NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|152966068|ref|YP_001361852|]
View 

stage II sporulation E family protein [Kineococcus radiotolerans SRS30216 = ATCC BAA-149]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
145-340 1.05e-31

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


:

Pssm-ID: 254114  Cd Length: 192  Bit Score: 118.55  E-value: 1.05e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152966068  145 SPFGVRLLLADVRGHGLEAVHLAATVLGAFRERAHERGDLRELARDLDRAVARAGGEEDFVTAVLAEVH--AGVLRVVNA 222
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGERFATAVLAVYDpeTGTLEYANA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152966068  223 GHLAPVLLRAGTAVGLDPRHPALPLGLGLgsgggsgtDLDVEQSQIHLEAGDRVLLYTDGVTEArRPDDGEFFPLTRL-- 300
Cdd:pfam07228  81 GHPPPLLLRPDGGVVELLESPGLPLGVLP--------DAPYETAEFPLEPGDTLLLYTDGLTEA-RDPDGELFGLERLla 151
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 152966068  301 VVPCLGTGALSAGLAELRAAVVDWVRGPAQDDVTVLAFEY 340
Cdd:pfam07228 152 LLAERHGLSPEELLDALLEDLLRLGGGELEDDITLLVLRV 191
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
145-340 1.05e-31

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 118.55  E-value: 1.05e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152966068  145 SPFGVRLLLADVRGHGLEAVHLAATVLGAFRERAHERGDLRELARDLDRAVARAGGEEDFVTAVLAEVH--AGVLRVVNA 222
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGERFATAVLAVYDpeTGTLEYANA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152966068  223 GHLAPVLLRAGTAVGLDPRHPALPLGLGLgsgggsgtDLDVEQSQIHLEAGDRVLLYTDGVTEArRPDDGEFFPLTRL-- 300
Cdd:pfam07228  81 GHPPPLLLRPDGGVVELLESPGLPLGVLP--------DAPYETAEFPLEPGDTLLLYTDGLTEA-RDPDGELFGLERLla 151
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 152966068  301 VVPCLGTGALSAGLAELRAAVVDWVRGPAQDDVTVLAFEY 340
Cdd:pfam07228 152 LLAERHGLSPEELLDALLEDLLRLGGGELEDDITLLVLRV 191
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
126-293 1.03e-22

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 93.18  E-value: 1.03e-22
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152966068   126 YDSAQEEAAVGGDVYAAVQSPFGVRLL-LADVRGHGLEAVHLAATVLGAFRERAHERGDLRELARDLDRAVARAGGEEDF 204
Cdd:smart00331   7 AQYYEDATQVGGDFYDVVKLPEGRLLIaIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYENGEDGMF 86
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152966068   205 VTAVLAEVH--AGVLRVVNAGHLAPVLLRA--GTAVGLDPRHPALplglglgsggGSGTDLDVEQSQIHLEAGDRVLLYT 280
Cdd:smart00331  87 ATLFLALYDfaGGTLSYANAGHSPPYLLRAdgGLVEDLDDLGAPL----------GLEPDVEVDVRELTLEPGDLLLLYT 156
                          170
                   ....*....|...
gi 152966068   281 DGVTEARRPDDGE 293
Cdd:smart00331 157 DGLTEARNPERLE 169
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
93-339 3.75e-19

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 85.92  E-value: 3.75e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152966068  93 HRLTRVLKIAAVAQSAILPPVPPRLGPVNVAASYDSAQEeaaVGGDVYAAVQ-SPFGVRLLLADVRGHGLEAVHLAATVL 171
Cdd:COG2208  122 NNISAELEVARQIQQNLLPKALPLFPGIDIEAILVPASE---VGGDYYDFIQlGEKRLRIGIGDVSGKGVPAALLMLMPK 198
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152966068 172 GAFRERAHERG-DLRELARDLDRAVARAGGEEDFVTAVLAEVH--AGVLRVVNAGHLAPVLLRAGTAV------GLDPRH 242
Cdd:COG2208  199 LALRLLLESGPlDPADVLETLNRVLKQNLEEDMFVTLFLGVYDldSGELTYSNAGHEPALILSADGEIevedltALGLPI 278
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152966068 243 PALPlglglgsgggsgtDLDVEQSQIHLEAGDRVLLYTDGVTEARRPdDGEFFPLTRLVVpcLGTGALSAGLAELRAAVV 322
Cdd:COG2208  279 GLLP-------------DYQYEVASLQLEPGDLLVLYTDGVTEARNS-DGEFFGLERLLK--ILGRLLGQPAEEILEAIL 342
                        250       260
                 ....*....|....*....|..
gi 152966068 323 DWVRG-----PAQDDVTVLAFE 339
Cdd:COG2208  343 ESLEElqgdqIQDDDITLLVLK 364
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
145-340 1.05e-31

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 118.55  E-value: 1.05e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152966068  145 SPFGVRLLLADVRGHGLEAVHLAATVLGAFRERAHERGDLRELARDLDRAVARAGGEEDFVTAVLAEVH--AGVLRVVNA 222
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGERFATAVLAVYDpeTGTLEYANA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152966068  223 GHLAPVLLRAGTAVGLDPRHPALPLGLGLgsgggsgtDLDVEQSQIHLEAGDRVLLYTDGVTEArRPDDGEFFPLTRL-- 300
Cdd:pfam07228  81 GHPPPLLLRPDGGVVELLESPGLPLGVLP--------DAPYETAEFPLEPGDTLLLYTDGLTEA-RDPDGELFGLERLla 151
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 152966068  301 VVPCLGTGALSAGLAELRAAVVDWVRGPAQDDVTVLAFEY 340
Cdd:pfam07228 152 LLAERHGLSPEELLDALLEDLLRLGGGELEDDITLLVLRV 191
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
126-293 1.03e-22

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 93.18  E-value: 1.03e-22
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152966068   126 YDSAQEEAAVGGDVYAAVQSPFGVRLL-LADVRGHGLEAVHLAATVLGAFRERAHERGDLRELARDLDRAVARAGGEEDF 204
Cdd:smart00331   7 AQYYEDATQVGGDFYDVVKLPEGRLLIaIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYENGEDGMF 86
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152966068   205 VTAVLAEVH--AGVLRVVNAGHLAPVLLRA--GTAVGLDPRHPALplglglgsggGSGTDLDVEQSQIHLEAGDRVLLYT 280
Cdd:smart00331  87 ATLFLALYDfaGGTLSYANAGHSPPYLLRAdgGLVEDLDDLGAPL----------GLEPDVEVDVRELTLEPGDLLLLYT 156
                          170
                   ....*....|...
gi 152966068   281 DGVTEARRPDDGE 293
Cdd:smart00331 157 DGLTEARNPERLE 169
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
93-339 3.75e-19

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 85.92  E-value: 3.75e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152966068  93 HRLTRVLKIAAVAQSAILPPVPPRLGPVNVAASYDSAQEeaaVGGDVYAAVQ-SPFGVRLLLADVRGHGLEAVHLAATVL 171
Cdd:COG2208  122 NNISAELEVARQIQQNLLPKALPLFPGIDIEAILVPASE---VGGDYYDFIQlGEKRLRIGIGDVSGKGVPAALLMLMPK 198
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152966068 172 GAFRERAHERG-DLRELARDLDRAVARAGGEEDFVTAVLAEVH--AGVLRVVNAGHLAPVLLRAGTAV------GLDPRH 242
Cdd:COG2208  199 LALRLLLESGPlDPADVLETLNRVLKQNLEEDMFVTLFLGVYDldSGELTYSNAGHEPALILSADGEIevedltALGLPI 278
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152966068 243 PALPlglglgsgggsgtDLDVEQSQIHLEAGDRVLLYTDGVTEARRPdDGEFFPLTRLVVpcLGTGALSAGLAELRAAVV 322
Cdd:COG2208  279 GLLP-------------DYQYEVASLQLEPGDLLVLYTDGVTEARNS-DGEFFGLERLLK--ILGRLLGQPAEEILEAIL 342
                        250       260
                 ....*....|....*....|..
gi 152966068 323 DWVRG-----PAQDDVTVLAFE 339
Cdd:COG2208  343 ESLEElqgdqIQDDDITLLVLK 364
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH