NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|157150315|ref|YP_001449915|]
View 

phosphoprotein phosphatase [Streptococcus gordonii str. Challis substr. CH1]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
6-240 2.57e-59

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


:

Pssm-ID: 238083  Cd Length: 254  Bit Score: 190.23  E-value: 2.57e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315   6 LTDVGKKRTNNQDFVNHFVNRSGMP--LIVLADGMGGHRAGNIASEMAVTDLGAAWVDTQIDSVNGVRDWFAEHLEAENK 83
Cdd:cd00143    5 VSDKGGDRKTNEDAVVIKPNLNNEDggLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDIEEALRKAFLRADE 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315  84 KIHEVGQSD-EYKGMGTTLEAIAIIGNQAIYAHIGDSRIGLVRGEEYKQLTSDHSLVNALLKAGqITAEEAE----RHPQ 158
Cdd:cd00143   85 EILEEAQDEpDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERER-IEKAGGRvsngRVPG 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315 159 RNIITQSIGQKD-----EIQPDFGIITL-EEGDYIVINSDGLSNMVAGSEIYDILKSDL---TLSEKAQTLIRFANNAGG 229
Cdd:cd00143  164 VLAVTRALGDFDlkpgvSAEPDVTVVKLtEDDDFLILASDGLWDVLSNQEAVDIVRSELakeDLQEAAQELVDLALRRGS 243
                        250
                 ....*....|.
gi 157150315 230 LDNITVALVYF 240
Cdd:cd00143  244 HDNITVVVVRL 254
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
6-240 2.57e-59

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 190.23  E-value: 2.57e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315   6 LTDVGKKRTNNQDFVNHFVNRSGMP--LIVLADGMGGHRAGNIASEMAVTDLGAAWVDTQIDSVNGVRDWFAEHLEAENK 83
Cdd:cd00143    5 VSDKGGDRKTNEDAVVIKPNLNNEDggLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDIEEALRKAFLRADE 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315  84 KIHEVGQSD-EYKGMGTTLEAIAIIGNQAIYAHIGDSRIGLVRGEEYKQLTSDHSLVNALLKAGqITAEEAE----RHPQ 158
Cdd:cd00143   85 EILEEAQDEpDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERER-IEKAGGRvsngRVPG 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315 159 RNIITQSIGQKD-----EIQPDFGIITL-EEGDYIVINSDGLSNMVAGSEIYDILKSDL---TLSEKAQTLIRFANNAGG 229
Cdd:cd00143  164 VLAVTRALGDFDlkpgvSAEPDVTVVKLtEDDDFLILASDGLWDVLSNQEAVDIVRSELakeDLQEAAQELVDLALRRGS 243
                        250
                 ....*....|.
gi 157150315 230 LDNITVALVYF 240
Cdd:cd00143  244 HDNITVVVVRL 254
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
1-245 1.14e-85

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 258.06  E-value: 1.14e-85
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315   1 MEIALLTDVGKKRTNNQDFVNHFVNRSGMP--LIVLADGMGGHRAGNIASEMAVTDLGAAWVDTQIDSVNGV-RDWFAEH 77
Cdd:COG0631    8 LKVAGLSDVGTVRKHNEDAFLIKPNENGNLllLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSLNESlEELLKEA 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315  78 LEAENKKIHEVGQSDE-YKGMGTTLEAIAIIGNQAIYAHIGDSRIGLVRGEEYKQLTSDHSLVNALLKAGQITAEEAERH 156
Cdd:COG0631   88 ILKANEAIAEEGQLNEdVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEEARSH 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315 157 PQRNIITQSIGQKDEIQPDFGIITLEEGDYIVINSDGLSNMVAGSEIYDILKSDLTLSEKAQTLIRFANNAGGLDNITVA 236
Cdd:COG0631  168 PRRNALTRALGDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILKNSETPQEAADKLIELALEGGGPDNITVV 247

                 ....*....
gi 157150315 237 LVYFDKEEE 245
Cdd:COG0631  248 LVRLNGEGE 256
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
6-238 2.94e-30

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 114.01  E-value: 2.94e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315     6 LTDVGKKRTNNQDFVNHFVNRSGMP-LIVLADGMGGHRAGNIASEMAVTdlgaaWVDTQIDSVNGVRDWFAEHLEAENKK 84
Cdd:smart00332  13 LSSMQGVRKPMEDAHVITPDLSDSGgFFGVFDGHGGSEAAKFLSKNLPE-----ILAEELIKEKDELEDVEEALRKAFLS 87
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315    85 IHEVGQSDEYKGMGTTLEAIAIIGNQAIYAHIGDSRIGLVRGEEYKQLTSDHSLVNAlLKAGQITAE----EAERHPQRN 160
Cdd:smart00332  88 TDEEILEELEALSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKPSNE-DERARIEAAggfvINGRVNGVL 166
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315   161 IITQSIGQKDEIQ-----PDFGIITL-EEGDYIVINSDGLSNMVAGSEIYDILKSDLT--LSEKAQTLIRFANNAGGLDN 232
Cdd:smart00332 167 ALSRAIGDFFLKPyvsaePDVTVVELtEKDDFLILASDGLWDVLSNQEVVDIVRKHLSkdPKEAAKRLIDLALARGSKDN 246

                   ....*.
gi 157150315   233 ITVALV 238
Cdd:smart00332 247 ITVVVV 252
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
35-233 6.94e-19

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 82.02  E-value: 6.94e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315   35 ADGMGGHRAGNIASEMAVTdlgaaWVDTQI--DSVNGVRDWFAEHLEAENKKIHEVGQSDEYKGMGTTLEAIAIIGNQAI 112
Cdd:pfam00481  40 FDGHGGSEAAKYAGKHLHT-----ILALRRsfLTLRKLEDALRESFLETDEELRSDAANHEDLSSGSTAVVALIRGNKLY 114
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315  113 YAHIGDSRIGLVR-GEEYKQLTSDHSLVNaLLKAGQITAEEAeRHPQRNII------TQSIG---QKDEIQ-----PDFG 177
Cdd:pfam00481 115 VANVGDSRAVLCRnGGAIKQLTEDHKPSD-EDERRRIRAAGG-FVSRNGRVngvlavSRAFGdfdLKPGEQpvsaePDIT 192
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 157150315  178 IITLEEGD-YIVINSDGLSNMVAGSEIYDILKSDL----TLSEKAQTLIRFANNAGGLDNI 233
Cdd:pfam00481 193 SHKITEDDeFLILACDGLWDVLSDQEVVDIVRSNLsdggDPMEAAEKLVDEAIAYGSEDNI 253
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
7-238 6.62e-33

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 125.55  E-value: 6.62e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315   7 TDVGKKRTNNQDF--VNHFVNR---------SGMPLIVLADGMGGHRAGNIASEMAVTDLgaawvdtqidsvngvRDWFA 75
Cdd:PRK14559 381 TDVGRQRHHNEDYfgINTRIQKlenphgrivQARGLYILCDGMGGHAAGEVASALAVETL---------------QQYFQ 445
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315  76 EHLEAE--------------NKKIHEVGQSDEYKG---MGTTLEAIAIIGNQAIYAHIGDSRIGLV---RGEEykQLTSD 135
Cdd:PRK14559 446 QHWQDElpdeetireaiylaNEAIYDLNQQNARSGsgrMGTTLVMALVQDTQVAVAHVGDSRLYRVtrkGGLE--QLTVD 523
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315 136 HSLVNALLKAGqITAEEAERHPQRNIITQSIGQKDE--IQPDFGIITLEEGDYIVINSDGLSN--MVagsEIY------D 205
Cdd:PRK14559 524 HEVGQREIQRG-VEPQIAYARPDAYQLTQALGPRDNsaIQPDIQFLEIEEDTLLLLCSDGLSDndLL---ETHwqthllP 599
                        250       260       270
                 ....*....|....*....|....*....|...
gi 157150315 206 ILKSDLTLSEKAQTLIRFANNAGGLDNITVALV 238
Cdd:PRK14559 600 LLSSSANLDQGLNKLIDLANQYNGHDNITAILV 632
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
6-240 2.57e-59

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 190.23  E-value: 2.57e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315   6 LTDVGKKRTNNQDFVNHFVNRSGMP--LIVLADGMGGHRAGNIASEMAVTDLGAAWVDTQIDSVNGVRDWFAEHLEAENK 83
Cdd:cd00143    5 VSDKGGDRKTNEDAVVIKPNLNNEDggLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDIEEALRKAFLRADE 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315  84 KIHEVGQSD-EYKGMGTTLEAIAIIGNQAIYAHIGDSRIGLVRGEEYKQLTSDHSLVNALLKAGqITAEEAE----RHPQ 158
Cdd:cd00143   85 EILEEAQDEpDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERER-IEKAGGRvsngRVPG 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315 159 RNIITQSIGQKD-----EIQPDFGIITL-EEGDYIVINSDGLSNMVAGSEIYDILKSDL---TLSEKAQTLIRFANNAGG 229
Cdd:cd00143  164 VLAVTRALGDFDlkpgvSAEPDVTVVKLtEDDDFLILASDGLWDVLSNQEAVDIVRSELakeDLQEAAQELVDLALRRGS 243
                        250
                 ....*....|.
gi 157150315 230 LDNITVALVYF 240
Cdd:cd00143  244 HDNITVVVVRL 254
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
1-245 1.14e-85

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 258.06  E-value: 1.14e-85
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315   1 MEIALLTDVGKKRTNNQDFVNHFVNRSGMP--LIVLADGMGGHRAGNIASEMAVTDLGAAWVDTQIDSVNGV-RDWFAEH 77
Cdd:COG0631    8 LKVAGLSDVGTVRKHNEDAFLIKPNENGNLllLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSLNESlEELLKEA 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315  78 LEAENKKIHEVGQSDE-YKGMGTTLEAIAIIGNQAIYAHIGDSRIGLVRGEEYKQLTSDHSLVNALLKAGQITAEEAERH 156
Cdd:COG0631   88 ILKANEAIAEEGQLNEdVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEEARSH 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315 157 PQRNIITQSIGQKDEIQPDFGIITLEEGDYIVINSDGLSNMVAGSEIYDILKSDLTLSEKAQTLIRFANNAGGLDNITVA 236
Cdd:COG0631  168 PRRNALTRALGDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILKNSETPQEAADKLIELALEGGGPDNITVV 247

                 ....*....
gi 157150315 237 LVYFDKEEE 245
Cdd:COG0631  248 LVRLNGEGE 256
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
6-238 2.94e-30

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 114.01  E-value: 2.94e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315     6 LTDVGKKRTNNQDFVNHFVNRSGMP-LIVLADGMGGHRAGNIASEMAVTdlgaaWVDTQIDSVNGVRDWFAEHLEAENKK 84
Cdd:smart00332  13 LSSMQGVRKPMEDAHVITPDLSDSGgFFGVFDGHGGSEAAKFLSKNLPE-----ILAEELIKEKDELEDVEEALRKAFLS 87
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315    85 IHEVGQSDEYKGMGTTLEAIAIIGNQAIYAHIGDSRIGLVRGEEYKQLTSDHSLVNAlLKAGQITAE----EAERHPQRN 160
Cdd:smart00332  88 TDEEILEELEALSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKPSNE-DERARIEAAggfvINGRVNGVL 166
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315   161 IITQSIGQKDEIQ-----PDFGIITL-EEGDYIVINSDGLSNMVAGSEIYDILKSDLT--LSEKAQTLIRFANNAGGLDN 232
Cdd:smart00332 167 ALSRAIGDFFLKPyvsaePDVTVVELtEKDDFLILASDGLWDVLSNQEVVDIVRKHLSkdPKEAAKRLIDLALARGSKDN 246

                   ....*.
gi 157150315   233 ITVALV 238
Cdd:smart00332 247 ITVVVV 252
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
35-233 6.94e-19

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 82.02  E-value: 6.94e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315   35 ADGMGGHRAGNIASEMAVTdlgaaWVDTQI--DSVNGVRDWFAEHLEAENKKIHEVGQSDEYKGMGTTLEAIAIIGNQAI 112
Cdd:pfam00481  40 FDGHGGSEAAKYAGKHLHT-----ILALRRsfLTLRKLEDALRESFLETDEELRSDAANHEDLSSGSTAVVALIRGNKLY 114
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315  113 YAHIGDSRIGLVR-GEEYKQLTSDHSLVNaLLKAGQITAEEAeRHPQRNII------TQSIG---QKDEIQ-----PDFG 177
Cdd:pfam00481 115 VANVGDSRAVLCRnGGAIKQLTEDHKPSD-EDERRRIRAAGG-FVSRNGRVngvlavSRAFGdfdLKPGEQpvsaePDIT 192
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 157150315  178 IITLEEGD-YIVINSDGLSNMVAGSEIYDILKSDL----TLSEKAQTLIRFANNAGGLDNI 233
Cdd:pfam00481 193 SHKITEDDeFLILACDGLWDVLSDQEVVDIVRSNLsdggDPMEAAEKLVDEAIAYGSEDNI 253
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
18-222 2.71e-17

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 76.62  E-value: 2.71e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315    18 DFVNHFVNRSGMPLIVLADGMGGHRAGNIASEMAVTDLGAAWvdtqidsvnGVRDWFAEHLEAENKKIHEvgqsDEYKGM 97
Cdd:smart00331  19 DFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLL---------SEGISLSQILERLNRAIYE----NGEDGM 85
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315    98 GTTLEAIAI--IGNQAIYAHIGDSRIGLVRGEEYKQLTSDHSlvnallkagqitaeeaerhpqrniiTQSIGQKDEIQPD 175
Cdd:smart00331  86 FATLFLALYdfAGGTLSYANAGHSPPYLLRADGGLVEDLDDL-------------------------GAPLGLEPDVEVD 140
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*....
gi 157150315   176 FGIITLEEGDYIVINSDGLSNMVAGSEIYDILKS--DLTLSEKAQTLIR 222
Cdd:smart00331 141 VRELTLEPGDLLLLYTDGLTEARNPERLEELLEEllGSPPAEIAQRILE 189
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
11-204 2.26e-15

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 71.19  E-value: 2.26e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315   11 KKRTNNQDFVNHFVNRSGmPLIVLADGMGGHRAGNIASEMAVT-------DLGAAWVDTQIDSV-----NGVRDWFAEHL 78
Cdd:pfam13672   7 RRGLPCQDAFAYRVLSDG-WLIAVADGAGSAKYSDVGARLAVEaavealrELLDSGELPELEALvrqilNDILALVRQEA 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315   79 EAENKKIHEvgqsdeykgMGTTLEAIAIIGNQAIYAHIGDSRIGLVRGE-EYKQLTSDHSlvnallkagqitAEEAErhp 157
Cdd:pfam13672  86 AAQGLEPRD---------YATTLLLAVITPGGIVFFQIGDGAIVVRDRDgELQLLSEPDS------------GEYAN--- 141
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*...
gi 157150315  158 qrniITQSIGQKDEIQ-PDFGIITLEEGDYIVINSDGLSNMVAGSEIY 204
Cdd:pfam13672 142 ----ETTFLTSPDALEeFRIRRLTLEPGDALALMTDGLSDSLVTEEPF 185
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
7-238 6.62e-33

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 125.55  E-value: 6.62e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315   7 TDVGKKRTNNQDF--VNHFVNR---------SGMPLIVLADGMGGHRAGNIASEMAVTDLgaawvdtqidsvngvRDWFA 75
Cdd:PRK14559 381 TDVGRQRHHNEDYfgINTRIQKlenphgrivQARGLYILCDGMGGHAAGEVASALAVETL---------------QQYFQ 445
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315  76 EHLEAE--------------NKKIHEVGQSDEYKG---MGTTLEAIAIIGNQAIYAHIGDSRIGLV---RGEEykQLTSD 135
Cdd:PRK14559 446 QHWQDElpdeetireaiylaNEAIYDLNQQNARSGsgrMGTTLVMALVQDTQVAVAHVGDSRLYRVtrkGGLE--QLTVD 523
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157150315 136 HSLVNALLKAGqITAEEAERHPQRNIITQSIGQKDE--IQPDFGIITLEEGDYIVINSDGLSN--MVagsEIY------D 205
Cdd:PRK14559 524 HEVGQREIQRG-VEPQIAYARPDAYQLTQALGPRDNsaIQPDIQFLEIEEDTLLLLCSDGLSDndLL---ETHwqthllP 599
                        250       260       270
                 ....*....|....*....|....*....|...
gi 157150315 206 ILKSDLTLSEKAQTLIRFANNAGGLDNITVALV 238
Cdd:PRK14559 600 LLSSSANLDQGLNKLIDLANQYNGHDNITAILV 632
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH