NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|15604980|ref|NP_219764.1|]
View 

protein phosphatase [Chlamydia trachomatis D/UW-3/CX]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
8-246 1.10e-51

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


:

Pssm-ID: 238083  Cd Length: 254  Bit Score: 170.58  E-value: 1.10e-51
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980   8 YFGLSDVGLVRHNNEDFWQVNYDSQ-----LIAIADGMGGHRAGEVASYEAVGNLMQLVDLHKVDLErfgdEQYKESIKT 82
Cdd:cd00143   2 SAGVSDKGGDRKTNEDAVVIKPNLNnedggLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSE----EDIEEALRK 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980  83 IVSEINLLIYRQGLSNEQFKGMGTTLSCMQFRRGKAWLFHVGDCRVYRLRNKMLERLTEDHSLAN-HLASRYGLSKQSV- 160
Cdd:cd00143  78 AFLRADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNeEERERIEKAGGRVs 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980 161 -KRYPGRNVLTNVLGSR---PHVSL--DIREM-SYEKEDLFVFCSDGLTSAVSDHDMLDILTQT---TTLEEGGNILISL 230
Cdd:cd00143 158 nGRVPGVLAVTRALGDFdlkPGVSAepDVTVVkLTEDDDFLILASDGLWDVLSNQEAVDIVRSElakEDLQEAAQELVDL 237
                       250
                ....*....|....*.
gi 15604980 231 ANSRGGRDNATVILVR 246
Cdd:cd00143 238 ALRRGSHDNITVVVVR 253
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
8-246 1.10e-51

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 170.58  E-value: 1.10e-51
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980   8 YFGLSDVGLVRHNNEDFWQVNYDSQ-----LIAIADGMGGHRAGEVASYEAVGNLMQLVDLHKVDLErfgdEQYKESIKT 82
Cdd:cd00143   2 SAGVSDKGGDRKTNEDAVVIKPNLNnedggLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSE----EDIEEALRK 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980  83 IVSEINLLIYRQGLSNEQFKGMGTTLSCMQFRRGKAWLFHVGDCRVYRLRNKMLERLTEDHSLAN-HLASRYGLSKQSV- 160
Cdd:cd00143  78 AFLRADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNeEERERIEKAGGRVs 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980 161 -KRYPGRNVLTNVLGSR---PHVSL--DIREM-SYEKEDLFVFCSDGLTSAVSDHDMLDILTQT---TTLEEGGNILISL 230
Cdd:cd00143 158 nGRVPGVLAVTRALGDFdlkPGVSAepDVTVVkLTEDDDFLILASDGLWDVLSNQEAVDIVRSElakEDLQEAAQELVDL 237
                       250
                ....*....|....*.
gi 15604980 231 ANSRGGRDNATVILVR 246
Cdd:cd00143 238 ALRRGSHDNITVVVVR 253
PTC1 COG0631
Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];
1-246 8.95e-86

Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];


Pssm-ID: 223704  Cd Length: 262  Bit Score: 258.44  E-value: 8.95e-86
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980   1 MIVADFEYFGLSDVGLVRHNNED-----FWQVNYDSQLIAIADGMGGHRAGEVASYEAVGNLMQLVDLHKVDLerfGDEQ 75
Cdd:COG0631   3 SGILSLKVAGLSDVGTVRKHNEDaflikPNENGNLLLLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNS---LNES 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980  76 YKESIKTIVSEINLLIYRQGLSNEQFKGMGTTLSCMQFRRGKAWLFHVGDCRVYRLRNKMLERLTEDHSLANHLASRYGL 155
Cdd:COG0631  80 LEELLKEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGII 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980 156 SKQSVKRYPGRNVLTNVLGSRPHVSLDIREMSYEKEDLFVFCSDGLTSAVSDHDMLDILTQTTTLEEGGNILISLANSRG 235
Cdd:COG0631 160 TPEEARSHPRRNALTRALGDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILKNSETPQEAADKLIELALEGG 239
                       250
                ....*....|.
gi 15604980 236 GRDNATVILVR 246
Cdd:COG0631 240 GPDNITVVLVR 250
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
8-245 2.44e-42

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 145.98  E-value: 2.44e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980      8 YFGLSDVGLVRHNNEDFWQVNYDSQ----LIAIADGMGGHRAGEVASYEAVGNLMQLVDLHKVDlerfgDEQYKESIKTI 83
Cdd:smart00332  10 RYGLSSMQGVRKPMEDAHVITPDLSdsggFFGVFDGHGGSEAAKFLSKNLPEILAEELIKEKDE-----LEDVEEALRKA 84
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980     84 VSEINLLIYRQGLSneqfkGMGTTLSCMQFRRGKAWLFHVGDCRVYRLRNKMLERLTEDHSLAN-HLASRYGLSKQSVK- 161
Cdd:smart00332  85 FLSTDEEILEELEA-----LSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKPSNeDERARIEAAGGFVIn 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980    162 -RYPGRNVLTNVLG---------SRPHVSldIREMsYEKEDLFVFCSDGLTSAVSDHDMLDILTQTTT--LEEGGNILIS 229
Cdd:smart00332 160 gRVNGVLALSRAIGdfflkpyvsAEPDVT--VVEL-TEKDDFLILASDGLWDVLSNQEVVDIVRKHLSkdPKEAAKRLID 236
                          250
                   ....*....|....*.
gi 15604980    230 LANSRGGRDNATVILV 245
Cdd:smart00332 237 LALARGSKDNITVVVV 252
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
20-209 1.42e-15

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 71.57  E-value: 1.42e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980    20 NNED--FWQVNYDSQLIAIADGMGGHRAGEVASYEAVgnlmQLVDLHkvdLERFGDEQYKESIKTIVSEINLLIYRQGLS 97
Cdd:pfam13672  11 PCQDafAYRVLSDGWLIAVADGAGSAKYSDVGARLAV----EAAVEA---LRELLDSGELPELEALVRQILNDILALVRQ 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980    98 NEQFKGM-----GTTLSCMQFRRGKAWLFHVGDCR-VYRLRNKMLERLTEDHSLAnhlasryglskqsvkrYPgrNVLTN 171
Cdd:pfam13672  84 EAAAQGLeprdyATTLLLAVITPGGIVFFQIGDGAiVVRDRDGELQLLSEPDSGE----------------YA--NETTF 145
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 15604980   172 VLGSRPHVSLDIREMSYEKEDLFVFCSDGLTSAVSDHD 209
Cdd:pfam13672 146 LTSPDALEEFRIRRLTLEPGDALALMTDGLSDSLVTEE 183
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
10-248 1.36e-39

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 144.43  E-value: 1.36e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980   10 GLSDVGLVRHNNEDFWQVNYDSQ--------------LIAIADGMGGHRAGEVASYEAVGNLMQLVDLHKVDleRFGDEq 75
Cdd:PRK14559 379 GRTDVGRQRHHNEDYFGINTRIQklenphgrivqargLYILCDGMGGHAAGEVASALAVETLQQYFQQHWQD--ELPDE- 455
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980   76 ykESIKTIVSEINLLIYRQGLSNEQfKG---MGTTLSCMQFRRGKAWLFHVGDCRVYRL-RNKMLERLTEDHSLANHLAS 151
Cdd:PRK14559 456 --ETIREAIYLANEAIYDLNQQNAR-SGsgrMGTTLVMALVQDTQVAVAHVGDSRLYRVtRKGGLEQLTVDHEVGQREIQ 532
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980  152 RyGLSKQSVKRYPGRNVLTNVLGSRPHVSL--DIREMSYEKEDLFVFCSDGLtsavSDHDMLDI---------LTQTTTL 220
Cdd:PRK14559 533 R-GVEPQIAYARPDAYQLTQALGPRDNSAIqpDIQFLEIEEDTLLLLCSDGL----SDNDLLEThwqthllplLSSSANL 607
                        250       260
                 ....*....|....*....|....*...
gi 15604980  221 EEGGNILISLANSRGGRDNATVILVRMR 248
Cdd:PRK14559 608 DQGLNKLIDLANQYNGHDNITAILVRLK 635
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
8-246 1.10e-51

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 170.58  E-value: 1.10e-51
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980   8 YFGLSDVGLVRHNNEDFWQVNYDSQ-----LIAIADGMGGHRAGEVASYEAVGNLMQLVDLHKVDLErfgdEQYKESIKT 82
Cdd:cd00143   2 SAGVSDKGGDRKTNEDAVVIKPNLNnedggLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSE----EDIEEALRK 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980  83 IVSEINLLIYRQGLSNEQFKGMGTTLSCMQFRRGKAWLFHVGDCRVYRLRNKMLERLTEDHSLAN-HLASRYGLSKQSV- 160
Cdd:cd00143  78 AFLRADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNeEERERIEKAGGRVs 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980 161 -KRYPGRNVLTNVLGSR---PHVSL--DIREM-SYEKEDLFVFCSDGLTSAVSDHDMLDILTQT---TTLEEGGNILISL 230
Cdd:cd00143 158 nGRVPGVLAVTRALGDFdlkPGVSAepDVTVVkLTEDDDFLILASDGLWDVLSNQEAVDIVRSElakEDLQEAAQELVDL 237
                       250
                ....*....|....*.
gi 15604980 231 ANSRGGRDNATVILVR 246
Cdd:cd00143 238 ALRRGSHDNITVVVVR 253
PTC1 COG0631
Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];
1-246 8.95e-86

Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];


Pssm-ID: 223704  Cd Length: 262  Bit Score: 258.44  E-value: 8.95e-86
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980   1 MIVADFEYFGLSDVGLVRHNNED-----FWQVNYDSQLIAIADGMGGHRAGEVASYEAVGNLMQLVDLHKVDLerfGDEQ 75
Cdd:COG0631   3 SGILSLKVAGLSDVGTVRKHNEDaflikPNENGNLLLLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNS---LNES 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980  76 YKESIKTIVSEINLLIYRQGLSNEQFKGMGTTLSCMQFRRGKAWLFHVGDCRVYRLRNKMLERLTEDHSLANHLASRYGL 155
Cdd:COG0631  80 LEELLKEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGII 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980 156 SKQSVKRYPGRNVLTNVLGSRPHVSLDIREMSYEKEDLFVFCSDGLTSAVSDHDMLDILTQTTTLEEGGNILISLANSRG 235
Cdd:COG0631 160 TPEEARSHPRRNALTRALGDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILKNSETPQEAADKLIELALEGG 239
                       250
                ....*....|.
gi 15604980 236 GRDNATVILVR 246
Cdd:COG0631 240 GPDNITVVLVR 250
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
8-245 2.44e-42

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 145.98  E-value: 2.44e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980      8 YFGLSDVGLVRHNNEDFWQVNYDSQ----LIAIADGMGGHRAGEVASYEAVGNLMQLVDLHKVDlerfgDEQYKESIKTI 83
Cdd:smart00332  10 RYGLSSMQGVRKPMEDAHVITPDLSdsggFFGVFDGHGGSEAAKFLSKNLPEILAEELIKEKDE-----LEDVEEALRKA 84
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980     84 VSEINLLIYRQGLSneqfkGMGTTLSCMQFRRGKAWLFHVGDCRVYRLRNKMLERLTEDHSLAN-HLASRYGLSKQSVK- 161
Cdd:smart00332  85 FLSTDEEILEELEA-----LSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKPSNeDERARIEAAGGFVIn 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980    162 -RYPGRNVLTNVLG---------SRPHVSldIREMsYEKEDLFVFCSDGLTSAVSDHDMLDILTQTTT--LEEGGNILIS 229
Cdd:smart00332 160 gRVNGVLALSRAIGdfflkpyvsAEPDVT--VVEL-TEKDDFLILASDGLWDVLSNQEVVDIVRKHLSkdPKEAAKRLID 236
                          250
                   ....*....|....*.
gi 15604980    230 LANSRGGRDNATVILV 245
Cdd:smart00332 237 LALARGSKDNITVVVV 252
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
12-221 9.39e-35

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 124.38  E-value: 9.39e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980     12 SDVGLVRHNNEDFWQV----------NYDSQLIAIADGMGGHRAGEVASYEAVGNLMQLVDLHkvdlerfgdeqykESIK 81
Cdd:smart00331   1 DDGGLIAQYYEDATQVggdfydvvklPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEG-------------ISLS 67
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980     82 TIVSEINLLIYRQGlsneqFKGMGTTLSCM--QFRRGKAWLFHVGDCRVYRLRNKmlERLTEDHSlanhlasryglskqs 159
Cdd:smart00331  68 QILERLNRAIYENG-----EDGMFATLFLAlyDFAGGTLSYANAGHSPPYLLRAD--GGLVEDLD--------------- 125
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 15604980    160 vkrypgrnVLTNVLGSRPHVSLDIREMSYEKEDLFVFCSDGLTSAVSDHDMLDILTQTTTLE 221
Cdd:smart00331 126 --------DLGAPLGLEPDVEVDVRELTLEPGDLLLLYTDGLTEARNPERLEELLEELLGSP 179
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
20-209 1.42e-15

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 71.57  E-value: 1.42e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980    20 NNED--FWQVNYDSQLIAIADGMGGHRAGEVASYEAVgnlmQLVDLHkvdLERFGDEQYKESIKTIVSEINLLIYRQGLS 97
Cdd:pfam13672  11 PCQDafAYRVLSDGWLIAVADGAGSAKYSDVGARLAV----EAAVEA---LRELLDSGELPELEALVRQILNDILALVRQ 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980    98 NEQFKGM-----GTTLSCMQFRRGKAWLFHVGDCR-VYRLRNKMLERLTEDHSLAnhlasryglskqsvkrYPgrNVLTN 171
Cdd:pfam13672  84 EAAAQGLeprdyATTLLLAVITPGGIVFFQIGDGAiVVRDRDGELQLLSEPDSGE----------------YA--NETTF 145
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 15604980   172 VLGSRPHVSLDIREMSYEKEDLFVFCSDGLTSAVSDHD 209
Cdd:pfam13672 146 LTSPDALEEFRIRRLTLEPGDALALMTDGLSDSLVTEE 183
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
9-239 1.27e-08

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 52.75  E-value: 1.27e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980     9 FGLSDVGLVRHNNED----FWQVNYDSQ-----LIAIADGMGGHRAGEVASyeavGNLMQLVDLHKVDLERFGDEQ-YKE 78
Cdd:pfam00481   3 VGGTRMQGWRKSMEDahidGKNLNSSSGkdswsFFAVFDGHGGSEAAKYAG----KHLHTILALRRSFLTLRKLEDaLRE 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980    79 SIKTIVSEINLLIYRQGLSNeqfkgMGTTLSCMQFRRGKAWLFHVGDCRVYRLRN-KMLERLTEDHSLANHLA----SRY 153
Cdd:pfam00481  79 SFLETDEELRSDAANHEDLS-----SGSTAVVALIRGNKLYVANVGDSRAVLCRNgGAIKQLTEDHKPSDEDErrriRAA 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980   154 GLSKQSVKRYPGRNVLTNVLG------SRPHVSL--DIREMSYEKEDLF-VFCSDGLTSAVSDHDMLDI----LTQTTTL 220
Cdd:pfam00481 154 GGFVSRNGRVNGVLAVSRAFGdfdlkpGEQPVSAepDITSHKITEDDEFlILACDGLWDVLSDQEVVDIvrsnLSDGGDP 233
                         250
                  ....*....|....*....
gi 15604980   221 EEGGNILISLANSRGGRDN 239
Cdd:pfam00481 234 MEAAEKLVDEAIAYGSEDN 252
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
10-248 1.36e-39

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 144.43  E-value: 1.36e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980   10 GLSDVGLVRHNNEDFWQVNYDSQ--------------LIAIADGMGGHRAGEVASYEAVGNLMQLVDLHKVDleRFGDEq 75
Cdd:PRK14559 379 GRTDVGRQRHHNEDYFGINTRIQklenphgrivqargLYILCDGMGGHAAGEVASALAVETLQQYFQQHWQD--ELPDE- 455
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980   76 ykESIKTIVSEINLLIYRQGLSNEQfKG---MGTTLSCMQFRRGKAWLFHVGDCRVYRL-RNKMLERLTEDHSLANHLAS 151
Cdd:PRK14559 456 --ETIREAIYLANEAIYDLNQQNAR-SGsgrMGTTLVMALVQDTQVAVAHVGDSRLYRVtRKGGLEQLTVDHEVGQREIQ 532
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604980  152 RyGLSKQSVKRYPGRNVLTNVLGSRPHVSL--DIREMSYEKEDLFVFCSDGLtsavSDHDMLDI---------LTQTTTL 220
Cdd:PRK14559 533 R-GVEPQIAYARPDAYQLTQALGPRDNSAIqpDIQFLEIEEDTLLLLCSDGL----SDNDLLEThwqthllplLSSSANL 607
                        250       260
                 ....*....|....*....|....*...
gi 15604980  221 EEGGNILISLANSRGGRDNATVILVRMR 248
Cdd:PRK14559 608 DQGLNKLIDLANQYNGHDNITAILVRLK 635
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH