NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|15229955|ref|NP_187818|]
View 

actin-11 [Arabidopsis thaliana]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
NBD_sugar-kinase_HSP70_actin cd00012
Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily ...
10-183 4.99e-17

Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily includes the actin family, the HSP70 family of molecular chaperones and nucleotide exchange factors, the ROK (repressor, ORF, kinase) family, the hexokinase family, the FGGY family (which includes glycerol kinase and similar carbohydrate kinases such as rhamnulokinase and xylulokinase), the exopolyphosphatase/guanosine pentaphosphate phosphohydrolase/nucleoside triphosphate diphosphohydrolase family, propionate kinase/acetate kinase family, glycerol dehydratase reactivase, 2-hydroxyglutaryl-CoA dehydratase component A, N-acetylglucosamine kinase, butyrate kinase 2, Escherichia coli YeaZ and similar glycoproteases, the cell shape-determining protein MreB, the plasmid DNA segregation factor ParM, cell cycle proteins FtsA, Pili assembly protein PilM, ethanolamine utilization protein EutJ, and similar proteins. The nucleotide-binding site residues are conserved; the nucleotide sits in a deep cleft formed between the two lobes of the nucleotide-binding domain (NBD). Substrate binding to superfamily members is associated with closure of this catalytic site cleft. The functional activities of several members of the superfamily, including hexokinases, actin, and HSP70s, are modulated by allosteric effectors, which may act on the cleft closure.


:

Pssm-ID: 212657  Cd Length: 185  Bit Score: 77.63  E-value: 4.99e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  10 LVCDNGTGMVKAGFAGDDA---PRAVFPSIVGRPrhtgvmvgmgqkdayvgdeaqskrgiltlkypiehGIVSNWDDMEK 86
Cdd:cd00012   1 LGIDIGSTSTKAGVADLDGeilPEEIVPTPVGRP-----------------------------------GAVTDLDELEE 45
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  87 IWHHTFYNELRVAPEE-HPVLLTEAPLNPKANREKMTQI---------MFETFNTPAMYVAIQAVLSLYASGRT-----T 151
Cdd:cd00012  46 ALRELLKEALRQLKSEiDAVGITEPGGVPKENREVIILPnllliplalALEDLGGVPVAVVNDAVAAALAEGLFgkeedT 125
                       170       180       190
                ....*....|....*....|....*....|..
gi 15229955 152 GIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 183
Cdd:cd00012 126 VLVVDLGTGTTGIAIVEDGKGGVGAAGELGIA 157
Actin pfam00022
Actin;
5-377 0e+00

Actin;


:

Pssm-ID: 249516 [Multi-domain]  Cd Length: 367  Bit Score: 655.83  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955     5 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMvgmgqKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDM 84
Cdd:pfam00022   1 DEVSALVIDNGSGTTKAGFAGEDAPRAVIPSVVGRPRGRGVE-----NKYYVGDEALSKRPGLEVRYPIEDGIVENWDAM 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955    85 EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHT 164
Cdd:pfam00022  76 EKIWEHTFFEELRVDPEEHPLLLTEPPLNPPANREKATEIMFETFGVPALYLAKQAVLSAYASGRTTGLVVDSGAGVTSV 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955   165 VPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDVKEKLAYIALDYEQEMETAntSSSVEKSYEL 244
Cdd:pfam00022 156 VPVYEGYVLQKAIRRSDLAGDDLTDYLRKLLSSRTYSFNTYAEEEVVRDIKESLCYVSDDPFGDTAAS--SSPPTVSYEL 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955   245 PDGQVITIGGERFRCPEVLFQPSLVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAP 324
Cdd:pfam00022 234 PDGYVIILGNERFRVPEILFNPSLIGSESAGIPELIYDSINACDVDLRPSLLANIVVTGGTTLFPGFTERLEKELAQLAP 313
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....
gi 15229955   325 SSMKIKVVAPP-ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
Cdd:pfam00022 314 SGVKVKIIAPPnERKYSAWIGGSILASLGTFQQMWVSKQEYEEHGSSVVERKCF 367
 
Name Accession Description Interval E-value
NBD_sugar-kinase_HSP70_actin cd00012
Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily ...
10-183 4.99e-17

Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily includes the actin family, the HSP70 family of molecular chaperones and nucleotide exchange factors, the ROK (repressor, ORF, kinase) family, the hexokinase family, the FGGY family (which includes glycerol kinase and similar carbohydrate kinases such as rhamnulokinase and xylulokinase), the exopolyphosphatase/guanosine pentaphosphate phosphohydrolase/nucleoside triphosphate diphosphohydrolase family, propionate kinase/acetate kinase family, glycerol dehydratase reactivase, 2-hydroxyglutaryl-CoA dehydratase component A, N-acetylglucosamine kinase, butyrate kinase 2, Escherichia coli YeaZ and similar glycoproteases, the cell shape-determining protein MreB, the plasmid DNA segregation factor ParM, cell cycle proteins FtsA, Pili assembly protein PilM, ethanolamine utilization protein EutJ, and similar proteins. The nucleotide-binding site residues are conserved; the nucleotide sits in a deep cleft formed between the two lobes of the nucleotide-binding domain (NBD). Substrate binding to superfamily members is associated with closure of this catalytic site cleft. The functional activities of several members of the superfamily, including hexokinases, actin, and HSP70s, are modulated by allosteric effectors, which may act on the cleft closure.


Pssm-ID: 212657  Cd Length: 185  Bit Score: 77.63  E-value: 4.99e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  10 LVCDNGTGMVKAGFAGDDA---PRAVFPSIVGRPrhtgvmvgmgqkdayvgdeaqskrgiltlkypiehGIVSNWDDMEK 86
Cdd:cd00012   1 LGIDIGSTSTKAGVADLDGeilPEEIVPTPVGRP-----------------------------------GAVTDLDELEE 45
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  87 IWHHTFYNELRVAPEE-HPVLLTEAPLNPKANREKMTQI---------MFETFNTPAMYVAIQAVLSLYASGRT-----T 151
Cdd:cd00012  46 ALRELLKEALRQLKSEiDAVGITEPGGVPKENREVIILPnllliplalALEDLGGVPVAVVNDAVAAALAEGLFgkeedT 125
                       170       180       190
                ....*....|....*....|....*....|..
gi 15229955 152 GIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 183
Cdd:cd00012 126 VLVVDLGTGTTGIAIVEDGKGGVGAAGELGIA 157
PTZ00281 PTZ00281
actin; Provisional
5-377 0e+00

actin; Provisional


Pssm-ID: 173506  Cd Length: 376  Bit Score: 739.59  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955    5 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDM 84
Cdd:PTZ00281   4 EDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955   85 EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHT 164
Cdd:PTZ00281  84 EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHT 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  165 VPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDVKEKLAYIALDYEQEMETANTSSSVEKSYEL 244
Cdd:PTZ00281 164 VPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYEL 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  245 PDGQVITIGGERFRCPEVLFQPSLVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAP 324
Cdd:PTZ00281 244 PDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAP 323
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|...
gi 15229955  325 SSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
Cdd:PTZ00281 324 STMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF 376
COG5277 COG5277
Actin and related proteins [Cytoskeleton]
4-377 1.19e-162

Actin and related proteins [Cytoskeleton]


Pssm-ID: 227602  Cd Length: 444  Bit Score: 466.51  E-value: 1.19e-162
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955   4 GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPR-HTGVMVGMGQKDAYVGDEAQSKRGI--LTLKYPIEHGIVSN 80
Cdd:COG5277   3 GDNVPTIVIDNGSGTTKAGFAGNDTPTTVFPSIVGRRRdEDSVMEDTEEKDTYVGNEAQNDRDNslLELRYPIENGIILN 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  81 WDDMEKIWHHTFYNE--LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT--TGIVLD 156
Cdd:COG5277  83 WDAMEQIWDYTFFNKgdLLPSPEEHPLLLTEPPLNPPSNREKITELLFETLNVPALYLAIQAVLSLYASGSSdeTGLVID 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955 157 SGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE-----RGYSFTT---SAEREIVRDVKEKL-------AYI 221
Cdd:COG5277 163 SGDSVTHVIPVVDGIVLPKAVKRIDIGGRDITDYLKKLLREkyppsRGYNLKSelvEYSSEIVNEIKEEVcetddesAYV 242
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955 222 ALDYEQEMETA----------------NTSSSVEKSYELPDGQVITIG-GERFRCPEVLFQPSL---------------- 268
Cdd:COG5277 243 SLDAEEEFEEEeekpaekstestfqlsKETSIAKESKELPDGEEIEFGnEERFKAPEILFKPELpisgleeagkideskq 322
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955 269 -------------VGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP 335
Cdd:COG5277 323 elvaenyeisptnLGNDIAGLPELVYQSIQICDEDVRKSLYSNIVLTGGTSKIPGFAERLQKELTSLAPSIWKVSVIPPP 402
                       410       420       430       440
                ....*....|....*....|....*....|....*....|..
gi 15229955 336 ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
Cdd:COG5277 403 DPSLDAWLGASILASLETFQQLWITKEEYEEHGPDILQEKRF 444
Actin pfam00022
Actin;
5-377 0e+00

Actin;


Pssm-ID: 249516 [Multi-domain]  Cd Length: 367  Bit Score: 655.83  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955     5 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMvgmgqKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDM 84
Cdd:pfam00022   1 DEVSALVIDNGSGTTKAGFAGEDAPRAVIPSVVGRPRGRGVE-----NKYYVGDEALSKRPGLEVRYPIEDGIVENWDAM 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955    85 EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHT 164
Cdd:pfam00022  76 EKIWEHTFFEELRVDPEEHPLLLTEPPLNPPANREKATEIMFETFGVPALYLAKQAVLSAYASGRTTGLVVDSGAGVTSV 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955   165 VPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDVKEKLAYIALDYEQEMETAntSSSVEKSYEL 244
Cdd:pfam00022 156 VPVYEGYVLQKAIRRSDLAGDDLTDYLRKLLSSRTYSFNTYAEEEVVRDIKESLCYVSDDPFGDTAAS--SSPPTVSYEL 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955   245 PDGQVITIGGERFRCPEVLFQPSLVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAP 324
Cdd:pfam00022 234 PDGYVIILGNERFRVPEILFNPSLIGSESAGIPELIYDSINACDVDLRPSLLANIVVTGGTTLFPGFTERLEKELAQLAP 313
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....
gi 15229955   325 SSMKIKVVAPP-ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
Cdd:pfam00022 314 SGVKVKIIAPPnERKYSAWIGGSILASLGTFQQMWVSKQEYEEHGSSVVERKCF 367
ACTIN smart00268
Actin; ACTIN subfamily of ACTIN/mreB/sugarkinase/Hsp70 superfamily
8-377 0e+00

Actin; ACTIN subfamily of ACTIN/mreB/sugarkinase/Hsp70 superfamily


Pssm-ID: 214592 [Multi-domain]  Cd Length: 373  Bit Score: 638.53  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955      8 QPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGmGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKI 87
Cdd:smart00268   2 PAIVIDNGSGTIKAGFAGEDFPQVVFPSIVGRPKDGKGMVG-DAKDIFVGDEAQEKRGGLELKYPIENGIVENWDDMEKI 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955     88 WHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPI 167
Cdd:smart00268  81 WDYTFFNELRVEPEEHPVLLTEPPMNPKSNREKILEIMFETFNFPALYIAIQAVLSLYASGRTTGLVIDSGDGVTHVVPV 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955    168 YEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDVKEKLAYIALDYEQEMETANT---SSSVEKSYEL 244
Cdd:smart00268 161 VDGYVLPHAIKRIDIAGRDITDYLKELLSERGYQFNSSAEFEIVREIKEKLCYVAEDFEKEMKLAREsseSSKLEKTYEL 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955    245 PDGQVITIGGERFRCPEVLFQPSLVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAP 324
Cdd:smart00268 241 PDGNTIKVGNERFRIPEILFSPELIGLEQKGIHELVYESIQKCDIDVRKDLYENIVLSGGSTLIPGFGERLEKELKQLAP 320
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|...
gi 15229955    325 SSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
Cdd:smart00268 321 KKLKVKVIAPPERKYSVWLGGSILASLSTFEDMWITKKEYEESGSQIVERKCF 373
PTZ00280 PTZ00280
Actin-related protein 3; Provisional
10-374 2.98e-118

Actin-related protein 3; Provisional


Pssm-ID: 240343 [Multi-domain]  Cd Length: 414  Bit Score: 352.11  E-value: 2.98e-118
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955   10 LVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMV---GMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEK 86
Cdd:PTZ00280   7 VVIDNGTGYTKMGYAGNTEPTYIIPTLIADNSKQSRRRskkGFEDLDFYIGDEALAASKSYTLTYPMKHGIVEDWDLMEK 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955   87 IWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYAS----------GRTTGIVLD 156
Cdd:PTZ00280  87 FWEQCIFKYLRCEPEEHYFILTEPPMNPPENREYTAEIMFETFNVKGLYIAVQAVLALRASwtskkakelgGTLTGTVID 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  157 SGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDVKEKLAYIALDYEQEMETAN--- 233
Cdd:PTZ00280 167 SGDGVTHVIPVVDGYVIGSSIKHIPLAGRDITNFIQQMLRERGEPIPAEDILLLAQRIKEKYCYVAPDIAKEFEKYDsdp 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  234 ---------TSSSVEKSYElpdgqvITIGGERFRCPEVLFQPSLVGME-AAGIHETTYNSIMKCDVDIRKDLYGNIVLSG 303
Cdd:PTZ00280 247 knhfkkytaVNSVTKKPYT------VDVGYERFLGPEMFFHPEIFSSEwTTPLPEVVDDAIQSCPIDCRRPLYKNIVLSG 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  304 GTTMFPGIADRMSKEITA----------------LAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDES 367
Cdd:PTZ00280 321 GSTMFKGFDKRLQRDVRKrvdrrlkkaeelsggkLKPIPIDVNVVSHPRQRYAVWYGGSMLASSPEFEKVCHTKAEYDEY 400

                 ....*..
gi 15229955  368 GPSIVHR 374
Cdd:PTZ00280 401 GPSICRY 407
 
Name Accession Description Interval E-value
NBD_sugar-kinase_HSP70_actin cd00012
Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily ...
10-183 4.99e-17

Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily includes the actin family, the HSP70 family of molecular chaperones and nucleotide exchange factors, the ROK (repressor, ORF, kinase) family, the hexokinase family, the FGGY family (which includes glycerol kinase and similar carbohydrate kinases such as rhamnulokinase and xylulokinase), the exopolyphosphatase/guanosine pentaphosphate phosphohydrolase/nucleoside triphosphate diphosphohydrolase family, propionate kinase/acetate kinase family, glycerol dehydratase reactivase, 2-hydroxyglutaryl-CoA dehydratase component A, N-acetylglucosamine kinase, butyrate kinase 2, Escherichia coli YeaZ and similar glycoproteases, the cell shape-determining protein MreB, the plasmid DNA segregation factor ParM, cell cycle proteins FtsA, Pili assembly protein PilM, ethanolamine utilization protein EutJ, and similar proteins. The nucleotide-binding site residues are conserved; the nucleotide sits in a deep cleft formed between the two lobes of the nucleotide-binding domain (NBD). Substrate binding to superfamily members is associated with closure of this catalytic site cleft. The functional activities of several members of the superfamily, including hexokinases, actin, and HSP70s, are modulated by allosteric effectors, which may act on the cleft closure.


Pssm-ID: 212657  Cd Length: 185  Bit Score: 77.63  E-value: 4.99e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  10 LVCDNGTGMVKAGFAGDDA---PRAVFPSIVGRPrhtgvmvgmgqkdayvgdeaqskrgiltlkypiehGIVSNWDDMEK 86
Cdd:cd00012   1 LGIDIGSTSTKAGVADLDGeilPEEIVPTPVGRP-----------------------------------GAVTDLDELEE 45
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  87 IWHHTFYNELRVAPEE-HPVLLTEAPLNPKANREKMTQI---------MFETFNTPAMYVAIQAVLSLYASGRT-----T 151
Cdd:cd00012  46 ALRELLKEALRQLKSEiDAVGITEPGGVPKENREVIILPnllliplalALEDLGGVPVAVVNDAVAAALAEGLFgkeedT 125
                       170       180       190
                ....*....|....*....|....*....|..
gi 15229955 152 GIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 183
Cdd:cd00012 126 VLVVDLGTGTTGIAIVEDGKGGVGAAGELGIA 157
PTZ00281 PTZ00281
actin; Provisional
5-377 0e+00

actin; Provisional


Pssm-ID: 173506  Cd Length: 376  Bit Score: 739.59  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955    5 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDM 84
Cdd:PTZ00281   4 EDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955   85 EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHT 164
Cdd:PTZ00281  84 EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHT 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  165 VPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDVKEKLAYIALDYEQEMETANTSSSVEKSYEL 244
Cdd:PTZ00281 164 VPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYEL 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  245 PDGQVITIGGERFRCPEVLFQPSLVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAP 324
Cdd:PTZ00281 244 PDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAP 323
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|...
gi 15229955  325 SSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
Cdd:PTZ00281 324 STMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF 376
PTZ00004 PTZ00004
actin-2; Provisional
1-377 0e+00

actin-2; Provisional


Pssm-ID: 240225  Cd Length: 378  Bit Score: 705.76  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955    1 MADgEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSN 80
Cdd:PTZ00004   1 MSV-EETNAAVVDNGSGMVKAGFAGDDAPRCVFPSIVGRPKNPGIMVGMEEKDCYVGDEAQDKRGILTLKYPIEHGIVTN 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955   81 WDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDG 160
Cdd:PTZ00004  80 WDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETHNVPAMYVAIQAVLSLYASGRTTGIVLDSGDG 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  161 VSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDVKEKLAYIALDYEQEM-ETANTSSSVE 239
Cdd:PTZ00004 160 VSHTVPIYEGYSLPHAIHRLDVAGRDLTEYMMKILHERGTTFTTTAEKEIVRDIKEKLCYIALDFDEEMgNSAGSSDKYE 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  240 KSYELPDGQVITIGGERFRCPEVLFQPSLVGM-EAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKE 318
Cdd:PTZ00004 240 ESYELPDGTIITVGSERFRCPEALFQPSLIGKeEPPGIHELTFQSINKCDIDIRKDLYGNIVLSGGTTMYRGLPERLTKE 319
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 15229955  319 ITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
Cdd:PTZ00004 320 LTTLAPSTMKIKVVAPPERKYSVWIGGSILSSLPTFQQMWVTKEEYDESGPSIVHRKCF 378
PTZ00466 PTZ00466
actin-like protein; Provisional
8-377 1.70e-177

actin-like protein; Provisional


Pssm-ID: 240426  Cd Length: 380  Bit Score: 501.78  E-value: 1.70e-177
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955    8 QPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKI 87
Cdd:PTZ00466  13 QPIIIDNGTGYIKAGFAGEDVPNLVFPSYVGRPKYKRVMAGAVEGNIFVGNKAEEYRGLLKVTYPINHGIIENWNDMENI 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955   88 WHHTfYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPI 167
Cdd:PTZ00466  93 WIHV-YNSMKINSEEHPVLLTEAPLNPQKNKEKIAEVFFETFNVPALFISIQAILSLYSCGKTNGTVLDCGDGVCHCVSI 171
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  168 YEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDVKEKLAYIALDYEQEMETANTSSSVeKSYELPDG 247
Cdd:PTZ00466 172 YEGYSITNTITRTDVAGRDITTYLGYLLRKNGHLFNTSAEMEVVKNMKENCCYVSFNMNKEKNSSEKALTT-LPYILPDG 250
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  248 QVITIGGERFRCPEVLFQPSLVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSM 327
Cdd:PTZ00466 251 SQILIGSERYRAPEVLFNPSILGLEYLGLSELIVTSITRADMDLRRTLYSHIVLSGGTTMFHGFGDRLLNEIRKFAPKDI 330
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|
gi 15229955  328 KIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
Cdd:PTZ00466 331 TIRISAPPERKFSTFIGGSILASLATFKKIWISKQEFDEYGSVILHRKTF 380
PTZ00452 PTZ00452
actin; Provisional
10-377 1.03e-173

actin; Provisional


Pssm-ID: 185631  Cd Length: 375  Bit Score: 492.35  E-value: 1.03e-173
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955   10 LVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWH 89
Cdd:PTZ00452   8 VVIDNGSGYCKIGIAGDDAPTSCFPAIVGRSKQNDGIFSTFNKEYYVGEEAQAKRGVLAIKEPIQNGIINSWDDIEIIWH 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955   90 HTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE 169
Cdd:PTZ00452  88 HAFYNELCMSPEDQPVFMTDAPMNSKFNRERMTQIMFETFNTPCLYISNEAVLSLYTSGKTIGLVVDSGEGVTHCVPVFE 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  170 GYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDVKEKLAYIALDYEQEMETANTSSSVEKSYELPDGQV 249
Cdd:PTZ00452 168 GHQIPQAITKINLAGRLCTDYLTQILQELGYSLTEPHQRIIVKNIKERLCYTALDPQDEKRIYKESNSQDSPYKLPDGNI 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  250 ITIGGERFRCPEVLFQPSLVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKI 329
Cdd:PTZ00452 248 LTIKSQKFRCSEILFQPKLIGLEVAGIHHLAYSSIKKCDLDLRQELCRNIVLSGGTTLFPGIANRLSNELTNLVPSQLKI 327
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*...
gi 15229955  330 KVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
Cdd:PTZ00452 328 QVAAPPDRRFSAWIGGSIQCTLSTQQPQWIKRQEYDEQGPSIVHRKCF 375
COG5277 COG5277
Actin and related proteins [Cytoskeleton]
4-377 1.19e-162

Actin and related proteins [Cytoskeleton]


Pssm-ID: 227602  Cd Length: 444  Bit Score: 466.51  E-value: 1.19e-162
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955   4 GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPR-HTGVMVGMGQKDAYVGDEAQSKRGI--LTLKYPIEHGIVSN 80
Cdd:COG5277   3 GDNVPTIVIDNGSGTTKAGFAGNDTPTTVFPSIVGRRRdEDSVMEDTEEKDTYVGNEAQNDRDNslLELRYPIENGIILN 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  81 WDDMEKIWHHTFYNE--LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT--TGIVLD 156
Cdd:COG5277  83 WDAMEQIWDYTFFNKgdLLPSPEEHPLLLTEPPLNPPSNREKITELLFETLNVPALYLAIQAVLSLYASGSSdeTGLVID 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955 157 SGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE-----RGYSFTT---SAEREIVRDVKEKL-------AYI 221
Cdd:COG5277 163 SGDSVTHVIPVVDGIVLPKAVKRIDIGGRDITDYLKKLLREkyppsRGYNLKSelvEYSSEIVNEIKEEVcetddesAYV 242
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955 222 ALDYEQEMETA----------------NTSSSVEKSYELPDGQVITIG-GERFRCPEVLFQPSL---------------- 268
Cdd:COG5277 243 SLDAEEEFEEEeekpaekstestfqlsKETSIAKESKELPDGEEIEFGnEERFKAPEILFKPELpisgleeagkideskq 322
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955 269 -------------VGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPP 335
Cdd:COG5277 323 elvaenyeisptnLGNDIAGLPELVYQSIQICDEDVRKSLYSNIVLTGGTSKIPGFAERLQKELTSLAPSIWKVSVIPPP 402
                       410       420       430       440
                ....*....|....*....|....*....|....*....|..
gi 15229955 336 ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
Cdd:COG5277 403 DPSLDAWLGASILASLETFQQLWITKEEYEEHGPDILQEKRF 444
Actin pfam00022
Actin;
5-377 0e+00

Actin;


Pssm-ID: 249516 [Multi-domain]  Cd Length: 367  Bit Score: 655.83  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955     5 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMvgmgqKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDM 84
Cdd:pfam00022   1 DEVSALVIDNGSGTTKAGFAGEDAPRAVIPSVVGRPRGRGVE-----NKYYVGDEALSKRPGLEVRYPIEDGIVENWDAM 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955    85 EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHT 164
Cdd:pfam00022  76 EKIWEHTFFEELRVDPEEHPLLLTEPPLNPPANREKATEIMFETFGVPALYLAKQAVLSAYASGRTTGLVVDSGAGVTSV 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955   165 VPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDVKEKLAYIALDYEQEMETAntSSSVEKSYEL 244
Cdd:pfam00022 156 VPVYEGYVLQKAIRRSDLAGDDLTDYLRKLLSSRTYSFNTYAEEEVVRDIKESLCYVSDDPFGDTAAS--SSPPTVSYEL 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955   245 PDGQVITIGGERFRCPEVLFQPSLVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAP 324
Cdd:pfam00022 234 PDGYVIILGNERFRVPEILFNPSLIGSESAGIPELIYDSINACDVDLRPSLLANIVVTGGTTLFPGFTERLEKELAQLAP 313
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....
gi 15229955   325 SSMKIKVVAPP-ERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
Cdd:pfam00022 314 SGVKVKIIAPPnERKYSAWIGGSILASLGTFQQMWVSKQEYEEHGSSVVERKCF 367
ACTIN smart00268
Actin; ACTIN subfamily of ACTIN/mreB/sugarkinase/Hsp70 superfamily
8-377 0e+00

Actin; ACTIN subfamily of ACTIN/mreB/sugarkinase/Hsp70 superfamily


Pssm-ID: 214592 [Multi-domain]  Cd Length: 373  Bit Score: 638.53  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955      8 QPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGmGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKI 87
Cdd:smart00268   2 PAIVIDNGSGTIKAGFAGEDFPQVVFPSIVGRPKDGKGMVG-DAKDIFVGDEAQEKRGGLELKYPIENGIVENWDDMEKI 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955     88 WHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPI 167
Cdd:smart00268  81 WDYTFFNELRVEPEEHPVLLTEPPMNPKSNREKILEIMFETFNFPALYIAIQAVLSLYASGRTTGLVIDSGDGVTHVVPV 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955    168 YEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDVKEKLAYIALDYEQEMETANT---SSSVEKSYEL 244
Cdd:smart00268 161 VDGYVLPHAIKRIDIAGRDITDYLKELLSERGYQFNSSAEFEIVREIKEKLCYVAEDFEKEMKLAREsseSSKLEKTYEL 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955    245 PDGQVITIGGERFRCPEVLFQPSLVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAP 324
Cdd:smart00268 241 PDGNTIKVGNERFRIPEILFSPELIGLEQKGIHELVYESIQKCDIDVRKDLYENIVLSGGSTLIPGFGERLEKELKQLAP 320
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|...
gi 15229955    325 SSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
Cdd:smart00268 321 KKLKVKVIAPPERKYSVWLGGSILASLSTFEDMWITKKEYEESGSQIVERKCF 373
PTZ00280 PTZ00280
Actin-related protein 3; Provisional
10-374 2.98e-118

Actin-related protein 3; Provisional


Pssm-ID: 240343 [Multi-domain]  Cd Length: 414  Bit Score: 352.11  E-value: 2.98e-118
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955   10 LVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMV---GMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEK 86
Cdd:PTZ00280   7 VVIDNGTGYTKMGYAGNTEPTYIIPTLIADNSKQSRRRskkGFEDLDFYIGDEALAASKSYTLTYPMKHGIVEDWDLMEK 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955   87 IWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYAS----------GRTTGIVLD 156
Cdd:PTZ00280  87 FWEQCIFKYLRCEPEEHYFILTEPPMNPPENREYTAEIMFETFNVKGLYIAVQAVLALRASwtskkakelgGTLTGTVID 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  157 SGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDVKEKLAYIALDYEQEMETAN--- 233
Cdd:PTZ00280 167 SGDGVTHVIPVVDGYVIGSSIKHIPLAGRDITNFIQQMLRERGEPIPAEDILLLAQRIKEKYCYVAPDIAKEFEKYDsdp 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  234 ---------TSSSVEKSYElpdgqvITIGGERFRCPEVLFQPSLVGME-AAGIHETTYNSIMKCDVDIRKDLYGNIVLSG 303
Cdd:PTZ00280 247 knhfkkytaVNSVTKKPYT------VDVGYERFLGPEMFFHPEIFSSEwTTPLPEVVDDAIQSCPIDCRRPLYKNIVLSG 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229955  304 GTTMFPGIADRMSKEITA----------------LAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDES 367
Cdd:PTZ00280 321 GSTMFKGFDKRLQRDVRKrvdrrlkkaeelsggkLKPIPIDVNVVSHPRQRYAVWYGGSMLASSPEFEKVCHTKAEYDEY 400

                 ....*..
gi 15229955  368 GPSIVHR 374
Cdd:PTZ00280 401 GPSICRY 407
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH