NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|157278351|ref|NP_001098278|]
View 

actin, cytoplasmic 1 [Oryzias latipes]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
NBD_sugar-kinase_HSP70_actin cd00012
Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily ...
8-181 1.81e-20

Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily includes the actin family, the HSP70 family of molecular chaperones and nucleotide exchange factors, the ROK (repressor, ORF, kinase) family, the hexokinase family, the FGGY family (which includes glycerol kinase and similar carbohydrate kinases such as rhamnulokinase and xylulokinase), the exopolyphosphatase/guanosine pentaphosphate phosphohydrolase/nucleoside triphosphate diphosphohydrolase family, propionate kinase/acetate kinase family, glycerol dehydratase reactivase, 2-hydroxyglutaryl-CoA dehydratase component A, N-acetylglucosamine kinase, butyrate kinase 2, Escherichia coli YeaZ and similar glycoproteases, the cell shape-determining protein MreB, the plasmid DNA segregation factor ParM, cell cycle proteins FtsA, Pili assembly protein PilM, ethanolamine utilization protein EutJ, and similar proteins. The nucleotide-binding site residues are conserved; the nucleotide sits in a deep cleft formed between the two lobes of the nucleotide-binding domain (NBD). Substrate binding to superfamily members is associated with closure of this catalytic site cleft. The functional activities of several members of the superfamily, including hexokinases, actin, and HSP70s, are modulated by allosteric effectors, which may act on the cleft closure.


:

Pssm-ID: 212657  Cd Length: 185  Bit Score: 87.26  E-value: 1.81e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351   8 LVVDNGSGMCKAGFAGDDA---PRAVFPSIVGRPrhqgvmvgmgqkdsyvgdeaqskrgiltlkypiehGIVTNWDDMEK 84
Cdd:cd00012    1 LGIDIGSTSTKAGVADLDGeilPEEIVPTPVGRP-----------------------------------GAVTDLDELEE 45
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351  85 IWHHTFYNELRIAPEE-HPVLLTEAPLNPKANREKMTQI---------MFETFNSPAMYVAIQAVLSLYASGRT-----T 149
Cdd:cd00012   46 ALRELLKEALRQLKSEiDAVGITEPGGVPKENREVIILPnllliplalALEDLGGVPVAVVNDAVAAALAEGLFgkeedT 125
                        170       180       190
                 ....*....|....*....|....*....|..
gi 157278351 150 GIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181
Cdd:cd00012  126 VLVVDLGTGTTGIAIVEDGKGGVGAAGELGIA 157
Actin pfam00022
Actin;
3-375 0e+00

Actin;


:

Pssm-ID: 249516 [Multi-domain]  Cd Length: 367  Bit Score: 671.24  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351    3 DDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMvgmgqKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82
Cdd:pfam00022   1 DEVSALVIDNGSGTTKAGFAGEDAPRAVIPSVVGRPRGRGVE-----NKYYVGDEALSKRPGLEVRYPIEDGIVENWDAM 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351   83 EKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHT 162
Cdd:pfam00022  76 EKIWEHTFFEELRVDPEEHPLLLTEPPLNPPANREKATEIMFETFGVPALYLAKQAVLSAYASGRTTGLVVDSGAGVTSV 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351  163 VPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEmgTAASSSSLEKSYEL 242
Cdd:pfam00022 156 VPVYEGYVLQKAIRRSDLAGDDLTDYLRKLLSSRTYSFNTYAEEEVVRDIKESLCYVSDDPFGD--TAASSSPPTVSYEL 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351  243 PDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAP 322
Cdd:pfam00022 234 PDGYVIILGNERFRVPEILFNPSLIGSESAGIPELIYDSINACDVDLRPSLLANIVVTGGTTLFPGFTERLEKELAQLAP 313
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....
gi 157278351  323 STMKIKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
Cdd:pfam00022 314 SGVKVKIIAPPnERKYSAWIGGSILASLGTFQQMWVSKQEYEEHGSSVVERKCF 367
 
Name Accession Description Interval E-value
NBD_sugar-kinase_HSP70_actin cd00012
Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily ...
8-181 1.81e-20

Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily includes the actin family, the HSP70 family of molecular chaperones and nucleotide exchange factors, the ROK (repressor, ORF, kinase) family, the hexokinase family, the FGGY family (which includes glycerol kinase and similar carbohydrate kinases such as rhamnulokinase and xylulokinase), the exopolyphosphatase/guanosine pentaphosphate phosphohydrolase/nucleoside triphosphate diphosphohydrolase family, propionate kinase/acetate kinase family, glycerol dehydratase reactivase, 2-hydroxyglutaryl-CoA dehydratase component A, N-acetylglucosamine kinase, butyrate kinase 2, Escherichia coli YeaZ and similar glycoproteases, the cell shape-determining protein MreB, the plasmid DNA segregation factor ParM, cell cycle proteins FtsA, Pili assembly protein PilM, ethanolamine utilization protein EutJ, and similar proteins. The nucleotide-binding site residues are conserved; the nucleotide sits in a deep cleft formed between the two lobes of the nucleotide-binding domain (NBD). Substrate binding to superfamily members is associated with closure of this catalytic site cleft. The functional activities of several members of the superfamily, including hexokinases, actin, and HSP70s, are modulated by allosteric effectors, which may act on the cleft closure.


Pssm-ID: 212657  Cd Length: 185  Bit Score: 87.26  E-value: 1.81e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351   8 LVVDNGSGMCKAGFAGDDA---PRAVFPSIVGRPrhqgvmvgmgqkdsyvgdeaqskrgiltlkypiehGIVTNWDDMEK 84
Cdd:cd00012    1 LGIDIGSTSTKAGVADLDGeilPEEIVPTPVGRP-----------------------------------GAVTDLDELEE 45
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351  85 IWHHTFYNELRIAPEE-HPVLLTEAPLNPKANREKMTQI---------MFETFNSPAMYVAIQAVLSLYASGRT-----T 149
Cdd:cd00012   46 ALRELLKEALRQLKSEiDAVGITEPGGVPKENREVIILPnllliplalALEDLGGVPVAVVNDAVAAALAEGLFgkeedT 125
                        170       180       190
                 ....*....|....*....|....*....|..
gi 157278351 150 GIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181
Cdd:cd00012  126 VLVVDLGTGTTGIAIVEDGKGGVGAAGELGIA 157
PTZ00281 PTZ00281
actin; Provisional
1-375 0e+00

actin; Provisional


Pssm-ID: 173506  Cd Length: 376  Bit Score: 774.64  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351   1 MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWD 80
Cdd:PTZ00281   2 DGEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWD 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351  81 DMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVT 160
Cdd:PTZ00281  82 DMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVS 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 161 HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSY 240
Cdd:PTZ00281 162 HTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEAEMQTAASSSALEKSY 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 241 ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITAL 320
Cdd:PTZ00281 242 ELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTAL 321
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 157278351 321 APSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
Cdd:PTZ00281 322 APSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF 376
COG5277 COG5277
Actin and related proteins [Cytoskeleton]
1-375 1.03e-167

Actin and related proteins [Cytoskeleton]


Pssm-ID: 227602  Cd Length: 444  Bit Score: 479.23  E-value: 1.03e-167
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351   1 MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR-HQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIVT 77
Cdd:COG5277    2 TGDNVPTIVIDNGSGTTKAGFAGNDTPTTVFPSIVGRRRdEDSVMEDTEEKDTYVGNEAQNDRDNslLELRYPIENGIIL 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351  78 NWDDMEKIWHHTFYNE--LRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRT--TGIVM 153
Cdd:COG5277   82 NWDAMEQIWDYTFFNKgdLLPSPEEHPLLLTEPPLNPPSNREKITELLFETLNVPALYLAIQAVLSLYASGSSdeTGLVI 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 154 DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE-----RGYSFTTT---AEREIVRDIKEKLC-------Y 218
Cdd:COG5277  162 DSGDSVTHVIPVVDGIVLPKAVKRIDIGGRDITDYLKKLLREkyppsRGYNLKSElveYSSEIVNEIKEEVCetddesaY 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 219 VALDFEQEM----------------GTAASSSSLEKSYELPDGQVITIGNE-RFRCPEALFQPSF--------------- 266
Cdd:COG5277  242 VSLDAEEEFeeeeekpaekstestfQLSKETSIAKESKELPDGEEIEFGNEeRFKAPEILFKPELpisgleeagkidesk 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 267 --------------LGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP 332
Cdd:COG5277  322 qelvaenyeisptnLGNDIAGLPELVYQSIQICDEDVRKSLYSNIVLTGGTSKIPGFAERLQKELTSLAPSIWKVSVIPP 401
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|...
gi 157278351 333 PERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
Cdd:COG5277  402 PDPSLDAWLGASILASLETFQQLWITKEEYEEHGPDILQEKRF 444
Actin pfam00022
Actin;
3-375 0e+00

Actin;


Pssm-ID: 249516 [Multi-domain]  Cd Length: 367  Bit Score: 671.24  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351    3 DDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMvgmgqKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82
Cdd:pfam00022   1 DEVSALVIDNGSGTTKAGFAGEDAPRAVIPSVVGRPRGRGVE-----NKYYVGDEALSKRPGLEVRYPIEDGIVENWDAM 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351   83 EKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHT 162
Cdd:pfam00022  76 EKIWEHTFFEELRVDPEEHPLLLTEPPLNPPANREKATEIMFETFGVPALYLAKQAVLSAYASGRTTGLVVDSGAGVTSV 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351  163 VPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEmgTAASSSSLEKSYEL 242
Cdd:pfam00022 156 VPVYEGYVLQKAIRRSDLAGDDLTDYLRKLLSSRTYSFNTYAEEEVVRDIKESLCYVSDDPFGD--TAASSSPPTVSYEL 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351  243 PDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAP 322
Cdd:pfam00022 234 PDGYVIILGNERFRVPEILFNPSLIGSESAGIPELIYDSINACDVDLRPSLLANIVVTGGTTLFPGFTERLEKELAQLAP 313
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....
gi 157278351  323 STMKIKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
Cdd:pfam00022 314 SGVKVKIIAPPnERKYSAWIGGSILASLGTFQQMWVSKQEYEEHGSSVVERKCF 367
ACTIN smart00268
Actin; ACTIN subfamily of ACTIN/mreB/sugarkinase/Hsp70 superfamily
6-375 0e+00

Actin; ACTIN subfamily of ACTIN/mreB/sugarkinase/Hsp70 superfamily


Pssm-ID: 214592 [Multi-domain]  Cd Length: 373  Bit Score: 655.10  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351     6 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGmGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKI 85
Cdd:smart00268   2 PAIVIDNGSGTIKAGFAGEDFPQVVFPSIVGRPKDGKGMVG-DAKDIFVGDEAQEKRGGLELKYPIENGIVENWDDMEKI 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351    86 WHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPI 165
Cdd:smart00268  81 WDYTFFNELRVEPEEHPVLLTEPPMNPKSNREKILEIMFETFNFPALYIAIQAVLSLYASGRTTGLVIDSGDGVTHVVPV 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351   166 YEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAAS---SSSLEKSYEL 242
Cdd:smart00268 161 VDGYVLPHAIKRIDIAGRDITDYLKELLSERGYQFNSSAEFEIVREIKEKLCYVAEDFEKEMKLAREsseSSKLEKTYEL 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351   243 PDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAP 322
Cdd:smart00268 241 PDGNTIKVGNERFRIPEILFSPELIGLEQKGIHELVYESIQKCDIDVRKDLYENIVLSGGSTLIPGFGERLEKELKQLAP 320
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|...
gi 157278351   323 STMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
Cdd:smart00268 321 KKLKVKVIAPPERKYSVWLGGSILASLSTFEDMWITKKEYEESGSQIVERKCF 373
PTZ00280 PTZ00280
Actin-related protein 3; Provisional
7-372 1.21e-121

Actin-related protein 3; Provisional


Pssm-ID: 240343 [Multi-domain]  Cd Length: 414  Bit Score: 360.59  E-value: 1.21e-121
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351   7 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV---GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDME 83
Cdd:PTZ00280   6 VVVIDNGTGYTKMGYAGNTEPTYIIPTLIADNSKQSRRRskkGFEDLDFYIGDEALAASKSYTLTYPMKHGIVEDWDLME 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351  84 KIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYAS----------GRTTGIVM 153
Cdd:PTZ00280  86 KFWEQCIFKYLRCEPEEHYFILTEPPMNPPENREYTAEIMFETFNVKGLYIAVQAVLALRASwtskkakelgGTLTGTVI 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 154 DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGT---- 229
Cdd:PTZ00280 166 DSGDGVTHVIPVVDGYVIGSSIKHIPLAGRDITNFIQQMLRERGEPIPAEDILLLAQRIKEKYCYVAPDIAKEFEKydsd 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 230 --------AASSSSLEKSYElpdgqvITIGNERFRCPEALFQPSFLGME-SCGIHETTYNSIMKCDVDIRKDLYANTVLS 300
Cdd:PTZ00280 246 pknhfkkyTAVNSVTKKPYT------VDVGYERFLGPEMFFHPEIFSSEwTTPLPEVVDDAIQSCPIDCRRPLYKNIVLS 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 301 GGTTMYPGIADRMQKEITA----------------LAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 364
Cdd:PTZ00280 320 GGSTMFKGFDKRLQRDVRKrvdrrlkkaeelsggkLKPIPIDVNVVSHPRQRYAVWYGGSMLASSPEFEKVCHTKAEYDE 399

                 ....*...
gi 157278351 365 SGPSIVHR 372
Cdd:PTZ00280 400 YGPSICRY 407
 
Name Accession Description Interval E-value
NBD_sugar-kinase_HSP70_actin cd00012
Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily ...
8-181 1.81e-20

Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily includes the actin family, the HSP70 family of molecular chaperones and nucleotide exchange factors, the ROK (repressor, ORF, kinase) family, the hexokinase family, the FGGY family (which includes glycerol kinase and similar carbohydrate kinases such as rhamnulokinase and xylulokinase), the exopolyphosphatase/guanosine pentaphosphate phosphohydrolase/nucleoside triphosphate diphosphohydrolase family, propionate kinase/acetate kinase family, glycerol dehydratase reactivase, 2-hydroxyglutaryl-CoA dehydratase component A, N-acetylglucosamine kinase, butyrate kinase 2, Escherichia coli YeaZ and similar glycoproteases, the cell shape-determining protein MreB, the plasmid DNA segregation factor ParM, cell cycle proteins FtsA, Pili assembly protein PilM, ethanolamine utilization protein EutJ, and similar proteins. The nucleotide-binding site residues are conserved; the nucleotide sits in a deep cleft formed between the two lobes of the nucleotide-binding domain (NBD). Substrate binding to superfamily members is associated with closure of this catalytic site cleft. The functional activities of several members of the superfamily, including hexokinases, actin, and HSP70s, are modulated by allosteric effectors, which may act on the cleft closure.


Pssm-ID: 212657  Cd Length: 185  Bit Score: 87.26  E-value: 1.81e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351   8 LVVDNGSGMCKAGFAGDDA---PRAVFPSIVGRPrhqgvmvgmgqkdsyvgdeaqskrgiltlkypiehGIVTNWDDMEK 84
Cdd:cd00012    1 LGIDIGSTSTKAGVADLDGeilPEEIVPTPVGRP-----------------------------------GAVTDLDELEE 45
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351  85 IWHHTFYNELRIAPEE-HPVLLTEAPLNPKANREKMTQI---------MFETFNSPAMYVAIQAVLSLYASGRT-----T 149
Cdd:cd00012   46 ALRELLKEALRQLKSEiDAVGITEPGGVPKENREVIILPnllliplalALEDLGGVPVAVVNDAVAAALAEGLFgkeedT 125
                        170       180       190
                 ....*....|....*....|....*....|..
gi 157278351 150 GIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181
Cdd:cd00012  126 VLVVDLGTGTTGIAIVEDGKGGVGAAGELGIA 157
PTZ00281 PTZ00281
actin; Provisional
1-375 0e+00

actin; Provisional


Pssm-ID: 173506  Cd Length: 376  Bit Score: 774.64  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351   1 MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWD 80
Cdd:PTZ00281   2 DGEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWD 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351  81 DMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVT 160
Cdd:PTZ00281  82 DMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVS 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 161 HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSY 240
Cdd:PTZ00281 162 HTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEAEMQTAASSSALEKSY 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 241 ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITAL 320
Cdd:PTZ00281 242 ELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTAL 321
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 157278351 321 APSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
Cdd:PTZ00281 322 APSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF 376
PTZ00004 PTZ00004
actin-2; Provisional
1-375 0e+00

actin-2; Provisional


Pssm-ID: 240225  Cd Length: 378  Bit Score: 713.85  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351   1 MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWD 80
Cdd:PTZ00004   2 SVEETNAAVVDNGSGMVKAGFAGDDAPRCVFPSIVGRPKNPGIMVGMEEKDCYVGDEAQDKRGILTLKYPIEHGIVTNWD 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351  81 DMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVT 160
Cdd:PTZ00004  82 DMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETHNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVS 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 161 HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSL-EKS 239
Cdd:PTZ00004 162 HTVPIYEGYSLPHAIHRLDVAGRDLTEYMMKILHERGTTFTTTAEKEIVRDIKEKLCYIALDFDEEMGNSAGSSDKyEES 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 240 YELPDGQVITIGNERFRCPEALFQPSFLGMESC-GIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEIT 318
Cdd:PTZ00004 242 YELPDGTIITVGSERFRCPEALFQPSLIGKEEPpGIHELTFQSINKCDIDIRKDLYGNIVLSGGTTMYRGLPERLTKELT 321
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 157278351 319 ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
Cdd:PTZ00004 322 TLAPSTMKIKVVAPPERKYSVWIGGSILSSLPTFQQMWVTKEEYDESGPSIVHRKCF 378
PTZ00466 PTZ00466
actin-like protein; Provisional
8-375 9.13e-177

actin-like protein; Provisional


Pssm-ID: 240426  Cd Length: 380  Bit Score: 499.86  E-value: 9.13e-177
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351   8 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWH 87
Cdd:PTZ00466  15 IIIDNGTGYIKAGFAGEDVPNLVFPSYVGRPKYKRVMAGAVEGNIFVGNKAEEYRGLLKVTYPINHGIIENWNDMENIWI 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351  88 HTfYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYE 167
Cdd:PTZ00466  95 HV-YNSMKINSEEHPVLLTEAPLNPQKNKEKIAEVFFETFNVPALFISIQAILSLYSCGKTNGTVLDCGDGVCHCVSIYE 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 168 GYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEmgtaasSSSLEKS-----YEL 242
Cdd:PTZ00466 174 GYSITNTITRTDVAGRDITTYLGYLLRKNGHLFNTSAEMEVVKNMKENCCYVSFNMNKE------KNSSEKAlttlpYIL 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 243 PDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAP 322
Cdd:PTZ00466 248 PDGSQILIGSERYRAPEVLFNPSILGLEYLGLSELIVTSITRADMDLRRTLYSHIVLSGGTTMFHGFGDRLLNEIRKFAP 327
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|...
gi 157278351 323 STMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
Cdd:PTZ00466 328 KDITIRISAPPERKFSTFIGGSILASLATFKKIWISKQEFDEYGSVILHRKTF 380
PTZ00452 PTZ00452
actin; Provisional
1-375 4.21e-175

actin; Provisional


Pssm-ID: 185631  Cd Length: 375  Bit Score: 495.81  E-value: 4.21e-175
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351   1 MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWD 80
Cdd:PTZ00452   1 MQAQYPAVVIDNGSGYCKIGIAGDDAPTSCFPAIVGRSKQNDGIFSTFNKEYYVGEEAQAKRGVLAIKEPIQNGIINSWD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351  81 DMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVT 160
Cdd:PTZ00452  81 DIEIIWHHAFYNELCMSPEDQPVFMTDAPMNSKFNRERMTQIMFETFNTPCLYISNEAVLSLYTSGKTIGLVVDSGEGVT 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 161 HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSY 240
Cdd:PTZ00452 161 HCVPVFEGHQIPQAITKINLAGRLCTDYLTQILQELGYSLTEPHQRIIVKNIKERLCYTALDPQDEKRIYKESNSQDSPY 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 241 ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITAL 320
Cdd:PTZ00452 241 KLPDGNILTIKSQKFRCSEILFQPKLIGLEVAGIHHLAYSSIKKCDLDLRQELCRNIVLSGGTTLFPGIANRLSNELTNL 320
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 157278351 321 APSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
Cdd:PTZ00452 321 VPSQLKIQVAAPPDRRFSAWIGGSIQCTLSTQQPQWIKRQEYDEQGPSIVHRKCF 375
COG5277 COG5277
Actin and related proteins [Cytoskeleton]
1-375 1.03e-167

Actin and related proteins [Cytoskeleton]


Pssm-ID: 227602  Cd Length: 444  Bit Score: 479.23  E-value: 1.03e-167
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351   1 MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR-HQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIVT 77
Cdd:COG5277    2 TGDNVPTIVIDNGSGTTKAGFAGNDTPTTVFPSIVGRRRdEDSVMEDTEEKDTYVGNEAQNDRDNslLELRYPIENGIIL 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351  78 NWDDMEKIWHHTFYNE--LRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRT--TGIVM 153
Cdd:COG5277   82 NWDAMEQIWDYTFFNKgdLLPSPEEHPLLLTEPPLNPPSNREKITELLFETLNVPALYLAIQAVLSLYASGSSdeTGLVI 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 154 DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE-----RGYSFTTT---AEREIVRDIKEKLC-------Y 218
Cdd:COG5277  162 DSGDSVTHVIPVVDGIVLPKAVKRIDIGGRDITDYLKKLLREkyppsRGYNLKSElveYSSEIVNEIKEEVCetddesaY 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 219 VALDFEQEM----------------GTAASSSSLEKSYELPDGQVITIGNE-RFRCPEALFQPSF--------------- 266
Cdd:COG5277  242 VSLDAEEEFeeeeekpaekstestfQLSKETSIAKESKELPDGEEIEFGNEeRFKAPEILFKPELpisgleeagkidesk 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 267 --------------LGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP 332
Cdd:COG5277  322 qelvaenyeisptnLGNDIAGLPELVYQSIQICDEDVRKSLYSNIVLTGGTSKIPGFAERLQKELTSLAPSIWKVSVIPP 401
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|...
gi 157278351 333 PERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
Cdd:COG5277  402 PDPSLDAWLGASILASLETFQQLWITKEEYEEHGPDILQEKRF 444
Actin pfam00022
Actin;
3-375 0e+00

Actin;


Pssm-ID: 249516 [Multi-domain]  Cd Length: 367  Bit Score: 671.24  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351    3 DDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMvgmgqKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82
Cdd:pfam00022   1 DEVSALVIDNGSGTTKAGFAGEDAPRAVIPSVVGRPRGRGVE-----NKYYVGDEALSKRPGLEVRYPIEDGIVENWDAM 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351   83 EKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHT 162
Cdd:pfam00022  76 EKIWEHTFFEELRVDPEEHPLLLTEPPLNPPANREKATEIMFETFGVPALYLAKQAVLSAYASGRTTGLVVDSGAGVTSV 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351  163 VPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEmgTAASSSSLEKSYEL 242
Cdd:pfam00022 156 VPVYEGYVLQKAIRRSDLAGDDLTDYLRKLLSSRTYSFNTYAEEEVVRDIKESLCYVSDDPFGD--TAASSSPPTVSYEL 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351  243 PDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAP 322
Cdd:pfam00022 234 PDGYVIILGNERFRVPEILFNPSLIGSESAGIPELIYDSINACDVDLRPSLLANIVVTGGTTLFPGFTERLEKELAQLAP 313
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....
gi 157278351  323 STMKIKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
Cdd:pfam00022 314 SGVKVKIIAPPnERKYSAWIGGSILASLGTFQQMWVSKQEYEEHGSSVVERKCF 367
ACTIN smart00268
Actin; ACTIN subfamily of ACTIN/mreB/sugarkinase/Hsp70 superfamily
6-375 0e+00

Actin; ACTIN subfamily of ACTIN/mreB/sugarkinase/Hsp70 superfamily


Pssm-ID: 214592 [Multi-domain]  Cd Length: 373  Bit Score: 655.10  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351     6 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGmGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKI 85
Cdd:smart00268   2 PAIVIDNGSGTIKAGFAGEDFPQVVFPSIVGRPKDGKGMVG-DAKDIFVGDEAQEKRGGLELKYPIENGIVENWDDMEKI 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351    86 WHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPI 165
Cdd:smart00268  81 WDYTFFNELRVEPEEHPVLLTEPPMNPKSNREKILEIMFETFNFPALYIAIQAVLSLYASGRTTGLVIDSGDGVTHVVPV 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351   166 YEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAAS---SSSLEKSYEL 242
Cdd:smart00268 161 VDGYVLPHAIKRIDIAGRDITDYLKELLSERGYQFNSSAEFEIVREIKEKLCYVAEDFEKEMKLAREsseSSKLEKTYEL 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351   243 PDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAP 322
Cdd:smart00268 241 PDGNTIKVGNERFRIPEILFSPELIGLEQKGIHELVYESIQKCDIDVRKDLYENIVLSGGSTLIPGFGERLEKELKQLAP 320
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|...
gi 157278351   323 STMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
Cdd:smart00268 321 KKLKVKVIAPPERKYSVWLGGSILASLSTFEDMWITKKEYEESGSQIVERKCF 373
PTZ00280 PTZ00280
Actin-related protein 3; Provisional
7-372 1.21e-121

Actin-related protein 3; Provisional


Pssm-ID: 240343 [Multi-domain]  Cd Length: 414  Bit Score: 360.59  E-value: 1.21e-121
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351   7 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV---GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDME 83
Cdd:PTZ00280   6 VVVIDNGTGYTKMGYAGNTEPTYIIPTLIADNSKQSRRRskkGFEDLDFYIGDEALAASKSYTLTYPMKHGIVEDWDLME 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351  84 KIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYAS----------GRTTGIVM 153
Cdd:PTZ00280  86 KFWEQCIFKYLRCEPEEHYFILTEPPMNPPENREYTAEIMFETFNVKGLYIAVQAVLALRASwtskkakelgGTLTGTVI 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 154 DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGT---- 229
Cdd:PTZ00280 166 DSGDGVTHVIPVVDGYVIGSSIKHIPLAGRDITNFIQQMLRERGEPIPAEDILLLAQRIKEKYCYVAPDIAKEFEKydsd 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 230 --------AASSSSLEKSYElpdgqvITIGNERFRCPEALFQPSFLGME-SCGIHETTYNSIMKCDVDIRKDLYANTVLS 300
Cdd:PTZ00280 246 pknhfkkyTAVNSVTKKPYT------VDVGYERFLGPEMFFHPEIFSSEwTTPLPEVVDDAIQSCPIDCRRPLYKNIVLS 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157278351 301 GGTTMYPGIADRMQKEITA----------------LAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 364
Cdd:PTZ00280 320 GGSTMFKGFDKRLQRDVRKrvdrrlkkaeelsggkLKPIPIDVNVVSHPRQRYAVWYGGSMLASSPEFEKVCHTKAEYDE 399

                 ....*...
gi 157278351 365 SGPSIVHR 372
Cdd:PTZ00280 400 YGPSICRY 407
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH