NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|157823827|ref|NP_001101545.1|]
View 

sphingosine 1-phosphate receptor 4 [Rattus norvegicus]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TM_PBP1_branched-chain-AA_like super family cl00454
Transmembrane subunit (TM) of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette ...
226-341 8.13e-03

Transmembrane subunit (TM) of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which are involved in the uptake of branched-chain amino acids (AAs), as well as TMs of transporters involved in the uptake of monosaccharides including ribose, galactose, and arabinose. These transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. This group includes Escherichia coli LivM and LivH, two TMs which heterodimerize to form the translocation pathway of the E. coli branched-chain AA LIV-1/LS transporter. This transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) and LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine. Included in this group are proteins from transport systems that contain a single TM which homodimerizes to generate the transmembrane pore; for example E. coli RbsC, AlsC, and MglC, the TMs of the high affinity ribose transporter, the D-allose transporter and the galactose transporter, respectively. The D-allose transporter may also to be involved in low affinity ribose transport.


The actual alignment was detected with superfamily member pfam03699:

Pssm-ID: 277410  Cd Length: 771  Bit Score: 37.15  E-value: 8.13e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823827  226 LPLYSKGY-VLFCVVVFALILVTILSLygaIFRVVRANGQKSPRPPARRKSRRLLNTVLMILVAfVVCWGPLFGLLLAD- 303
Cdd:pfam03699 153 LPFLELLLsWLLALLLLALIATLLTYY---LYGGIRLQGRFPGLSRAARRHLAVLLGLFFLLKA-AGYWLDRYELLYSGr 228
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 157823827  304 --IFG---SNVWAQEYLRgmdWILALAVLNSAINPLIYSFRSR 341
Cdd:pfam03699 229 gvVTGagyTDVHAVLPAY---LILAVIALLVAVLFFANIFRRK 268
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
99-336 1.08e-28

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


:

Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 112.40  E-value: 1.08e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823827   99 AAIAIHMRSRRWVYYCLLNITLSDLLTGLAYVVNVLL-SGTRTFQLSPVHWFLREGLLFMALAASTFSLLFTAGERFATM 177
Cdd:pfam00001   1 LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYyLVGGDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823827  178 VRVAESGATKT-SRVYGCIGLCWLLAATLGLLPLLGWN---------CVCAFQRCSSLLPLYskGYVLFCVVVFALILVT 247
Cdd:pfam00001  81 VHPLRYRRIRTpRRAKVLILVVWVLALLLSLPPLLFSWlrtveegnvTTCLIDFPEESTLRS--YTLLSTLLGFVLPLLV 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823827  248 ILSLYGAIFRVVRANGQKSP----RPPARRKSRRLLNTVLMILVAFVVCWGPLFGLLLADIFGSNVWAQEYLRGMDWILA 323
Cdd:pfam00001 159 ILVCYTLILRTLRKRARSGAsqarAKRSSSKERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSIIRLLPTALLITLW 238
                         250
                  ....*....|...
gi 157823827  324 LAVLNSAINPLIY 336
Cdd:pfam00001 239 LAYVNSCLNPIIY 251
 
Name Accession Description Interval E-value
UPF0182 pfam03699
Uncharacterized protein family (UPF0182); This family contains uncharacterized integral ...
226-341 8.13e-03

Uncharacterized protein family (UPF0182); This family contains uncharacterized integral membrane proteins.


Pssm-ID: 252106  Cd Length: 771  Bit Score: 37.15  E-value: 8.13e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823827  226 LPLYSKGY-VLFCVVVFALILVTILSLygaIFRVVRANGQKSPRPPARRKSRRLLNTVLMILVAfVVCWGPLFGLLLAD- 303
Cdd:pfam03699 153 LPFLELLLsWLLALLLLALIATLLTYY---LYGGIRLQGRFPGLSRAARRHLAVLLGLFFLLKA-AGYWLDRYELLYSGr 228
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 157823827  304 --IFG---SNVWAQEYLRgmdWILALAVLNSAINPLIYSFRSR 341
Cdd:pfam03699 229 gvVTGagyTDVHAVLPAY---LILAVIALLVAVLFFANIFRRK 268
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
99-336 1.08e-28

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 112.40  E-value: 1.08e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823827   99 AAIAIHMRSRRWVYYCLLNITLSDLLTGLAYVVNVLL-SGTRTFQLSPVHWFLREGLLFMALAASTFSLLFTAGERFATM 177
Cdd:pfam00001   1 LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYyLVGGDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823827  178 VRVAESGATKT-SRVYGCIGLCWLLAATLGLLPLLGWN---------CVCAFQRCSSLLPLYskGYVLFCVVVFALILVT 247
Cdd:pfam00001  81 VHPLRYRRIRTpRRAKVLILVVWVLALLLSLPPLLFSWlrtveegnvTTCLIDFPEESTLRS--YTLLSTLLGFVLPLLV 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823827  248 ILSLYGAIFRVVRANGQKSP----RPPARRKSRRLLNTVLMILVAFVVCWGPLFGLLLADIFGSNVWAQEYLRGMDWILA 323
Cdd:pfam00001 159 ILVCYTLILRTLRKRARSGAsqarAKRSSSKERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSIIRLLPTALLITLW 238
                         250
                  ....*....|...
gi 157823827  324 LAVLNSAINPLIY 336
Cdd:pfam00001 239 LAYVNSCLNPIIY 251
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
115-342 3.23e-03

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 37.84  E-value: 3.23e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823827 115 LLNITLSDLLTGLAYVVNVLLSGTRTFQLSPVHWFLREGLLFMALAASTFSLLFTAGERFATMVRVAESGATKTSRVYGC 194
Cdd:PHA03087  78 LLNLAVSDLLFVMTLPFQIYYYILFQWSFGEFACKIVSGLYYIGFYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYI 157
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823827 195 IGLCWLLAATLGLLPLL---------GWNCVCAFQRCSSLlplYSKGYVLFCVVVFALI--LVTILSLYGAIFRVVRANg 263
Cdd:PHA03087 158 VSLVIWIISIIETTPILfvyttkkdhETLICCMFYNNKTM---NWKLFINFEINIIGMLipLTILLYCYSKILITLKGI- 233
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823827 264 QKSprpparRKSRRLLNTVLMILVAFVVCWGP----LFGLLLADIfgSNVWAQEYLRGMDWIL----ALAVLNSAINPLI 335
Cdd:PHA03087 234 NKS------KKNKKAIKLVLIIVILFVIFWLPfnvsVFVYSLHIL--HFKSGCKAVKYIQYALhvteIISLSHCCINPLI 305

                 ....*..
gi 157823827 336 YSFRSRE 342
Cdd:PHA03087 306 YAFVSEF 312
 
Name Accession Description Interval E-value
UPF0182 pfam03699
Uncharacterized protein family (UPF0182); This family contains uncharacterized integral ...
226-341 8.13e-03

Uncharacterized protein family (UPF0182); This family contains uncharacterized integral membrane proteins.


Pssm-ID: 252106  Cd Length: 771  Bit Score: 37.15  E-value: 8.13e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823827  226 LPLYSKGY-VLFCVVVFALILVTILSLygaIFRVVRANGQKSPRPPARRKSRRLLNTVLMILVAfVVCWGPLFGLLLAD- 303
Cdd:pfam03699 153 LPFLELLLsWLLALLLLALIATLLTYY---LYGGIRLQGRFPGLSRAARRHLAVLLGLFFLLKA-AGYWLDRYELLYSGr 228
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 157823827  304 --IFG---SNVWAQEYLRgmdWILALAVLNSAINPLIYSFRSR 341
Cdd:pfam03699 229 gvVTGagyTDVHAVLPAY---LILAVIALLVAVLFFANIFRRK 268
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
99-336 1.08e-28

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 112.40  E-value: 1.08e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823827   99 AAIAIHMRSRRWVYYCLLNITLSDLLTGLAYVVNVLL-SGTRTFQLSPVHWFLREGLLFMALAASTFSLLFTAGERFATM 177
Cdd:pfam00001   1 LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYyLVGGDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823827  178 VRVAESGATKT-SRVYGCIGLCWLLAATLGLLPLLGWN---------CVCAFQRCSSLLPLYskGYVLFCVVVFALILVT 247
Cdd:pfam00001  81 VHPLRYRRIRTpRRAKVLILVVWVLALLLSLPPLLFSWlrtveegnvTTCLIDFPEESTLRS--YTLLSTLLGFVLPLLV 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823827  248 ILSLYGAIFRVVRANGQKSP----RPPARRKSRRLLNTVLMILVAFVVCWGPLFGLLLADIFGSNVWAQEYLRGMDWILA 323
Cdd:pfam00001 159 ILVCYTLILRTLRKRARSGAsqarAKRSSSKERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSIIRLLPTALLITLW 238
                         250
                  ....*....|...
gi 157823827  324 LAVLNSAINPLIY 336
Cdd:pfam00001 239 LAYVNSCLNPIIY 251
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
115-342 3.23e-03

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 37.84  E-value: 3.23e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823827 115 LLNITLSDLLTGLAYVVNVLLSGTRTFQLSPVHWFLREGLLFMALAASTFSLLFTAGERFATMVRVAESGATKTSRVYGC 194
Cdd:PHA03087  78 LLNLAVSDLLFVMTLPFQIYYYILFQWSFGEFACKIVSGLYYIGFYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYI 157
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823827 195 IGLCWLLAATLGLLPLL---------GWNCVCAFQRCSSLlplYSKGYVLFCVVVFALI--LVTILSLYGAIFRVVRANg 263
Cdd:PHA03087 158 VSLVIWIISIIETTPILfvyttkkdhETLICCMFYNNKTM---NWKLFINFEINIIGMLipLTILLYCYSKILITLKGI- 233
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823827 264 QKSprpparRKSRRLLNTVLMILVAFVVCWGP----LFGLLLADIfgSNVWAQEYLRGMDWIL----ALAVLNSAINPLI 335
Cdd:PHA03087 234 NKS------KKNKKAIKLVLIIVILFVIFWLPfnvsVFVYSLHIL--HFKSGCKAVKYIQYALhvteIISLSHCCINPLI 305

                 ....*..
gi 157823827 336 YSFRSRE 342
Cdd:PHA03087 306 YAFVSEF 312
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH