NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|15219078|ref|NP_175683.1|]
View 

histone H2A protein 9 [Arabidopsis thaliana]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
H2A cd00074
Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two ...
26-130 1.90e-53

Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two H2A, H2B, H3, and H4 subunits. The H2A subunit performs essential roles in maintaining structural integrity of the nucleosome, chromatin condensation, and binding of specific chromatin-associated proteins.


:

Pssm-ID: 238029 [Multi-domain]  Cd Length: 115  Bit Score: 166.36  E-value: 1.90e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15219078  26 PITRSSRAGLQFPVGRVHRLLKTRSTAhGRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEE 105
Cdd:cd00074  10 KRSRSARAGLQFPVGRIHRYLKKGRYA-ERVGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKKRITPRHLQLAVRNDEE 88
                        90       100
                ....*....|....*....|....*.
gi 15219078 106 LDTLIKG-TIAGGGVIPHIHKSLINK 130
Cdd:cd00074  89 LNKLLKGvTIASGGVLPNIHKVLLPK 114
PTZ00017 PTZ00017
histone H2A; Provisional
1-133 1.25e-58

histone H2A; Provisional


:

Pssm-ID: 185399 [Multi-domain]  Cd Length: 134  Bit Score: 179.94  E-value: 1.25e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15219078    1 MSGKGAKGliMGKPSGSDkdkdkkkPITRSSRAGLQFPVGRVHRLLKTRSTAHgRVGATAAVYTAAILEYLTAEVLELAG 80
Cdd:PTZ00017   1 KGGKGKTG--GGKAGKKK-------PVSRSAKAGLQFPVGRVHRYLKKGRYAK-RVGAGAPVYLAAVLEYLTAEVLELAG 70
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 15219078   81 NASKDLKVKRISPRHLQLAIRGDEELDTLIKG-TIAGGGVIPHIHKSLINKSAK 133
Cdd:PTZ00017  71 NAAKDNKKKRITPRHIQLAIRNDEELNKLLAGvTIASGGVLPNIHKVLLPKKSK 124
 
Name Accession Description Interval E-value
H2A cd00074
Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two ...
26-130 1.90e-53

Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two H2A, H2B, H3, and H4 subunits. The H2A subunit performs essential roles in maintaining structural integrity of the nucleosome, chromatin condensation, and binding of specific chromatin-associated proteins.


Pssm-ID: 238029 [Multi-domain]  Cd Length: 115  Bit Score: 166.36  E-value: 1.90e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15219078  26 PITRSSRAGLQFPVGRVHRLLKTRSTAhGRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEE 105
Cdd:cd00074  10 KRSRSARAGLQFPVGRIHRYLKKGRYA-ERVGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKKRITPRHLQLAVRNDEE 88
                        90       100
                ....*....|....*....|....*.
gi 15219078 106 LDTLIKG-TIAGGGVIPHIHKSLINK 130
Cdd:cd00074  89 LNKLLKGvTIASGGVLPNIHKVLLPK 114
PLN00154 PLN00154
histone H2A; Provisional
1-134 1.20e-70

histone H2A; Provisional


Pssm-ID: 177756  Cd Length: 136  Bit Score: 210.96  E-value: 1.20e-70
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15219078    1 MSGKGAKGLIMGKPSGSDKDKDK--KKPITRSSRAGLQFPVGRVHRLLKTRSTAHGRVGATAAVYTAAILEYLTAEVLEL 78
Cdd:PLN00154   1 MSGKGGKGLLAAKTTAAAAKKDKdkKKPTSRSSRAGLQFPVGRIHRQLKQRVSAHGRVGATAAVYTAAILEYLTAEVLEL 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 15219078   79 AGNASKDLKVKRISPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSAKE 134
Cdd:PLN00154  81 AGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSTKK 136
H2A smart00414
Histone 2A;
28-133 2.56e-54

Histone 2A;


Pssm-ID: 197711  Cd Length: 106  Bit Score: 168.28  E-value: 2.56e-54
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15219078     28 TRSSRAGLQFPVGRVHRLLKTRSTAHgRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELD 107
Cdd:smart00414   1 SRSARAGLQFPVGRIHRLLRKGTYAK-RVGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKRRITPRHLQLAIRNDEELN 79
                           90       100
                   ....*....|....*....|....*..
gi 15219078    108 TLIKG-TIAGGGVIPHIHKSLINKSAK 133
Cdd:smart00414  80 KLLKGvTIAQGGVLPNIHKVLLPKKTG 106
HTA1 COG5262
Histone H2A [Chromatin structure and dynamics];
28-134 2.10e-41

Histone H2A [Chromatin structure and dynamics];


Pssm-ID: 227587  Cd Length: 132  Bit Score: 136.15  E-value: 2.10e-41
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15219078  28 TRSSRAGLQFPVGRVHRLLKTRSTAHgRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELD 107
Cdd:COG5262  18 SRSAKAGLIFPVGRVKRLLKKGNYRM-RIGAGAPVYLAAVLEYLAAEILELAGNAARDNKKKRIIPRHLQLAIRNDEELN 96
                        90       100
                ....*....|....*....|....*...
gi 15219078 108 TLIKG-TIAGGGVIPHIHKSLINKSAKE 134
Cdd:COG5262  97 KLLGDvTIAQGGVLPNINPGLLPKSSKK 124
Histone pfam00125
Core histone H2A/H2B/H3/H4;
29-103 5.62e-23

Core histone H2A/H2B/H3/H4;


Pssm-ID: 249609  Cd Length: 75  Bit Score: 86.44  E-value: 5.62e-23
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 15219078    29 RSSRAGLQFPVGRVHRLLKTRSTAHGRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGD 103
Cdd:pfam00125   1 RSRLLILKLPFSRVVRELKEGFYAGLRISSKAPVALQEALEDLLEEILEDAGLLARHAKRKTITPRDIQLAVRLD 75
PTZ00252 PTZ00252
histone H2A; Provisional
29-130 1.63e-22

histone H2A; Provisional


Pssm-ID: 240330  Cd Length: 134  Bit Score: 86.94  E-value: 1.63e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15219078   29 RSSRAGLQFPVGRVHRLLKTRSTAHgRVGATAAVYTAAILEYLTAEVLELAGNAS--KDLKVKRISPRHLQLAIRGDEEL 106
Cdd:PTZ00252  18 RSAKAGLIFPVGRVGSLLRRGQYAR-RIGASGAVYMAAVLEYLTAELLELSVKAAaqQAKKPKRLTPRTVTLAVRHDDDL 96
                         90       100
                 ....*....|....*....|....*
gi 15219078  107 DTLIKG-TIAGGGVIPHIHKSLINK 130
Cdd:PTZ00252  97 GSLLKNvTLSRGGVMPSLNKALAKK 121
PTZ00017 PTZ00017
histone H2A; Provisional
1-133 1.25e-58

histone H2A; Provisional


Pssm-ID: 185399 [Multi-domain]  Cd Length: 134  Bit Score: 179.94  E-value: 1.25e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15219078    1 MSGKGAKGliMGKPSGSDkdkdkkkPITRSSRAGLQFPVGRVHRLLKTRSTAHgRVGATAAVYTAAILEYLTAEVLELAG 80
Cdd:PTZ00017   1 KGGKGKTG--GGKAGKKK-------PVSRSAKAGLQFPVGRVHRYLKKGRYAK-RVGAGAPVYLAAVLEYLTAEVLELAG 70
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 15219078   81 NASKDLKVKRISPRHLQLAIRGDEELDTLIKG-TIAGGGVIPHIHKSLINKSAK 133
Cdd:PTZ00017  71 NAAKDNKKKRITPRHIQLAIRNDEELNKLLAGvTIASGGVLPNIHKVLLPKKSK 124
PLN00157 PLN00157
histone H2A; Provisional
26-133 3.42e-38

histone H2A; Provisional


Pssm-ID: 177758 [Multi-domain]  Cd Length: 132  Bit Score: 127.66  E-value: 3.42e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15219078   26 PITRSSRAGLQFPVGRVHRLLKTRSTAHgRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEE 105
Cdd:PLN00157  16 ATSRSAKAGLQFPVGRIARYLKAGKYAT-RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIVPRHIQLAVRNDEE 94
                         90       100
                 ....*....|....*....|....*....
gi 15219078  106 LDTLIKG-TIAGGGVIPHIHKSLINKSAK 133
Cdd:PLN00157  95 LSKLLGGvTIAAGGVLPNIHSVLLPKKSG 123
 
Name Accession Description Interval E-value
H2A cd00074
Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two ...
26-130 1.90e-53

Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two H2A, H2B, H3, and H4 subunits. The H2A subunit performs essential roles in maintaining structural integrity of the nucleosome, chromatin condensation, and binding of specific chromatin-associated proteins.


Pssm-ID: 238029 [Multi-domain]  Cd Length: 115  Bit Score: 166.36  E-value: 1.90e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15219078  26 PITRSSRAGLQFPVGRVHRLLKTRSTAhGRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEE 105
Cdd:cd00074  10 KRSRSARAGLQFPVGRIHRYLKKGRYA-ERVGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKKRITPRHLQLAVRNDEE 88
                        90       100
                ....*....|....*....|....*.
gi 15219078 106 LDTLIKG-TIAGGGVIPHIHKSLINK 130
Cdd:cd00074  89 LNKLLKGvTIASGGVLPNIHKVLLPK 114
PLN00154 PLN00154
histone H2A; Provisional
1-134 1.20e-70

histone H2A; Provisional


Pssm-ID: 177756  Cd Length: 136  Bit Score: 210.96  E-value: 1.20e-70
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15219078    1 MSGKGAKGLIMGKPSGSDKDKDK--KKPITRSSRAGLQFPVGRVHRLLKTRSTAHGRVGATAAVYTAAILEYLTAEVLEL 78
Cdd:PLN00154   1 MSGKGGKGLLAAKTTAAAAKKDKdkKKPTSRSSRAGLQFPVGRIHRQLKQRVSAHGRVGATAAVYTAAILEYLTAEVLEL 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 15219078   79 AGNASKDLKVKRISPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSAKE 134
Cdd:PLN00154  81 AGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSTKK 136
H2A smart00414
Histone 2A;
28-133 2.56e-54

Histone 2A;


Pssm-ID: 197711  Cd Length: 106  Bit Score: 168.28  E-value: 2.56e-54
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15219078     28 TRSSRAGLQFPVGRVHRLLKTRSTAHgRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELD 107
Cdd:smart00414   1 SRSARAGLQFPVGRIHRLLRKGTYAK-RVGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKRRITPRHLQLAIRNDEELN 79
                           90       100
                   ....*....|....*....|....*..
gi 15219078    108 TLIKG-TIAGGGVIPHIHKSLINKSAK 133
Cdd:smart00414  80 KLLKGvTIAQGGVLPNIHKVLLPKKTG 106
HTA1 COG5262
Histone H2A [Chromatin structure and dynamics];
28-134 2.10e-41

Histone H2A [Chromatin structure and dynamics];


Pssm-ID: 227587  Cd Length: 132  Bit Score: 136.15  E-value: 2.10e-41
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15219078  28 TRSSRAGLQFPVGRVHRLLKTRSTAHgRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELD 107
Cdd:COG5262  18 SRSAKAGLIFPVGRVKRLLKKGNYRM-RIGAGAPVYLAAVLEYLAAEILELAGNAARDNKKKRIIPRHLQLAIRNDEELN 96
                        90       100
                ....*....|....*....|....*...
gi 15219078 108 TLIKG-TIAGGGVIPHIHKSLINKSAKE 134
Cdd:COG5262  97 KLLGDvTIAQGGVLPNINPGLLPKSSKK 124
Histone pfam00125
Core histone H2A/H2B/H3/H4;
29-103 5.62e-23

Core histone H2A/H2B/H3/H4;


Pssm-ID: 249609  Cd Length: 75  Bit Score: 86.44  E-value: 5.62e-23
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 15219078    29 RSSRAGLQFPVGRVHRLLKTRSTAHGRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGD 103
Cdd:pfam00125   1 RSRLLILKLPFSRVVRELKEGFYAGLRISSKAPVALQEALEDLLEEILEDAGLLARHAKRKTITPRDIQLAVRLD 75
PTZ00252 PTZ00252
histone H2A; Provisional
29-130 1.63e-22

histone H2A; Provisional


Pssm-ID: 240330  Cd Length: 134  Bit Score: 86.94  E-value: 1.63e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15219078   29 RSSRAGLQFPVGRVHRLLKTRSTAHgRVGATAAVYTAAILEYLTAEVLELAGNAS--KDLKVKRISPRHLQLAIRGDEEL 106
Cdd:PTZ00252  18 RSAKAGLIFPVGRVGSLLRRGQYAR-RIGASGAVYMAAVLEYLTAELLELSVKAAaqQAKKPKRLTPRTVTLAVRHDDDL 96
                         90       100
                 ....*....|....*....|....*
gi 15219078  107 DTLIKG-TIAGGGVIPHIHKSLINK 130
Cdd:PTZ00252  97 GSLLKNvTLSRGGVMPSLNKALAKK 121
PLN00155 PLN00155
histone H2A; Provisional
1-71 3.08e-09

histone H2A; Provisional


Pssm-ID: 165723  Cd Length: 58  Bit Score: 49.32  E-value: 3.08e-09
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 15219078    1 MSGKGAkglimGKPSGSDKdkdkkkpITRSSRAGLQFPVGRVHRLLKTRSTAHgRVGATAAVYTAAILEYL 71
Cdd:PLN00155   1 MAGRGK-----GKTSGKKA-------VSRSAKAGLQFPVGRIARYLKKGKYAE-RIGAGAPVYLAAVLEYL 58
BUR6 COG5247
Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription];
11-109 1.77e-07

Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription];


Pssm-ID: 227572  Cd Length: 113  Bit Score: 45.34  E-value: 1.77e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15219078  11 MGKPSGSDKDKDKKKPITRSSRaglQFPVGRVHRLLKTRSTAhGRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKR 90
Cdd:COG5247   1 GGSPVGNMGTMPKQNSQKKKKT---RFPIARLKKIMQLDEDI-GKVGQSTPVIASKALEMFLTEIVGLSLKEARKKSSKR 76
                        90
                ....*....|....*....
gi 15219078  91 ISPRHLQLAIRGDEELDTL 109
Cdd:COG5247  77 MTSEFLKRATESDEKFDFL 95
PTZ00017 PTZ00017
histone H2A; Provisional
1-133 1.25e-58

histone H2A; Provisional


Pssm-ID: 185399 [Multi-domain]  Cd Length: 134  Bit Score: 179.94  E-value: 1.25e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15219078    1 MSGKGAKGliMGKPSGSDkdkdkkkPITRSSRAGLQFPVGRVHRLLKTRSTAHgRVGATAAVYTAAILEYLTAEVLELAG 80
Cdd:PTZ00017   1 KGGKGKTG--GGKAGKKK-------PVSRSAKAGLQFPVGRVHRYLKKGRYAK-RVGAGAPVYLAAVLEYLTAEVLELAG 70
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 15219078   81 NASKDLKVKRISPRHLQLAIRGDEELDTLIKG-TIAGGGVIPHIHKSLINKSAK 133
Cdd:PTZ00017  71 NAAKDNKKKRITPRHIQLAIRNDEELNKLLAGvTIASGGVLPNIHKVLLPKKSK 124
PLN00157 PLN00157
histone H2A; Provisional
26-133 3.42e-38

histone H2A; Provisional


Pssm-ID: 177758 [Multi-domain]  Cd Length: 132  Bit Score: 127.66  E-value: 3.42e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15219078   26 PITRSSRAGLQFPVGRVHRLLKTRSTAHgRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEE 105
Cdd:PLN00157  16 ATSRSAKAGLQFPVGRIARYLKAGKYAT-RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIVPRHIQLAVRNDEE 94
                         90       100
                 ....*....|....*....|....*....
gi 15219078  106 LDTLIKG-TIAGGGVIPHIHKSLINKSAK 133
Cdd:PLN00157  95 LSKLLGGvTIAAGGVLPNIHSVLLPKKSG 123
PLN00156 PLN00156
histone H2AX; Provisional
1-132 9.22e-36

histone H2AX; Provisional


Pssm-ID: 215080 [Multi-domain]  Cd Length: 139  Bit Score: 121.61  E-value: 9.22e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15219078    1 MSGKGAKGlimgKPSGSDKdkdkkkpITRSSRAGLQFPVGRVHRLLKTRSTAHgRVGATAAVYTAAILEYLTAEVLELAG 80
Cdd:PLN00156   5 GTTKGGRG----KPKATKS-------VSRSSKAGLQFPVGRIARFLKAGKYAE-RVGAGAPVYLSAVLEYLAAEVLELAG 72
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|...
gi 15219078   81 NASKDLKVKRISPRHLQLAIRGDEELDTLIKG-TIAGGGVIPHIHKSLINKSA 132
Cdd:PLN00156  73 NAARDNKKNRIVPRHIQLAVRNDEELSKLLGSvTIAAGGVLPNIHQTLLPKKV 125
PLN00153 PLN00153
histone H2A; Provisional
27-133 5.99e-31

histone H2A; Provisional


Pssm-ID: 165721 [Multi-domain]  Cd Length: 129  Bit Score: 109.04  E-value: 5.99e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15219078   27 ITRSSRAGLQFPVGRVHRLLKTRSTAHgRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEEL 106
Cdd:PLN00153  15 VSRSAKAGLQFPVGRIARYLKKGKYAE-RIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKNRIVPRHIQLAIRNDEEL 93
                         90       100
                 ....*....|....*....|....*...
gi 15219078  107 DTLI-KGTIAGGGVIPHIHKSLINKSAK 133
Cdd:PLN00153  94 GKLLgEVTIASGGVLPNIHAVLLPKKTK 121
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH