NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|15011870|ref|NP_149161|]
View 

beta-1,3-galactosyltransferase 5 [Mus musculus]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Galactosyl_T super family cl18377
Galactosyltransferase; This family includes the galactosyltransferases UDP-galactose: ...
69-259 2.08e-62

Galactosyltransferase; This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.


The actual alignment was detected with superfamily member pfam01762:

Pssm-ID: 250845  Cd Length: 196  Bit Score: 198.32  E-value: 2.08e-62
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15011870    69 AARMAIRKTWGRETSVQGQQVRTFFLLGTSDSTEE--MDATTLESEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFCPQ 146
Cdd:pfam01762   1 ARRNAIRKTWMNQGNSEGGRIKSLFLVGLSADTDGkvADLVMEEAKLYGDIVQVDFEDTYENLTYKTLTGLLWAVSKCPS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15011870   147 TAYVMKTDSDMFVNVGYLTELLLKKNKTTR--FFTGYIKPHDFPIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFSSDVA 224
Cdd:pfam01762  81 AKYIGKIDDDVYFFPDKLLSLLDNGNIDPSesSFYGYVMKEGPVIRNKKSKWYVSPSDYKCSRYPPYASGPFYVLSRDAA 160
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 15011870   225 IQVYNVSESVPFIKLEDVFV-GLCLAKLKIRPEELH 259
Cdd:pfam01762 161 EKLLKASKHRRFLQIEDVYVtGILANDLGISRVNLP 196
 
Name Accession Description Interval E-value
Galactosyl_T pfam01762
Galactosyltransferase; This family includes the galactosyltransferases UDP-galactose: ...
69-259 2.08e-62

Galactosyltransferase; This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.


Pssm-ID: 250845  Cd Length: 196  Bit Score: 198.32  E-value: 2.08e-62
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15011870    69 AARMAIRKTWGRETSVQGQQVRTFFLLGTSDSTEE--MDATTLESEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFCPQ 146
Cdd:pfam01762   1 ARRNAIRKTWMNQGNSEGGRIKSLFLVGLSADTDGkvADLVMEEAKLYGDIVQVDFEDTYENLTYKTLTGLLWAVSKCPS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15011870   147 TAYVMKTDSDMFVNVGYLTELLLKKNKTTR--FFTGYIKPHDFPIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFSSDVA 224
Cdd:pfam01762  81 AKYIGKIDDDVYFFPDKLLSLLDNGNIDPSesSFYGYVMKEGPVIRNKKSKWYVSPSDYKCSRYPPYASGPFYVLSRDAA 160
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 15011870   225 IQVYNVSESVPFIKLEDVFV-GLCLAKLKIRPEELH 259
Cdd:pfam01762 161 EKLLKASKHRRFLQIEDVYVtGILANDLGISRVNLP 196
PLN03133 PLN03133
beta-1,3-galactosyltransferase; Provisional
53-305 2.26e-28

beta-1,3-galactosyltransferase; Provisional


Pssm-ID: 215596 [Multi-domain]  Cd Length: 636  Bit Score: 114.51  E-value: 2.26e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15011870   53 KPPFLVLLVTSSHKQLAARMAIRKTWGRETSVQGQQVRTFFLLGTSDSTEEMDATTLESEQHRDIIQKDFKDAYFNLTLK 132
Cdd:PLN03133 383 KPLDLFIGVFSTANNFKRRMAVRRTWMQYDAVRSGAVAVRFFVGLHKNQMVNEELWNEARTYGDIQLMPFVDYYSLITWK 462
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15011870  133 T----MMGMEWVyhfcpQTAYVMKTDSDMFVNVgylTELL--LKKNKTTR-FFTGYIKPHDFPIRQKFNKWFVSKFEYPW 205
Cdd:PLN03133 463 TlaicIFGTEVV-----SAKYVMKTDDDAFVRV---DEVLasLKRTNVSHgLLYGLINSDSQPHRNPDSKWYISPEEWPE 534
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15011870  206 DRYPPFCSGTGYVFSSDVAIQVYNVSES--VPFIKLEDVFVGLCLAKLKIRPEELHTKQTffpGGLRFSVCRFQKIVAcH 283
Cdd:PLN03133 535 ETYPPWAHGPGYVVSRDIAKEVYKRHKEgrLKMFKLEDVAMGIWIAEMKKEGLEVKYEND---GRIYNEGCKDGYVVA-H 610
                        250       260
                 ....*....|....*....|..
gi 15011870  284 FMKPQDLLTYWQALENSKEQDC 305
Cdd:PLN03133 611 YQSPREMLCLWQKLQEGKRATC 632
 
Name Accession Description Interval E-value
Galactosyl_T pfam01762
Galactosyltransferase; This family includes the galactosyltransferases UDP-galactose: ...
69-259 2.08e-62

Galactosyltransferase; This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.


Pssm-ID: 250845  Cd Length: 196  Bit Score: 198.32  E-value: 2.08e-62
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15011870    69 AARMAIRKTWGRETSVQGQQVRTFFLLGTSDSTEE--MDATTLESEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFCPQ 146
Cdd:pfam01762   1 ARRNAIRKTWMNQGNSEGGRIKSLFLVGLSADTDGkvADLVMEEAKLYGDIVQVDFEDTYENLTYKTLTGLLWAVSKCPS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15011870   147 TAYVMKTDSDMFVNVGYLTELLLKKNKTTR--FFTGYIKPHDFPIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFSSDVA 224
Cdd:pfam01762  81 AKYIGKIDDDVYFFPDKLLSLLDNGNIDPSesSFYGYVMKEGPVIRNKKSKWYVSPSDYKCSRYPPYASGPFYVLSRDAA 160
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 15011870   225 IQVYNVSESVPFIKLEDVFV-GLCLAKLKIRPEELH 259
Cdd:pfam01762 161 EKLLKASKHRRFLQIEDVYVtGILANDLGISRVNLP 196
PLN03133 PLN03133
beta-1,3-galactosyltransferase; Provisional
53-305 2.26e-28

beta-1,3-galactosyltransferase; Provisional


Pssm-ID: 215596 [Multi-domain]  Cd Length: 636  Bit Score: 114.51  E-value: 2.26e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15011870   53 KPPFLVLLVTSSHKQLAARMAIRKTWGRETSVQGQQVRTFFLLGTSDSTEEMDATTLESEQHRDIIQKDFKDAYFNLTLK 132
Cdd:PLN03133 383 KPLDLFIGVFSTANNFKRRMAVRRTWMQYDAVRSGAVAVRFFVGLHKNQMVNEELWNEARTYGDIQLMPFVDYYSLITWK 462
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15011870  133 T----MMGMEWVyhfcpQTAYVMKTDSDMFVNVgylTELL--LKKNKTTR-FFTGYIKPHDFPIRQKFNKWFVSKFEYPW 205
Cdd:PLN03133 463 TlaicIFGTEVV-----SAKYVMKTDDDAFVRV---DEVLasLKRTNVSHgLLYGLINSDSQPHRNPDSKWYISPEEWPE 534
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15011870  206 DRYPPFCSGTGYVFSSDVAIQVYNVSES--VPFIKLEDVFVGLCLAKLKIRPEELHTKQTffpGGLRFSVCRFQKIVAcH 283
Cdd:PLN03133 535 ETYPPWAHGPGYVVSRDIAKEVYKRHKEgrLKMFKLEDVAMGIWIAEMKKEGLEVKYEND---GRIYNEGCKDGYVVA-H 610
                        250       260
                 ....*....|....*....|..
gi 15011870  284 FMKPQDLLTYWQALENSKEQDC 305
Cdd:PLN03133 611 YQSPREMLCLWQKLQEGKRATC 632
PLN03193 PLN03193
beta-1,3-galactosyltransferase; Provisional
63-224 3.68e-04

beta-1,3-galactosyltransferase; Provisional


Pssm-ID: 178735 [Multi-domain]  Cd Length: 408  Bit Score: 40.34  E-value: 3.68e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15011870   63 SSHKQlaaRMAIRKTW-----GRETSVQGQQVRTFFLLGTSDSTEEMDATTLESE--QHRDIIQKDFKDAYFNLTLKTMM 135
Cdd:PLN03193 150 SSRKR---RDSVRATWmpqgeKRKKLEEEKGIIIRFVIGHSATSGGILDRAIEAEdrKHGDFLRLDHVEGYLELSAKTKT 226
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15011870  136 GMEWVYHFCPQTAYVmKTDSDMFVNVGYLTELLLKKNKTTRFFTGYIKPHDFpIRQKFNKWFVS---KFEYPWDRYPPFC 212
Cdd:PLN03193 227 YFATAVAMWDADFYV-KVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPV-LSQKGVRYHEPeywKFGENGNKYFRHA 304
                        170
                 ....*....|..
gi 15011870  213 SGTGYVFSSDVA 224
Cdd:PLN03193 305 TGQLYAISKDLA 316
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH