NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|157822691|ref|NP_001102437.1|]
View 

neurotensin receptor type 1

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
121-369 3.90e-43

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


:

Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 152.84  E-value: 3.90e-43
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691  121 MPVELYNFiwVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALL 200
Cdd:pfam00001  32 PPWALYYL--VGGDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAIVHPLRYRRIRTPRRAKVLILVVWVLALLL 109
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691  201 AIPMLFtMGLQNRSGDGTHPgglVCTPIVDTATVKVVIQV-NTFMSFLFPMLVISILNTVIANKLTVMVHQAAEQGRvct 279
Cdd:pfam00001 110 SLPPLL-FSWLRTVEEGNVT---TCLIDFPEESTLRSYTLlSTLLGFVLPLLVILVCYTLILRTLRKRARSGASQAR--- 182
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691  280 vgthnglehstfnmtiEPGRVQALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWttflfDFYHYFYMLTNALFY 359
Cdd:pfam00001 183 ----------------AKRSSSKERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSII-----RLLPTALLITLWLAY 241
                         250
                  ....*....|
gi 157822691  360 VSSAINPILY 369
Cdd:pfam00001 242 VNSCLNPIIY 251
 
Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
121-369 3.90e-43

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 152.84  E-value: 3.90e-43
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691  121 MPVELYNFiwVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALL 200
Cdd:pfam00001  32 PPWALYYL--VGGDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAIVHPLRYRRIRTPRRAKVLILVVWVLALLL 109
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691  201 AIPMLFtMGLQNRSGDGTHPgglVCTPIVDTATVKVVIQV-NTFMSFLFPMLVISILNTVIANKLTVMVHQAAEQGRvct 279
Cdd:pfam00001 110 SLPPLL-FSWLRTVEEGNVT---TCLIDFPEESTLRSYTLlSTLLGFVLPLLVILVCYTLILRTLRKRARSGASQAR--- 182
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691  280 vgthnglehstfnmtiEPGRVQALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWttflfDFYHYFYMLTNALFY 359
Cdd:pfam00001 183 ----------------AKRSSSKERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSII-----RLLPTALLITLWLAY 241
                         250
                  ....*....|
gi 157822691  360 VSSAINPILY 369
Cdd:pfam00001 242 VNSCLNPIIY 251
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
38-376 1.72e-10

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 60.56  E-value: 1.72e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691  38 NGSGNTSESDTAGPNSDLDVNTDIYSKVLVTaIYLALFVVGTVGNsVTAFTLARKKSLQSLQSTVHYHLgslaLSDLLIL 117
Cdd:PHA03087  15 TDYYYDTYYDEDYADCDLNIGYDTNSTILIV-VYSTIFFFGLVGN-IIVIYVLTKTKIKTPMDIYLLNL----AVSDLLF 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691 118 LLAMPVELYNFIWVHhpWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLAS 197
Cdd:PHA03087  89 VMTLPFQIYYYILFQ--WSFGEFACKIVSGLYYIGFYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIIS 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691 198 ALLAIPMLFTMglQNRSGDGThpggLVCTPIVDTatvkvviqvNTFMSFLFPMLVISILNTVIAnkLTVMVhqaaeqgrV 277
Cdd:PHA03087 167 IIETTPILFVY--TTKKDHET----LICCMFYNN---------KTMNWKLFINFEINIIGMLIP--LTILL--------Y 221
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691 278 CTVGTHNGLEHSTFNmtiepgrVQALRHGVLVLrAVVIAFVVCWLPYHVRrlmfCYISDEQWTTFL-----FDFYHYFYM 352
Cdd:PHA03087 222 CYSKILITLKGINKS-------KKNKKAIKLVL-IIVILFVIFWLPFNVS----VFVYSLHILHFKsgckaVKYIQYALH 289
                        330       340
                 ....*....|....*....|....
gi 157822691 353 LTNALFYVSSAINPILYNLVSANF 376
Cdd:PHA03087 290 VTEIISLSHCCINPLIYAFVSEFF 313
 
Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
121-369 3.90e-43

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 152.84  E-value: 3.90e-43
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691  121 MPVELYNFiwVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALL 200
Cdd:pfam00001  32 PPWALYYL--VGGDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAIVHPLRYRRIRTPRRAKVLILVVWVLALLL 109
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691  201 AIPMLFtMGLQNRSGDGTHPgglVCTPIVDTATVKVVIQV-NTFMSFLFPMLVISILNTVIANKLTVMVHQAAEQGRvct 279
Cdd:pfam00001 110 SLPPLL-FSWLRTVEEGNVT---TCLIDFPEESTLRSYTLlSTLLGFVLPLLVILVCYTLILRTLRKRARSGASQAR--- 182
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691  280 vgthnglehstfnmtiEPGRVQALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWttflfDFYHYFYMLTNALFY 359
Cdd:pfam00001 183 ----------------AKRSSSKERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSII-----RLLPTALLITLWLAY 241
                         250
                  ....*....|
gi 157822691  360 VSSAINPILY 369
Cdd:pfam00001 242 VNSCLNPIIY 251
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
38-376 1.72e-10

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 60.56  E-value: 1.72e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691  38 NGSGNTSESDTAGPNSDLDVNTDIYSKVLVTaIYLALFVVGTVGNsVTAFTLARKKSLQSLQSTVHYHLgslaLSDLLIL 117
Cdd:PHA03087  15 TDYYYDTYYDEDYADCDLNIGYDTNSTILIV-VYSTIFFFGLVGN-IIVIYVLTKTKIKTPMDIYLLNL----AVSDLLF 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691 118 LLAMPVELYNFIWVHhpWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLAS 197
Cdd:PHA03087  89 VMTLPFQIYYYILFQ--WSFGEFACKIVSGLYYIGFYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIIS 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691 198 ALLAIPMLFTMglQNRSGDGThpggLVCTPIVDTatvkvviqvNTFMSFLFPMLVISILNTVIAnkLTVMVhqaaeqgrV 277
Cdd:PHA03087 167 IIETTPILFVY--TTKKDHET----LICCMFYNN---------KTMNWKLFINFEINIIGMLIP--LTILL--------Y 221
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691 278 CTVGTHNGLEHSTFNmtiepgrVQALRHGVLVLrAVVIAFVVCWLPYHVRrlmfCYISDEQWTTFL-----FDFYHYFYM 352
Cdd:PHA03087 222 CYSKILITLKGINKS-------KKNKKAIKLVL-IIVILFVIFWLPFNVS----VFVYSLHILHFKsgckaVKYIQYALH 289
                        330       340
                 ....*....|....*....|....
gi 157822691 353 LTNALFYVSSAINPILYNLVSANF 376
Cdd:PHA03087 290 VTEIISLSHCCINPLIYAFVSEFF 313
PHA02638 PHA02638
CC chemokine receptor-like protein; Provisional
67-381 8.89e-06

CC chemokine receptor-like protein; Provisional


Pssm-ID: 165021 [Multi-domain]  Cd Length: 417  Bit Score: 46.16  E-value: 8.89e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691  67 VTAIYLALFVVGTVGNSVTAFTLARKKsLQSLQSTVHYHLGslalSDLLILLLAMPVELYNFIwvhHPWAFGDAGCR--- 143
Cdd:PHA02638 101 IKIFYIIIFILGLFGNAAIIMILFCKK-IKTITDIYIFNLA----ISDLIFVIDFPFIIYNEF---DQWIFGDFMCKvis 172
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691 144 -GYYFlrdaCTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGLQN----RSGDGT 218
Cdd:PHA02638 173 aSYYI----GFFSNMFLITLMSIDRYFAILYPISFQKYRTFNIGIILCIISWILSLIITSPAYFIFEASNiifsAQDSNE 248
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691 219 HPGGLVCTPIVDTAtvkvviqvNTFMSFLFPMLV--ISILNTVIANKLTVMVHqaaeqgrVCTVGTHNGLEHSTFNMTIe 296
Cdd:PHA02638 249 TISNYQCTLIEDNE--------KNNISFLGRILQfeINILGMFIPIIIFAFCY-------IKIILKLKQLKKSKKTKSI- 312
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157822691 297 pgrvqalrhgvLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFL------FDFYHYFYMLTNALFYVSSAINPILYN 370
Cdd:PHA02638 313 -----------IIVSIIIICSLICWIPLNIVILFATMYSFKGFNSIIsehicgFIKLGYAMMLAEAISLTHCCINPLIYT 381
                        330
                 ....*....|.
gi 157822691 371 LVSANFRQVFL 381
Cdd:PHA02638 382 LIGENFRMHLL 392
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH