NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|157823527|ref|NP_001099538.1|]
View 

UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 precursor

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Galactosyl_T super family cl21608
Galactosyltransferase; This family includes the galactosyltransferases UDP-galactose: ...
119-308 2.00e-40

Galactosyltransferase; This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.


The actual alignment was detected with superfamily member pfam01762:

Pssm-ID: 272028  Cd Length: 196  Bit Score: 142.85  E-value: 2.00e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823527  119 RRQVLRTTWARERRVRGASLRRLFLVGSDRDPQQarKFNRLLELEAKAYGDILQWDFHDSFFNLTLKQVLFLEWQRTHCT 198
Cdd:pfam01762   2 RRNAIRKTWMNQGNSEGGRIKSLFLVGLSADTDG--KVADLVMEEAKLYGDIVQVDFEDTYENLTYKTLTGLLWAVSKCP 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823527  199 NASFVLNGDDDVFAHTDNMVTYL-QGRDPDQHLFV-GHLIQNVGPIRVPWSKYFIPTLVTAEDKYPPYCGGGGFLLSRFT 276
Cdd:pfam01762  80 SAKYIGKIDDDVYFFPDKLLSLLdNGNIDPSESSFyGYVMKEGPVIRNKKSKWYVSPSDYKCSRYPPYASGPFYVLSRDA 159
                         170       180       190
                  ....*....|....*....|....*....|...
gi 157823527  277 MAALHRAARVLPIFPIDDVFL-GMCLQQQGLAP 308
Cdd:pfam01762 160 AEKLLKASKHRRFLQIEDVYVtGILANDLGISR 192
 
Name Accession Description Interval E-value
Galactosyl_T pfam01762
Galactosyltransferase; This family includes the galactosyltransferases UDP-galactose: ...
119-308 2.00e-40

Galactosyltransferase; This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.


Pssm-ID: 250845  Cd Length: 196  Bit Score: 142.85  E-value: 2.00e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823527  119 RRQVLRTTWARERRVRGASLRRLFLVGSDRDPQQarKFNRLLELEAKAYGDILQWDFHDSFFNLTLKQVLFLEWQRTHCT 198
Cdd:pfam01762   2 RRNAIRKTWMNQGNSEGGRIKSLFLVGLSADTDG--KVADLVMEEAKLYGDIVQVDFEDTYENLTYKTLTGLLWAVSKCP 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823527  199 NASFVLNGDDDVFAHTDNMVTYL-QGRDPDQHLFV-GHLIQNVGPIRVPWSKYFIPTLVTAEDKYPPYCGGGGFLLSRFT 276
Cdd:pfam01762  80 SAKYIGKIDDDVYFFPDKLLSLLdNGNIDPSESSFyGYVMKEGPVIRNKKSKWYVSPSDYKCSRYPPYASGPFYVLSRDA 159
                         170       180       190
                  ....*....|....*....|....*....|...
gi 157823527  277 MAALHRAARVLPIFPIDDVFL-GMCLQQQGLAP 308
Cdd:pfam01762 160 AEKLLKASKHRRFLQIEDVYVtGILANDLGISR 192
PLN03133 PLN03133
beta-1,3-galactosyltransferase; Provisional
85-355 2.07e-17

beta-1,3-galactosyltransferase; Provisional


Pssm-ID: 215596 [Multi-domain]  Cd Length: 636  Bit Score: 82.54  E-value: 2.07e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823527  85 HCRDFAVLREPKATKcAQPAFLLLAIKSSPANYGRRQVLRTTWARERRVRGASLRRLFLVGSDRDPQqarkFNRLLELEA 164
Cdd:PLN03133 367 HVIDLEALKSPPLSP-KKPLDLFIGVFSTANNFKRRMAVRRTWMQYDAVRSGAVAVRFFVGLHKNQM----VNEELWNEA 441
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823527 165 KAYGDILQWDFHDsFFNLTLKQVLFLEWQRTHCTNASFVLNGDDDVFAHTDNMVTYLQGRDPDQHLFVGHLIQNVGPIRV 244
Cdd:PLN03133 442 RTYGDIQLMPFVD-YYSLITWKTLAICIFGTEVVSAKYVMKTDDDAFVRVDEVLASLKRTNVSHGLLYGLINSDSQPHRN 520
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823527 245 PWSKYFIPTLVTAEDKYPPYCGGGGFLLSRFTMAALHRAARV--LPIFPIDDVFLGMC---LQQQGLAPG--AHSGVRTA 317
Cdd:PLN03133 521 PDSKWYISPEEWPEETYPPWAHGPGYVVSRDIAKEVYKRHKEgrLKMFKLEDVAMGIWiaeMKKEGLEVKyeNDGRIYNE 600
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 157823527 318 GVlppsprvssfdpcfyRDLLLV-HRFLPFEMLLMWDAL 355
Cdd:PLN03133 601 GC---------------KDGYVVaHYQSPREMLCLWQKL 624
 
Name Accession Description Interval E-value
Galactosyl_T pfam01762
Galactosyltransferase; This family includes the galactosyltransferases UDP-galactose: ...
119-308 2.00e-40

Galactosyltransferase; This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.


Pssm-ID: 250845  Cd Length: 196  Bit Score: 142.85  E-value: 2.00e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823527  119 RRQVLRTTWARERRVRGASLRRLFLVGSDRDPQQarKFNRLLELEAKAYGDILQWDFHDSFFNLTLKQVLFLEWQRTHCT 198
Cdd:pfam01762   2 RRNAIRKTWMNQGNSEGGRIKSLFLVGLSADTDG--KVADLVMEEAKLYGDIVQVDFEDTYENLTYKTLTGLLWAVSKCP 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823527  199 NASFVLNGDDDVFAHTDNMVTYL-QGRDPDQHLFV-GHLIQNVGPIRVPWSKYFIPTLVTAEDKYPPYCGGGGFLLSRFT 276
Cdd:pfam01762  80 SAKYIGKIDDDVYFFPDKLLSLLdNGNIDPSESSFyGYVMKEGPVIRNKKSKWYVSPSDYKCSRYPPYASGPFYVLSRDA 159
                         170       180       190
                  ....*....|....*....|....*....|...
gi 157823527  277 MAALHRAARVLPIFPIDDVFL-GMCLQQQGLAP 308
Cdd:pfam01762 160 AEKLLKASKHRRFLQIEDVYVtGILANDLGISR 192
PLN03133 PLN03133
beta-1,3-galactosyltransferase; Provisional
85-355 2.07e-17

beta-1,3-galactosyltransferase; Provisional


Pssm-ID: 215596 [Multi-domain]  Cd Length: 636  Bit Score: 82.54  E-value: 2.07e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823527  85 HCRDFAVLREPKATKcAQPAFLLLAIKSSPANYGRRQVLRTTWARERRVRGASLRRLFLVGSDRDPQqarkFNRLLELEA 164
Cdd:PLN03133 367 HVIDLEALKSPPLSP-KKPLDLFIGVFSTANNFKRRMAVRRTWMQYDAVRSGAVAVRFFVGLHKNQM----VNEELWNEA 441
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823527 165 KAYGDILQWDFHDsFFNLTLKQVLFLEWQRTHCTNASFVLNGDDDVFAHTDNMVTYLQGRDPDQHLFVGHLIQNVGPIRV 244
Cdd:PLN03133 442 RTYGDIQLMPFVD-YYSLITWKTLAICIFGTEVVSAKYVMKTDDDAFVRVDEVLASLKRTNVSHGLLYGLINSDSQPHRN 520
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157823527 245 PWSKYFIPTLVTAEDKYPPYCGGGGFLLSRFTMAALHRAARV--LPIFPIDDVFLGMC---LQQQGLAPG--AHSGVRTA 317
Cdd:PLN03133 521 PDSKWYISPEEWPEETYPPWAHGPGYVVSRDIAKEVYKRHKEgrLKMFKLEDVAMGIWiaeMKKEGLEVKyeNDGRIYNE 600
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 157823527 318 GVlppsprvssfdpcfyRDLLLV-HRFLPFEMLLMWDAL 355
Cdd:PLN03133 601 GC---------------KDGYVVaHYQSPREMLCLWQKL 624
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH