NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|157817384|ref|NP_001101394|]
View 

CMP-sialic acid transporter [Rattus norvegicus]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
nst TIGR00803
UDP-galactose transporter; The 10-12 TMS Nucleotide Sugar Transporters (TC 2.A.7.10) ...
71-294 9.95e-75

UDP-galactose transporter; The 10-12 TMS Nucleotide Sugar Transporters (TC 2.A.7.10)Nucleotide-sugar transporters (NSTs) are found in the Golgi apparatus and the endoplasmic reticulum of eukaryotic cells. Members of the family have been sequenced from yeast, protozoans and animals. Animals such as C. elegans possess many of these transporters. Humans have at least two closely related isoforms of the UDP-galactose:UMP exchange transporter.NSTs generally appear to function by antiport mechanisms, exchanging a nucleotide-sugar for a nucleotide. Thus, CMP-sialic acid is exchanged for CMP; GDP-mannose is preferentially exchanged for GMP, and UDP-galactose and UDP-N-acetylglucosamine are exchanged for UMP (or possibly UDP). Other nucleotide sugars (e.g., GDP-fucose, UDP-xylose, UDP-glucose, UDP-N-acetylgalactosamine, etc.) may also be transported in exchange for various nucleotides, but their transporters have not been molecularly characterized. Each compound appears to be translocated by its own transport protein. Transport allows the compound, synthesized in the cytoplasm, to be exported to the lumen of the Golgi apparatus or the endoplasmic reticulum where it is used for the synthesis of glycoproteins and glycolipids.


:

Pssm-ID: 129885  Cd Length: 222  Bit Score: 231.48  E-value: 9.95e-75
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157817384   71 KLSVPSLVYAVQNNMAFLALSNLDAAVYQVTyQLKIPCTALCTVLMLNRSLSKLQWISVFMLCGGVTLVQWKPAQAtKVV 150
Cdd:TIGR00803   1 KLSVPIHIIFKQNNLVLIALGNLLAAGKQVT-QLKILSTALMTLGSLVASLGDDQWFSLKLLKLGVAIVQMVQSSA-KTL 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157817384  151 VAQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIAVTLAGTYLSDGAEIKEKGFFYGYTYYVWFV 230
Cdd:TIGR00803  79 MFGNPVVGLSAVLSALLSSGFAGVYFEKILKDGDTMFWSRNLQLPLFGLFSTFSVLLWSDGTLISNFGFFIGYPTAVWIV 158
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 157817384  231 IFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTVASVILFGLQITLSFTLGALLVCVSIYLY 294
Cdd:TIGR00803 159 GLLNVGGGLCIGGVVRYADNTTKSFVTALSIILSTLASVRLFDAKISSTFYLGAILVFLATFLY 222
Nuc_sug_transp pfam04142
Nucleotide-sugar transporter; This family of membrane proteins transport nucleotide sugars ...
1-295 6.45e-138

Nucleotide-sugar transporter; This family of membrane proteins transport nucleotide sugars from the cytoplasm into Golgi vesicles. SLC35A1 transports CMP-sialic acid, SLC35A2 transports UDP-galactose and SLC35A3 transports UDP-GlcNAc.


:

Pssm-ID: 282054 [Multi-domain]  Cd Length: 315  Bit Score: 396.33  E-value: 6.45e-138
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157817384    1 MTLVAAAYTIALRYTRTTAEG-LYFSTTAVCITEVIKLLISVGLLAKETGSLGR-FKASLSENVLGSPKELLKLSVPSLV 78
Cdd:pfam04142  13 LTVQNASLVLTLRYSRTRKDGpRYFSTTAVLMAEIIKLVVCFLLLYKETKSDARkFLRELHKEIFNSPRDTLKVAVPSLI 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157817384   79 YAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRSLSKLQWISVFMLCGGVTLVQWKPAQAT------KVVVA 152
Cdd:pfam04142  93 YTLQNNLLYVALSNLDAATYQVTYQLKILTTAIFSVLMLGRKLSTLQWMSLFLLMAGVALVQYQQASSPesesaaAAAVE 172
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157817384  153 QNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIAVTLAGTYLSDGAEIKEKGFFYGYTYYVWFVIF 232
Cdd:pfam04142 173 QNPILGLSAVLAACFSSGFAGVYFEKILKGSNVSLWIRNIQLALFGIIFALLGAWLYDGSRISEKGFFFGYTDVVWIVVL 252
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 157817384  233 LASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTVASVILFGLQITLSFTLGALLVCVSIYLYG 295
Cdd:pfam04142 253 LQAVGGLVIAVVVKYADNILKGFATSLSIILSTVASVLLFDFFITLTFLLGAILVIAAIFLYG 315
 
Name Accession Description Interval E-value
nst TIGR00803
UDP-galactose transporter; The 10-12 TMS Nucleotide Sugar Transporters (TC 2.A.7.10) ...
71-294 9.95e-75

UDP-galactose transporter; The 10-12 TMS Nucleotide Sugar Transporters (TC 2.A.7.10)Nucleotide-sugar transporters (NSTs) are found in the Golgi apparatus and the endoplasmic reticulum of eukaryotic cells. Members of the family have been sequenced from yeast, protozoans and animals. Animals such as C. elegans possess many of these transporters. Humans have at least two closely related isoforms of the UDP-galactose:UMP exchange transporter.NSTs generally appear to function by antiport mechanisms, exchanging a nucleotide-sugar for a nucleotide. Thus, CMP-sialic acid is exchanged for CMP; GDP-mannose is preferentially exchanged for GMP, and UDP-galactose and UDP-N-acetylglucosamine are exchanged for UMP (or possibly UDP). Other nucleotide sugars (e.g., GDP-fucose, UDP-xylose, UDP-glucose, UDP-N-acetylgalactosamine, etc.) may also be transported in exchange for various nucleotides, but their transporters have not been molecularly characterized. Each compound appears to be translocated by its own transport protein. Transport allows the compound, synthesized in the cytoplasm, to be exported to the lumen of the Golgi apparatus or the endoplasmic reticulum where it is used for the synthesis of glycoproteins and glycolipids.


Pssm-ID: 129885  Cd Length: 222  Bit Score: 231.48  E-value: 9.95e-75
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157817384   71 KLSVPSLVYAVQNNMAFLALSNLDAAVYQVTyQLKIPCTALCTVLMLNRSLSKLQWISVFMLCGGVTLVQWKPAQAtKVV 150
Cdd:TIGR00803   1 KLSVPIHIIFKQNNLVLIALGNLLAAGKQVT-QLKILSTALMTLGSLVASLGDDQWFSLKLLKLGVAIVQMVQSSA-KTL 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157817384  151 VAQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIAVTLAGTYLSDGAEIKEKGFFYGYTYYVWFV 230
Cdd:TIGR00803  79 MFGNPVVGLSAVLSALLSSGFAGVYFEKILKDGDTMFWSRNLQLPLFGLFSTFSVLLWSDGTLISNFGFFIGYPTAVWIV 158
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 157817384  231 IFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTVASVILFGLQITLSFTLGALLVCVSIYLY 294
Cdd:TIGR00803 159 GLLNVGGGLCIGGVVRYADNTTKSFVTALSIILSTLASVRLFDAKISSTFYLGAILVFLATFLY 222
Nuc_sug_transp pfam04142
Nucleotide-sugar transporter; This family of membrane proteins transport nucleotide sugars ...
1-295 6.45e-138

Nucleotide-sugar transporter; This family of membrane proteins transport nucleotide sugars from the cytoplasm into Golgi vesicles. SLC35A1 transports CMP-sialic acid, SLC35A2 transports UDP-galactose and SLC35A3 transports UDP-GlcNAc.


Pssm-ID: 282054 [Multi-domain]  Cd Length: 315  Bit Score: 396.33  E-value: 6.45e-138
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157817384    1 MTLVAAAYTIALRYTRTTAEG-LYFSTTAVCITEVIKLLISVGLLAKETGSLGR-FKASLSENVLGSPKELLKLSVPSLV 78
Cdd:pfam04142  13 LTVQNASLVLTLRYSRTRKDGpRYFSTTAVLMAEIIKLVVCFLLLYKETKSDARkFLRELHKEIFNSPRDTLKVAVPSLI 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157817384   79 YAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRSLSKLQWISVFMLCGGVTLVQWKPAQAT------KVVVA 152
Cdd:pfam04142  93 YTLQNNLLYVALSNLDAATYQVTYQLKILTTAIFSVLMLGRKLSTLQWMSLFLLMAGVALVQYQQASSPesesaaAAAVE 172
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157817384  153 QNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIAVTLAGTYLSDGAEIKEKGFFYGYTYYVWFVIF 232
Cdd:pfam04142 173 QNPILGLSAVLAACFSSGFAGVYFEKILKGSNVSLWIRNIQLALFGIIFALLGAWLYDGSRISEKGFFFGYTDVVWIVVL 252
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 157817384  233 LASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTVASVILFGLQITLSFTLGALLVCVSIYLYG 295
Cdd:pfam04142 253 LQAVGGLVIAVVVKYADNILKGFATSLSIILSTVASVLLFDFFITLTFLLGAILVIAAIFLYG 315
 
Name Accession Description Interval E-value
nst TIGR00803
UDP-galactose transporter; The 10-12 TMS Nucleotide Sugar Transporters (TC 2.A.7.10) ...
71-294 9.95e-75

UDP-galactose transporter; The 10-12 TMS Nucleotide Sugar Transporters (TC 2.A.7.10)Nucleotide-sugar transporters (NSTs) are found in the Golgi apparatus and the endoplasmic reticulum of eukaryotic cells. Members of the family have been sequenced from yeast, protozoans and animals. Animals such as C. elegans possess many of these transporters. Humans have at least two closely related isoforms of the UDP-galactose:UMP exchange transporter.NSTs generally appear to function by antiport mechanisms, exchanging a nucleotide-sugar for a nucleotide. Thus, CMP-sialic acid is exchanged for CMP; GDP-mannose is preferentially exchanged for GMP, and UDP-galactose and UDP-N-acetylglucosamine are exchanged for UMP (or possibly UDP). Other nucleotide sugars (e.g., GDP-fucose, UDP-xylose, UDP-glucose, UDP-N-acetylgalactosamine, etc.) may also be transported in exchange for various nucleotides, but their transporters have not been molecularly characterized. Each compound appears to be translocated by its own transport protein. Transport allows the compound, synthesized in the cytoplasm, to be exported to the lumen of the Golgi apparatus or the endoplasmic reticulum where it is used for the synthesis of glycoproteins and glycolipids.


Pssm-ID: 129885  Cd Length: 222  Bit Score: 231.48  E-value: 9.95e-75
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157817384   71 KLSVPSLVYAVQNNMAFLALSNLDAAVYQVTyQLKIPCTALCTVLMLNRSLSKLQWISVFMLCGGVTLVQWKPAQAtKVV 150
Cdd:TIGR00803   1 KLSVPIHIIFKQNNLVLIALGNLLAAGKQVT-QLKILSTALMTLGSLVASLGDDQWFSLKLLKLGVAIVQMVQSSA-KTL 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157817384  151 VAQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIAVTLAGTYLSDGAEIKEKGFFYGYTYYVWFV 230
Cdd:TIGR00803  79 MFGNPVVGLSAVLSALLSSGFAGVYFEKILKDGDTMFWSRNLQLPLFGLFSTFSVLLWSDGTLISNFGFFIGYPTAVWIV 158
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 157817384  231 IFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTVASVILFGLQITLSFTLGALLVCVSIYLY 294
Cdd:TIGR00803 159 GLLNVGGGLCIGGVVRYADNTTKSFVTALSIILSTLASVRLFDAKISSTFYLGAILVFLATFLY 222
Nuc_sug_transp pfam04142
Nucleotide-sugar transporter; This family of membrane proteins transport nucleotide sugars ...
1-295 6.45e-138

Nucleotide-sugar transporter; This family of membrane proteins transport nucleotide sugars from the cytoplasm into Golgi vesicles. SLC35A1 transports CMP-sialic acid, SLC35A2 transports UDP-galactose and SLC35A3 transports UDP-GlcNAc.


Pssm-ID: 282054 [Multi-domain]  Cd Length: 315  Bit Score: 396.33  E-value: 6.45e-138
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157817384    1 MTLVAAAYTIALRYTRTTAEG-LYFSTTAVCITEVIKLLISVGLLAKETGSLGR-FKASLSENVLGSPKELLKLSVPSLV 78
Cdd:pfam04142  13 LTVQNASLVLTLRYSRTRKDGpRYFSTTAVLMAEIIKLVVCFLLLYKETKSDARkFLRELHKEIFNSPRDTLKVAVPSLI 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157817384   79 YAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRSLSKLQWISVFMLCGGVTLVQWKPAQAT------KVVVA 152
Cdd:pfam04142  93 YTLQNNLLYVALSNLDAATYQVTYQLKILTTAIFSVLMLGRKLSTLQWMSLFLLMAGVALVQYQQASSPesesaaAAAVE 172
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157817384  153 QNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIAVTLAGTYLSDGAEIKEKGFFYGYTYYVWFVIF 232
Cdd:pfam04142 173 QNPILGLSAVLAACFSSGFAGVYFEKILKGSNVSLWIRNIQLALFGIIFALLGAWLYDGSRISEKGFFFGYTDVVWIVVL 252
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 157817384  233 LASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTVASVILFGLQITLSFTLGALLVCVSIYLYG 295
Cdd:pfam04142 253 LQAVGGLVIAVVVKYADNILKGFATSLSIILSTVASVLLFDFFITLTFLLGAILVIAAIFLYG 315
UAA pfam08449
UAA transporter family; This family includes transporters with a specificity for ...
114-298 2.77e-04

UAA transporter family; This family includes transporters with a specificity for UDP-N-acetylglucosamine.


Pssm-ID: 285625 [Multi-domain]  Cd Length: 302  Bit Score: 40.73  E-value: 2.77e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157817384  114 VLMLNRSLSKLQWISVFMLCGGV---TLVQWKPAQATKVVVAQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSlwvr 190
Cdd:pfam08449 108 ILILGKRYSKLQYLSAFLVTLGIiifTLFSAKDKVADSVVSPNFFLIGIAMLSGALLLDAFLGNYQEKTYKKYGKH---- 183
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157817384  191 NIQMYLSGIAVTLAGTYLSDGAEIKEKGFF-------YGYTYYVWFVIFLASVGGLYTSVVVKYTdnIMKGFSAAAAIVL 263
Cdd:pfam08449 184 SKEMLFYSHLLSLPFFLLLQGDLFSAVQFCsqspdkaVLSLPSMLFYLLLNVLTQYVCIRGVFIL--ISEFGALTVTLVT 261
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 157817384  264 ST------VASVILFGLQITLSFTLGALLVCVSIYLYGLPR 298
Cdd:pfam08449 262 TLrkfvslLLSILLFGNPFTLQHWVGTLLVFLGTFLYSYSK 302
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH