NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|154146249|ref|NP_083174|]
View 

regulatory-associated protein of mTOR isoform 1 [Mus musculus]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ARM cd00020
Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated ...
602-671 6.77e-03

Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.


:

Pssm-ID: 237987 [Multi-domain]  Cd Length: 120  Bit Score: 36.91  E-value: 6.77e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249  602 EKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDhsTTIDHNVAMMLAQLINDGSPMVRKELVVALSHLV 671
Cdd:cd00020    52 PALVQLLKSEDEEVVKAALWALRNLAAGPEDNKL--IVLEAGGVPKLVNLLDSSNEDIQKNATGALSNLA 119
Raptor_N pfam14538
Raptor N-terminal CASPase like domain; This domain is found at the N-terminus of the Raptor ...
54-207 1.53e-96

Raptor N-terminal CASPase like domain; This domain is found at the N-terminus of the Raptor protein. It has been identified to have a CASPase like structure. It conserves the characteristic cys/his dyad of the caspases suggesting it may have a peptidase activity.


:

Pssm-ID: 258678  Cd Length: 154  Bit Score: 306.50  E-value: 1.53e-96
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249    54 RMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKL 133
Cdd:pfam14538    1 RMKTVSVALVLCLNIGVDPPDVRKTNPCARLECWIDPSVLPPSKALETIGKALQSQYERWQPKARYKQSVDPTVEDVKRL 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 154146249   134 CTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFK 207
Cdd:pfam14538   81 CQSLRRNAKDERVLFHYNGHGVPRPTENGEIWVFNKNYTQYIPLSIYELQSWLGSPSIYIFDCSNAGSLLNAFK 154
WD40 super family cl02567
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
1027-1322 2.07e-22

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


The actual alignment was detected with superfamily member cd00200:

Pssm-ID: 271593 [Multi-domain]  Cd Length: 289  Bit Score: 99.33  E-value: 2.07e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1027 SVVKFHPFTPCIAVADKDSICF-WDWEKGEKLDYF--HNGNPRYTRVTAmeylngqDCSLLLTATDDGAIRVWknfaDLE 1103
Cdd:cd00200    13 TCVAFSPDGKLLATGSGDGTIKvWDLETGELLRTLkgHTGPVRDVAASA-------DGTYLASGSSDKTIRLW----DLE 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1104 KNpEMVTAWQGLSDMLpttrgagMVVDWEQETGLLMSSGDVRIVRIWDTDRETKVQDIpTGADSCVTSLSCDSHRSLIVA 1183
Cdd:cd00200    82 TG-ECVRTLTGHTSYV-------SSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTL-RGHTDWVNSVAFSPDGTFVAS 152
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1184 GLGDGSIRVYDrrMALSECrVMTYREHTAWVVKayLQKHPEG-HIVSVSVNGDVRFFDPRMPESVNVMQI-VKGLTALDI 1261
Cdd:cd00200   153 SSQDGTIKLWD--LRTGKC-VATLTGHTGEVNS--VAFSPDGeKLLSSSSDGTIKLWDLSTGKCLGTLRGhENGVNSVAF 227
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 154146249 1262 HPQANLIACGSMNqftaiyngngeliNNIKYYDGFMGQRV-------GAISCLAFHPHWPHLAVGSND 1322
Cdd:cd00200   228 SPDGYLLASGSED-------------GTIRVWDLRTGECVqtlsghtNSVTSLAWSPDGKRLASGSAD 282
WD40 COG2319
WD40 repeat [General function prediction only];
1019-1332 1.20e-21

WD40 repeat [General function prediction only];


:

Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 98.62  E-value: 1.20e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1019 LNRNPGVPSVVKFHPFTPCIAVA--DKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNgqdcSLLLTATDDGAIRVW 1096
Cdd:COG2319   151 LEGHSESVTSLAFSPDGKLLASGssLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGG----LLIASGSSDGTIRLW 226
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1097 knfaDLEKNPEMVTAWQGLSDMLpttrgagmVVDWEQETGLLMSSGDVRIVRIWDTDRETKVQDIPTGADSCVTSLSCDS 1176
Cdd:COG2319   227 ----DLSTGKLLRSTLSGHSDSV--------VSSFSPDGSLLASGSSDGTIRLWDLRSSSSLLRTLSGHSSSVLSVAFSP 294
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1177 HRSLIVAGLGDGSIRVYDRRMaLSECRVMTYREHTAWVVKAYLQKHPEGHIVSVSVNGDVRFFDPRMPESVNVMQIVKGL 1256
Cdd:COG2319   295 DGKLLASGSSDGTVRLWDLET-GKLLSSLTLKGHEGPVSSLSFSPDGSLLVSGGSDDGTIRLWDLRTGKPLKTLEGHSNV 373
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 154146249 1257 TALDIHPQANLIACGSMNQFTAIYNGNGELInnikyyDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEK 1332
Cdd:COG2319   374 LSVSFSPDGRVVSSGSTDGTVRLWDLSTGSL------LRNLDGHTSRVTSLDFSPDGKSLASGSSDNTIRLWDLKT 443
HEAT_2 pfam13646
HEAT repeats; This family includes multiple HEAT repeats.
566-668 6.38e-06

HEAT repeats; This family includes multiple HEAT repeats.


:

Pssm-ID: 257956 [Multi-domain]  Cd Length: 88  Bit Score: 45.80  E-value: 6.38e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249   566 LSDPHPLLRQWVAICLGRIWQnfdsarwcgvrDSAHEKLYSLLSDPIPEVRCAAVFALGtfvgnsaeRTDHSTTIDHnva 645
Cdd:pfam13646    9 LSDPDPEVRAAAARALGELGD-----------PEALPALLELLKDPDPEVRRAAAEALG--------KLGDPEALPA--- 66
                           90       100
                   ....*....|....*....|...
gi 154146249   646 mMLAQLINDGSPMVRKELVVALS 668
Cdd:pfam13646   67 -LLELLQDDEDAVVRAAAASALA 88
 
Name Accession Description Interval E-value
ARM cd00020
Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated ...
602-671 6.77e-03

Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.


Pssm-ID: 237987 [Multi-domain]  Cd Length: 120  Bit Score: 36.91  E-value: 6.77e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249  602 EKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDhsTTIDHNVAMMLAQLINDGSPMVRKELVVALSHLV 671
Cdd:cd00020    52 PALVQLLKSEDEEVVKAALWALRNLAAGPEDNKL--IVLEAGGVPKLVNLLDSSNEDIQKNATGALSNLA 119
Raptor_N pfam14538
Raptor N-terminal CASPase like domain; This domain is found at the N-terminus of the Raptor ...
54-207 1.53e-96

Raptor N-terminal CASPase like domain; This domain is found at the N-terminus of the Raptor protein. It has been identified to have a CASPase like structure. It conserves the characteristic cys/his dyad of the caspases suggesting it may have a peptidase activity.


Pssm-ID: 258678  Cd Length: 154  Bit Score: 306.50  E-value: 1.53e-96
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249    54 RMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKL 133
Cdd:pfam14538    1 RMKTVSVALVLCLNIGVDPPDVRKTNPCARLECWIDPSVLPPSKALETIGKALQSQYERWQPKARYKQSVDPTVEDVKRL 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 154146249   134 CTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFK 207
Cdd:pfam14538   81 CQSLRRNAKDERVLFHYNGHGVPRPTENGEIWVFNKNYTQYIPLSIYELQSWLGSPSIYIFDCSNAGSLLNAFK 154
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
1027-1322 2.07e-22

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 99.33  E-value: 2.07e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1027 SVVKFHPFTPCIAVADKDSICF-WDWEKGEKLDYF--HNGNPRYTRVTAmeylngqDCSLLLTATDDGAIRVWknfaDLE 1103
Cdd:cd00200    13 TCVAFSPDGKLLATGSGDGTIKvWDLETGELLRTLkgHTGPVRDVAASA-------DGTYLASGSSDKTIRLW----DLE 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1104 KNpEMVTAWQGLSDMLpttrgagMVVDWEQETGLLMSSGDVRIVRIWDTDRETKVQDIpTGADSCVTSLSCDSHRSLIVA 1183
Cdd:cd00200    82 TG-ECVRTLTGHTSYV-------SSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTL-RGHTDWVNSVAFSPDGTFVAS 152
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1184 GLGDGSIRVYDrrMALSECrVMTYREHTAWVVKayLQKHPEG-HIVSVSVNGDVRFFDPRMPESVNVMQI-VKGLTALDI 1261
Cdd:cd00200   153 SSQDGTIKLWD--LRTGKC-VATLTGHTGEVNS--VAFSPDGeKLLSSSSDGTIKLWDLSTGKCLGTLRGhENGVNSVAF 227
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 154146249 1262 HPQANLIACGSMNqftaiyngngeliNNIKYYDGFMGQRV-------GAISCLAFHPHWPHLAVGSND 1322
Cdd:cd00200   228 SPDGYLLASGSED-------------GTIRVWDLRTGECVqtlsghtNSVTSLAWSPDGKRLASGSAD 282
WD40 COG2319
WD40 repeat [General function prediction only];
1019-1332 1.20e-21

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 98.62  E-value: 1.20e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1019 LNRNPGVPSVVKFHPFTPCIAVA--DKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNgqdcSLLLTATDDGAIRVW 1096
Cdd:COG2319   151 LEGHSESVTSLAFSPDGKLLASGssLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGG----LLIASGSSDGTIRLW 226
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1097 knfaDLEKNPEMVTAWQGLSDMLpttrgagmVVDWEQETGLLMSSGDVRIVRIWDTDRETKVQDIPTGADSCVTSLSCDS 1176
Cdd:COG2319   227 ----DLSTGKLLRSTLSGHSDSV--------VSSFSPDGSLLASGSSDGTIRLWDLRSSSSLLRTLSGHSSSVLSVAFSP 294
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1177 HRSLIVAGLGDGSIRVYDRRMaLSECRVMTYREHTAWVVKAYLQKHPEGHIVSVSVNGDVRFFDPRMPESVNVMQIVKGL 1256
Cdd:COG2319   295 DGKLLASGSSDGTVRLWDLET-GKLLSSLTLKGHEGPVSSLSFSPDGSLLVSGGSDDGTIRLWDLRTGKPLKTLEGHSNV 373
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 154146249 1257 TALDIHPQANLIACGSMNQFTAIYNGNGELInnikyyDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEK 1332
Cdd:COG2319   374 LSVSFSPDGRVVSSGSTDGTVRLWDLSTGSL------LRNLDGHTSRVTSLDFSPDGKSLASGSSDNTIRLWDLKT 443
HEAT_2 pfam13646
HEAT repeats; This family includes multiple HEAT repeats.
566-668 6.38e-06

HEAT repeats; This family includes multiple HEAT repeats.


Pssm-ID: 257956 [Multi-domain]  Cd Length: 88  Bit Score: 45.80  E-value: 6.38e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249   566 LSDPHPLLRQWVAICLGRIWQnfdsarwcgvrDSAHEKLYSLLSDPIPEVRCAAVFALGtfvgnsaeRTDHSTTIDHnva 645
Cdd:pfam13646    9 LSDPDPEVRAAAARALGELGD-----------PEALPALLELLKDPDPEVRRAAAEALG--------KLGDPEALPA--- 66
                           90       100
                   ....*....|....*....|...
gi 154146249   646 mMLAQLINDGSPMVRKELVVALS 668
Cdd:pfam13646   67 -LLELLQDDEDAVVRAAAASALA 88
COG5096 COG5096
Vesicle coat complex, various subunits [Intracellular trafficking, secretion, and vesicular ...
472-696 6.97e-05

Vesicle coat complex, various subunits [Intracellular trafficking, secretion, and vesicular transport];


Pssm-ID: 227427 [Multi-domain]  Cd Length: 757  Bit Score: 45.87  E-value: 6.97e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249  472 IFPYVLKLLQSSARELRPLLVFIW---AK------ILAVDSscqadLVKDNGHKyflsvlaDPYMpaehRTMTAFILAVI 542
Cdd:COG5096    56 LFPDVIKNVATRDVELKRLLYLYLeryAKlkpelaLLAVNT-----IQKDLQDP-------NEEI----RGFALRTLSLL 119
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249  543 vnsyttgQEACLQGNLIAICLEQLSDPHPLLRQWVAICLGRIWQnFDSARWCGVRDSAHEKLysLLSDPIPEVRCAAVFA 622
Cdd:COG5096   120 -------RVKELLGNIIDPIKKLLTDPHAYVRKTAALAVAKLYR-LDKDLYHELGLIDILKE--LVADSDPIVIANALAS 189
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 154146249  623 LGTFVGNSAErtDHSTTIDHNVAMMLAQLINDGSPMVRKELVVALSHLVVQYESN---FCT-VALQFMEEEKNYPLPS 696
Cdd:COG5096   190 LAEIDPELAH--GYSLEVILRIPQLDLLSLSVSTEWLLLIILEVLTERVPTTPDSaedFEErLSPPLQHNNAEVLLIA 265
 
Name Accession Description Interval E-value
ARM cd00020
Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated ...
602-671 6.77e-03

Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.


Pssm-ID: 237987 [Multi-domain]  Cd Length: 120  Bit Score: 36.91  E-value: 6.77e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249  602 EKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDhsTTIDHNVAMMLAQLINDGSPMVRKELVVALSHLV 671
Cdd:cd00020    52 PALVQLLKSEDEEVVKAALWALRNLAAGPEDNKL--IVLEAGGVPKLVNLLDSSNEDIQKNATGALSNLA 119
Raptor_N pfam14538
Raptor N-terminal CASPase like domain; This domain is found at the N-terminus of the Raptor ...
54-207 1.53e-96

Raptor N-terminal CASPase like domain; This domain is found at the N-terminus of the Raptor protein. It has been identified to have a CASPase like structure. It conserves the characteristic cys/his dyad of the caspases suggesting it may have a peptidase activity.


Pssm-ID: 258678  Cd Length: 154  Bit Score: 306.50  E-value: 1.53e-96
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249    54 RMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKL 133
Cdd:pfam14538    1 RMKTVSVALVLCLNIGVDPPDVRKTNPCARLECWIDPSVLPPSKALETIGKALQSQYERWQPKARYKQSVDPTVEDVKRL 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 154146249   134 CTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFK 207
Cdd:pfam14538   81 CQSLRRNAKDERVLFHYNGHGVPRPTENGEIWVFNKNYTQYIPLSIYELQSWLGSPSIYIFDCSNAGSLLNAFK 154
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
1027-1322 2.07e-22

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 99.33  E-value: 2.07e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1027 SVVKFHPFTPCIAVADKDSICF-WDWEKGEKLDYF--HNGNPRYTRVTAmeylngqDCSLLLTATDDGAIRVWknfaDLE 1103
Cdd:cd00200    13 TCVAFSPDGKLLATGSGDGTIKvWDLETGELLRTLkgHTGPVRDVAASA-------DGTYLASGSSDKTIRLW----DLE 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1104 KNpEMVTAWQGLSDMLpttrgagMVVDWEQETGLLMSSGDVRIVRIWDTDRETKVQDIpTGADSCVTSLSCDSHRSLIVA 1183
Cdd:cd00200    82 TG-ECVRTLTGHTSYV-------SSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTL-RGHTDWVNSVAFSPDGTFVAS 152
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1184 GLGDGSIRVYDrrMALSECrVMTYREHTAWVVKayLQKHPEG-HIVSVSVNGDVRFFDPRMPESVNVMQI-VKGLTALDI 1261
Cdd:cd00200   153 SSQDGTIKLWD--LRTGKC-VATLTGHTGEVNS--VAFSPDGeKLLSSSSDGTIKLWDLSTGKCLGTLRGhENGVNSVAF 227
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 154146249 1262 HPQANLIACGSMNqftaiyngngeliNNIKYYDGFMGQRV-------GAISCLAFHPHWPHLAVGSND 1322
Cdd:cd00200   228 SPDGYLLASGSED-------------GTIRVWDLRTGECVqtlsghtNSVTSLAWSPDGKRLASGSAD 282
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
1123-1330 3.59e-17

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 82.77  E-value: 3.59e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1123 RGAGMVVDWEQETGLLMSSGDVRIVRIWDTDRETKVQDIpTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRmalSEC 1202
Cdd:cd00200     9 TGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTL-KGHTGPVRDVAASADGTYLASGSSDKTIRLWDLE---TGE 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1203 RVMTYREHTAWVvkAYLQKHPEGHIVSVS-VNGDVRFFDPRMPESVNVMQ-IVKGLTALDIHPQANLIACGSMNQFTAIY 1280
Cdd:cd00200    85 CVRTLTGHTSYV--SSVAFSPDGRILSSSsRDKTIKVWDVETGKCLTTLRgHTDWVNSVAFSPDGTFVASSSQDGTIKLW 162
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 154146249 1281 NG-NGELINNIKYYDGFmgqrvgaISCLAFHPHWPHLAVGSNDYYISVYSV 1330
Cdd:cd00200   163 DLrTGKCVATLTGHTGE-------VNSVAFSPDGEKLLSSSSDGTIKLWDL 206
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
1029-1240 6.80e-14

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 72.37  E-value: 6.80e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1029 VKFHPFTPCIAVADKDSICF-WDWEKGEKLDYF--HNGNprytrVTAMEYLngQDCSLLLTATDDGAIRVWknfaDLEKN 1105
Cdd:cd00200    57 VAASADGTYLASGSSDKTIRlWDLETGECVRTLtgHTSY-----VSSVAFS--PDGRILSSSSRDKTIKVW----DVETG 125
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1106 pEMVTAWQGLSDmlpttrgAGMVVDWEQETGLLMSSGDVRIVRIWDT--------------------------------- 1152
Cdd:cd00200   126 -KCLTTLRGHTD-------WVNSVAFSPDGTFVASSSQDGTIKLWDLrtgkcvatltghtgevnsvafspdgekllssss 197
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1153 DRETKVQDIPTGADSC--------VTSLSCDSHRSLIVAGLGDGSIRVYDRRMAlsECrVMTYREHTAWVVKAYLqkHPE 1224
Cdd:cd00200   198 DGTIKLWDLSTGKCLGtlrghengVNSVAFSPDGYLLASGSEDGTIRVWDLRTG--EC-VQTLSGHTNSVTSLAW--SPD 272
                         250
                  ....*....|....*..
gi 154146249 1225 GH-IVSVSVNGDVRFFD 1240
Cdd:cd00200   273 GKrLASGSADGTIRIWD 289
WD40 COG2319
WD40 repeat [General function prediction only];
1019-1332 1.20e-21

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 98.62  E-value: 1.20e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1019 LNRNPGVPSVVKFHPFTPCIAVA--DKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNgqdcSLLLTATDDGAIRVW 1096
Cdd:COG2319   151 LEGHSESVTSLAFSPDGKLLASGssLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGG----LLIASGSSDGTIRLW 226
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1097 knfaDLEKNPEMVTAWQGLSDMLpttrgagmVVDWEQETGLLMSSGDVRIVRIWDTDRETKVQDIPTGADSCVTSLSCDS 1176
Cdd:COG2319   227 ----DLSTGKLLRSTLSGHSDSV--------VSSFSPDGSLLASGSSDGTIRLWDLRSSSSLLRTLSGHSSSVLSVAFSP 294
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1177 HRSLIVAGLGDGSIRVYDRRMaLSECRVMTYREHTAWVVKAYLQKHPEGHIVSVSVNGDVRFFDPRMPESVNVMQIVKGL 1256
Cdd:COG2319   295 DGKLLASGSSDGTVRLWDLET-GKLLSSLTLKGHEGPVSSLSFSPDGSLLVSGGSDDGTIRLWDLRTGKPLKTLEGHSNV 373
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 154146249 1257 TALDIHPQANLIACGSMNQFTAIYNGNGELInnikyyDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEK 1332
Cdd:COG2319   374 LSVSFSPDGRVVSSGSTDGTVRLWDLSTGSL------LRNLDGHTSRVTSLDFSPDGKSLASGSSDNTIRLWDLKT 443
WD40 COG2319
WD40 repeat [General function prediction only];
1082-1333 2.81e-15

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 78.98  E-value: 2.81e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1082 SLLLTATDDGAIRVWknfaDLEKNPEMVTAWQGLSDmLPTTRGAGMVVDweQETGLLMSSGDVRIVRIWDTDRETKVQDI 1161
Cdd:COG2319    78 ELLLSGSSDGTIKLW----DLDNGEKLIKSLEGLHD-SSVSKLALSSPD--GNSILLASSSLDGTVKLWDLSTPGKLIRT 150
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1162 PTGADSCVTSLS-CDSHRSLIVAGLGDGSIRVYDRRmalSECRVMTYREHTAWVVKayLQKHPEG--HIVSVSVNGDVRF 1238
Cdd:COG2319   151 LEGHSESVTSLAfSPDGKLLASGSSLDGTIKLWDLR---TGKPLSTLAGHTDPVSS--LAFSPDGglLIASGSSDGTIRL 225
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1239 FDPRMPESV-NVMQIVKGLTALDIHPQANLIACGSMNQFTAIYN--GNGELINNIKYYDGfmgqrvgAISCLAFHPHWPH 1315
Cdd:COG2319   226 WDLSTGKLLrSTLSGHSDSVVSSFSPDGSLLASGSSDGTIRLWDlrSSSSLLRTLSGHSS-------SVLSVAFSPDGKL 298
                         250
                  ....*....|....*...
gi 154146249 1316 LAVGSNDYYISVYSVEKR 1333
Cdd:COG2319   299 LASGSSDGTVRLWDLETG 316
HEAT_2 pfam13646
HEAT repeats; This family includes multiple HEAT repeats.
566-668 6.38e-06

HEAT repeats; This family includes multiple HEAT repeats.


Pssm-ID: 257956 [Multi-domain]  Cd Length: 88  Bit Score: 45.80  E-value: 6.38e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249   566 LSDPHPLLRQWVAICLGRIWQnfdsarwcgvrDSAHEKLYSLLSDPIPEVRCAAVFALGtfvgnsaeRTDHSTTIDHnva 645
Cdd:pfam13646    9 LSDPDPEVRAAAARALGELGD-----------PEALPALLELLKDPDPEVRRAAAEALG--------KLGDPEALPA--- 66
                           90       100
                   ....*....|....*....|...
gi 154146249   646 mMLAQLINDGSPMVRKELVVALS 668
Cdd:pfam13646   67 -LLELLQDDEDAVVRAAAASALA 88
WD40 COG2319
WD40 repeat [General function prediction only];
1137-1332 2.01e-05

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 47.39  E-value: 2.01e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1137 LLMSSGDVRIVRIWDTDRETKvqdipTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMalSECRVMTYREHTAWVVK 1216
Cdd:COG2319    41 LLLALLSDSLVSLPDLSSLLL-----RGHEDSITSIAFSPDGELLLSGSSDGTIKLWDLDN--GEKLIKSLEGLHDSSVS 113
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249 1217 AYLQKHPEGHIV---SVSVNGDVRFFDPRMPeSVNVMQIV---KGLTALDIHPQANLIACGSmnqftaiyngngELINNI 1290
Cdd:COG2319   114 KLALSSPDGNSIllaSSSLDGTVKLWDLSTP-GKLIRTLEghsESVTSLAFSPDGKLLASGS------------SLDGTI 180
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|
gi 154146249 1291 KYYDGFMGQRV-------GAISCLAFHPHWPHLAVG-SNDYYISVYSVEK 1332
Cdd:COG2319   181 KLWDLRTGKPLstlaghtDPVSSLAFSPDGGLLIASgSSDGTIRLWDLST 230
COG5096 COG5096
Vesicle coat complex, various subunits [Intracellular trafficking, secretion, and vesicular ...
472-696 6.97e-05

Vesicle coat complex, various subunits [Intracellular trafficking, secretion, and vesicular transport];


Pssm-ID: 227427 [Multi-domain]  Cd Length: 757  Bit Score: 45.87  E-value: 6.97e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249  472 IFPYVLKLLQSSARELRPLLVFIW---AK------ILAVDSscqadLVKDNGHKyflsvlaDPYMpaehRTMTAFILAVI 542
Cdd:COG5096    56 LFPDVIKNVATRDVELKRLLYLYLeryAKlkpelaLLAVNT-----IQKDLQDP-------NEEI----RGFALRTLSLL 119
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154146249  543 vnsyttgQEACLQGNLIAICLEQLSDPHPLLRQWVAICLGRIWQnFDSARWCGVRDSAHEKLysLLSDPIPEVRCAAVFA 622
Cdd:COG5096   120 -------RVKELLGNIIDPIKKLLTDPHAYVRKTAALAVAKLYR-LDKDLYHELGLIDILKE--LVADSDPIVIANALAS 189
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 154146249  623 LGTFVGNSAErtDHSTTIDHNVAMMLAQLINDGSPMVRKELVVALSHLVVQYESN---FCT-VALQFMEEEKNYPLPS 696
Cdd:COG5096   190 LAEIDPELAH--GYSLEVILRIPQLDLLSLSVSTEWLLLIILEVLTERVPTTPDSaedFEErLSPPLQHNNAEVLLIA 265
HEAT_2 pfam13646
HEAT repeats; This family includes multiple HEAT repeats.
607-670 1.37e-04

HEAT repeats; This family includes multiple HEAT repeats.


Pssm-ID: 257956 [Multi-domain]  Cd Length: 88  Bit Score: 41.94  E-value: 1.37e-04
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 154146249   607 LLSDPIPEVRCAAVFALGTFvgnsaertDHSTTIDhnvamMLAQLINDGSPMVRKELVVALSHL 670
Cdd:pfam13646    8 LLSDPDPEVRAAAARALGEL--------GDPEALP-----ALLELLKDPDPEVRRAAAEALGKL 58
HEAT_2 pfam13646
HEAT repeats; This family includes multiple HEAT repeats.
559-624 2.25e-04

HEAT repeats; This family includes multiple HEAT repeats.


Pssm-ID: 257956 [Multi-domain]  Cd Length: 88  Bit Score: 41.17  E-value: 2.25e-04
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 154146249   559 IAICLEQLSDPHPLLRQWVAICLGRIwqnfdsarwcGVRDSAHEKLYSLLSDPIPEVRCAAVFALG 624
Cdd:pfam13646   33 LPALLELLKDPDPEVRRAAAEALGKL----------GDPEALPALLELLQDDEDAVVRAAAASALA 88
HEAT COG1413
HEAT repeat [General function prediction only];
557-624 5.52e-04

HEAT repeat [General function prediction only];


Pssm-ID: 224331 [Multi-domain]  Cd Length: 335  Bit Score: 42.21  E-value: 5.52e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 154146249  557 NLIAICLEQLSDPHPLLRQWVAICLGRIwqnFDSARWcgvrdsAHEKLYSLLSDPIPEVRCAAVFALG 624
Cdd:COG1413   180 EAIPLLIELLEDEDADVRRAAASALGQL---GSENVE------AADLLVKALSDESLEVRKAALLALG 238
Cnd1 pfam12717
non-SMC mitotic condensation complex subunit 1; The three non-SMC (structural maintenance of ...
613-673 5.68e-03

non-SMC mitotic condensation complex subunit 1; The three non-SMC (structural maintenance of chromosomes) subunits of the mitotic condensation complex are Cnd1-3. The whole complex is essential for viability and the condensing of chromosomes in mitosis.


Pssm-ID: 257244 [Multi-domain]  Cd Length: 172  Bit Score: 37.93  E-value: 5.68e-03
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 154146249   613 PEVRCAAVFALGTFvgnsAERtdHSTTIDHNVAMMLAQLiNDGSPMVRKELVVALSHLVVQ 673
Cdd:pfam12717    2 PLIRNNAVIALGDL----CIR--YPNLVEPYTPNLYRCL-RDEDPYVRKTALLVLTHLILN 55
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH