGLSIE--EREIINL-HPAFGRD 217
Cdd:pfam08668  98 HSLACALAARLLARRLGLDDP--EEAFTAGLLHDIGKLillsllpDEYEEILERvaAEGISLLeaERELLGTdHAEVGAA 175
                          90       100
                  ....*....|....*....|.
gi 15889567   218 ILSRdGQMPDMVLDVCFNHHE 238
Cdd:pfam08668 176 LLER-WNLPEELVEAIAYHHD 195
PRK00106 PRK00106
hypothetical protein; Provisional
150-275 5.05e-03

hypothetical protein; Provisional


Pssm-ID: 178867 [Multi-domain]  Cd Length: 535  Bit Score: 37.16  E-value: 5.05e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567  150 HSVSVSGLMILFGNYLGlnkETVNLLGVSGLLHDIGKveipsSIlnkteglsieEREIINLHPAFGRDiLSRDGQMPDMV 229
Cdd:PRK00106 354 HSVEVGKLAGILAGELG---ENVALARRAGFLHDMGK-----AI----------DREVEGSHVEIGME-FARKYKEHPVV 414
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 15889567  230 LDVCFNHHeridgggypsgragGEISLHARIAAICDVYDAVTSVRP 275
Cdd:PRK00106 415 VNTIASHH--------------GDVEPESVIAVIVAAADALSSARP 446
YqfF COG1480
Membrane-associated HD superfamily phosphohydrolase [General function prediction only];
147-237 9.70e-03

Membrane-associated HD superfamily phosphohydrolase [General function prediction only];


Pssm-ID: 224397 [Multi-domain]  Cd Length: 700  Bit Score: 36.21  E-value: 9.70e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15889567 147 TFVHSVSVSGLMILFGNYLGLNKEtvnLLGVSGLLHDIGKVEIP-------SSILNKTEGLSIEE-REIINLHPAFGRDI 218
Cdd:COG1480 490 TYQHSVMVANLAEAAAEEIGANSL---LARVGAYYHDIGKMKRPlffienqMGGKNPHDDLSPQLsALIIISHVKEGVEM 566
                        90
                ....*....|....*....
gi 15889567 219 LSRDGqMPDMVLDVCFNHH 237
Cdd:COG1480 567 AREYK-LPQEIIDIIPEHH 584
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH