NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|149732972|ref|XP_001500811.1|]
View 

PREDICTED: cadherin-6 [Equus caballus]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
163-264 4.85e-29

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


:

Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 112.41  E-value: 4.85e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972 163 VYTATVPEMSDVGTFVVQVTATDADDptyGNSAKVVYSILQGQP--YFSVESETGIIKTAlLNMDRENREQYQVVIQAKD 240
Cdd:cd11304    1 SYEVSVPENAPPGTVVLTVSATDPDS---GENGEVTYSIVSGNEdgLFSIDPSTGEITTA-KPLDREEQSSYTLTVTATD 76
                         90       100
                 ....*....|....*....|....
gi 149732972 241 MGGQmgGLSGTTTVNITLTDVNDN 264
Cdd:cd11304   77 GGGP--PLSSTATVTITVLDVNDN 98
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
272-379 9.34e-27

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


:

Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 105.86  E-value: 9.34e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972 272 TYQFKTPESSPPGTPIGRIKASDADVGENAAIEYSITEGEGLDMFDVitDQETqeGIITVKKLLDFEKKKVYTLKVEASN 351
Cdd:cd11304    1 SYEVSVPENAPPGTVVLTVSATDPDSGENGEVTYSIVSGNEDGLFSI--DPST--GEITTAKPLDREEQSSYTLTVTATD 76
                         90       100
                 ....*....|....*....|....*...
gi 149732972 352 PHVEPRFlylgpfkDSATVRIMVEDVDE 379
Cdd:cd11304   77 GGGPPLS-------STATVTITVLDVND 97
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
388-484 9.48e-26

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


:

Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 102.78  E-value: 9.48e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972 388 YILQIREDAQINTTIGSVSAQDPDAARN-PVKYSVDRHTDmDRIFNIDSGNGSIFTSKLLDRETLLWHNITVIATEINNP 466
Cdd:cd11304    2 YEVSVPENAPPGTVVLTVSATDPDSGENgEVTYSIVSGNE-DGLFSIDPSTGEITTAKPLDREEQSSYTLTVTATDGGGP 80
                         90
                 ....*....|....*...
gi 149732972 467 KQSSRVPLYIKVLDVNDN 484
Cdd:cd11304   81 PLSSTATVTITVLDVNDN 98
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
72-155 1.37e-15

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


:

Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 73.89  E-value: 1.37e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972  72 QYVGKLH-SDQDRGD-GSLKYILSGDGAGDLFIINENTGDIQATKRLDREEKPVYILRAQAINRRtGRPVEPESEFIIKI 149
Cdd:cd11304   14 TVVLTVSaTDPDSGEnGEVTYSIVSGNEDGLFSIDPSTGEITTAKPLDREEQSSYTLTVTATDGG-GPPLSSTATVTITV 92

                 ....*.
gi 149732972 150 HDINDN 155
Cdd:cd11304   93 LDVNDN 98
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
492-589 2.98e-12

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


:

Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 64.26  E-value: 2.98e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972 492 YETFVCEKAKADQLIQTLRAVDKDDPYSGhQFSFSLAPEAASGsNFTIqdnkDNTAGILTRKNGYNRHEMSTYLLPVVIS 571
Cdd:cd11304    2 YEVSVPENAPPGTVVLTVSATDPDSGENG-EVTYSIVSGNEDG-LFSI----DPSTGEITTAKPLDREEQSSYTLTVTAT 75
                         90
                 ....*....|....*...
gi 149732972 572 DNDYPVQSSTGTVTVRVC 589
Cdd:cd11304   76 DGGGPPLSSTATVTITVL 93
Cadherin_C pfam01049
Cadherin cytoplasmic region; Cadherins are vital in cell-cell adhesion during tissue ...
637-783 3.84e-72

Cadherin cytoplasmic region; Cadherins are vital in cell-cell adhesion during tissue differentiation. Cadherins are linked to the cytoskeleton by catenins. Catenins bind to the cytoplasmic tail of the cadherin. Cadherins cluster to form foci of homophilic binding units. A key determinant to the strength of the binding that it is mediated by cadherins is the juxtamembrane region of the cadherin. This region induces clustering and also binds to the protein p120ctn.


:

Pssm-ID: 250323  Cd Length: 144  Bit Score: 233.73  E-value: 3.84e-72
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972  637 RRQRKKEPLIISKE-DIRDNIVSYNDEGGGEEDTQAFDIGTLRNPEAIEDSKlrrdIVPEALFLPRRTPAarDNTDVRDF 715
Cdd:pfam01049   2 RRKKEPEKLIISEEdDIRENIVNYDDEGGGEEDTDAYDISALRNPLDPEPEK----IPPLISAQPRYRPP--DPGDVGDF 75
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 149732972  716 INQRLKENDTDPTAPPYDSLATYAYEGTGSVADSLSSLESVTTDGDQDYDYLSDWGPRFKKLADMYGG 783
Cdd:pfam01049  76 IHEKLPEADNDPTAPPYDSLLTYAYEGRGSVAGSLSSLNSSSSDGDQDYDYLSDWGPRFKKLADLYGG 143
 
Name Accession Description Interval E-value
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
163-264 4.85e-29

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 112.41  E-value: 4.85e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972 163 VYTATVPEMSDVGTFVVQVTATDADDptyGNSAKVVYSILQGQP--YFSVESETGIIKTAlLNMDRENREQYQVVIQAKD 240
Cdd:cd11304    1 SYEVSVPENAPPGTVVLTVSATDPDS---GENGEVTYSIVSGNEdgLFSIDPSTGEITTA-KPLDREEQSSYTLTVTATD 76
                         90       100
                 ....*....|....*....|....
gi 149732972 241 MGGQmgGLSGTTTVNITLTDVNDN 264
Cdd:cd11304   77 GGGP--PLSSTATVTITVLDVNDN 98
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
272-379 9.34e-27

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 105.86  E-value: 9.34e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972 272 TYQFKTPESSPPGTPIGRIKASDADVGENAAIEYSITEGEGLDMFDVitDQETqeGIITVKKLLDFEKKKVYTLKVEASN 351
Cdd:cd11304    1 SYEVSVPENAPPGTVVLTVSATDPDSGENGEVTYSIVSGNEDGLFSI--DPST--GEITTAKPLDREEQSSYTLTVTATD 76
                         90       100
                 ....*....|....*....|....*...
gi 149732972 352 PHVEPRFlylgpfkDSATVRIMVEDVDE 379
Cdd:cd11304   77 GGGPPLS-------STATVTITVLDVND 97
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
388-484 9.48e-26

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 102.78  E-value: 9.48e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972 388 YILQIREDAQINTTIGSVSAQDPDAARN-PVKYSVDRHTDmDRIFNIDSGNGSIFTSKLLDRETLLWHNITVIATEINNP 466
Cdd:cd11304    2 YEVSVPENAPPGTVVLTVSATDPDSGENgEVTYSIVSGNE-DGLFSIDPSTGEITTAKPLDREEQSSYTLTVTATDGGGP 80
                         90
                 ....*....|....*...
gi 149732972 467 KQSSRVPLYIKVLDVNDN 484
Cdd:cd11304   81 PLSSTATVTITVLDVNDN 98
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
72-155 1.37e-15

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 73.89  E-value: 1.37e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972  72 QYVGKLH-SDQDRGD-GSLKYILSGDGAGDLFIINENTGDIQATKRLDREEKPVYILRAQAINRRtGRPVEPESEFIIKI 149
Cdd:cd11304   14 TVVLTVSaTDPDSGEnGEVTYSIVSGNEDGLFSIDPSTGEITTAKPLDREEQSSYTLTVTATDGG-GPPLSSTATVTITV 92

                 ....*.
gi 149732972 150 HDINDN 155
Cdd:cd11304   93 LDVNDN 98
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
492-589 2.98e-12

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 64.26  E-value: 2.98e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972 492 YETFVCEKAKADQLIQTLRAVDKDDPYSGhQFSFSLAPEAASGsNFTIqdnkDNTAGILTRKNGYNRHEMSTYLLPVVIS 571
Cdd:cd11304    2 YEVSVPENAPPGTVVLTVSATDPDSGENG-EVTYSIVSGNEDG-LFSI----DPSTGEITTAKPLDREEQSSYTLTVTAT 75
                         90
                 ....*....|....*...
gi 149732972 572 DNDYPVQSSTGTVTVRVC 589
Cdd:cd11304   76 DGGGPPLSSTATVTITVL 93
Cadherin_C pfam01049
Cadherin cytoplasmic region; Cadherins are vital in cell-cell adhesion during tissue ...
637-783 3.84e-72

Cadherin cytoplasmic region; Cadherins are vital in cell-cell adhesion during tissue differentiation. Cadherins are linked to the cytoskeleton by catenins. Catenins bind to the cytoplasmic tail of the cadherin. Cadherins cluster to form foci of homophilic binding units. A key determinant to the strength of the binding that it is mediated by cadherins is the juxtamembrane region of the cadherin. This region induces clustering and also binds to the protein p120ctn.


Pssm-ID: 250323  Cd Length: 144  Bit Score: 233.73  E-value: 3.84e-72
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972  637 RRQRKKEPLIISKE-DIRDNIVSYNDEGGGEEDTQAFDIGTLRNPEAIEDSKlrrdIVPEALFLPRRTPAarDNTDVRDF 715
Cdd:pfam01049   2 RRKKEPEKLIISEEdDIRENIVNYDDEGGGEEDTDAYDISALRNPLDPEPEK----IPPLISAQPRYRPP--DPGDVGDF 75
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 149732972  716 INQRLKENDTDPTAPPYDSLATYAYEGTGSVADSLSSLESVTTDGDQDYDYLSDWGPRFKKLADMYGG 783
Cdd:pfam01049  76 IHEKLPEADNDPTAPPYDSLLTYAYEGRGSVAGSLSSLNSSSSDGDQDYDYLSDWGPRFKKLADLYGG 143
CA smart00112
Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. ...
182-266 9.90e-22

Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.


Pssm-ID: 214520  Cd Length: 81  Bit Score: 90.87  E-value: 9.90e-22
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972   182 TATDADDptyGNSAKVVYSILQG--QPYFSVESETGIIKTALlNMDRENREQYQVVIQAKDMGGQmgGLSGTTTVNITLT 259
Cdd:smart00112   1 SATDADS---GENGKVTYSILSGndDGLFSIDPETGEITTTK-PLDREEQPEYTLTVEATDGGGP--PLSSTATVTITVL 74

                   ....*..
gi 149732972   260 DVNDNPP 266
Cdd:smart00112  75 DVNDNAP 81
Cadherin pfam00028
Cadherin domain;
164-259 7.13e-20

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 85.82  E-value: 7.13e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972  164 YTATVPEMSDVGTFVVQVTATDADDPTygnSAKVVYSILQGQPY--FSVESETGIIKTAlLNMDRENREQYQVVIQAKDM 241
Cdd:pfam00028   1 YSASVPENAPVGTEVLTVTATDADLGP---NGRIFYSILGGGPGgwFRIDPDTGDLSTT-KPLDRESIGEYELTVLATDS 76
                          90
                  ....*....|....*...
gi 149732972  242 GGQmgGLSGTTTVNITLT 259
Cdd:pfam00028  77 GSP--PLSSTTTVTITVL 92
CA smart00112
Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. ...
406-486 5.10e-18

Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.


Pssm-ID: 214520  Cd Length: 81  Bit Score: 80.47  E-value: 5.10e-18
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972   406 SAQDPDAARN-PVKYSVDRHTDmDRIFNIDSGNGSIFTSKLLDRETLLWHNITVIATEINNPKQSSRVPLYIKVLDVNDN 484
Cdd:smart00112   1 SATDADSGENgKVTYSILSGND-DGLFSIDPETGEITTTKPLDREEQPEYTLTVEATDGGGPPLSSTATVTITVLDVNDN 79

                   ..
gi 149732972   485 AP 486
Cdd:smart00112  80 AP 81
CA smart00112
Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. ...
79-157 1.30e-16

Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.


Pssm-ID: 214520  Cd Length: 81  Bit Score: 76.23  E-value: 1.30e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972    79 SDQDRGD-GSLKYILSGDGAGDLFIINENTGDIQATKRLDREEKPVYILRAQAINrRTGRPVEPESEFIIKIHDINDNEP 157
Cdd:smart00112   3 TDADSGEnGKVTYSILSGNDDGLFSIDPETGEITTTKPLDREEQPEYTLTVEATD-GGGPPLSSTATVTITVLDVNDNAP 81
CA smart00112
Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. ...
291-381 1.58e-16

Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.


Pssm-ID: 214520  Cd Length: 81  Bit Score: 75.85  E-value: 1.58e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972   291 KASDADVGENAAIEYSITEGEGLDMFDVitDQETqeGIITVKKLLDFEKKKVYTLKVEASNPHVEPRflylgpfKDSATV 370
Cdd:smart00112   1 SATDADSGENGKVTYSILSGNDDGLFSI--DPET--GEITTTKPLDREEQPEYTLTVEATDGGGPPL-------SSTATV 69
                           90
                   ....*....|..
gi 149732972   371 RIMVEDV-DEPP 381
Cdd:smart00112  70 TITVLDVnDNAP 81
Cadherin pfam00028
Cadherin domain;
273-375 2.60e-16

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 75.81  E-value: 2.60e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972  273 YQFKTPESSPPGTPIGRIKASDADVGENAAIEYSITEGEGLDMFDVitDQETqeGIITVKKLLDFEKKKVYTLKVEASNP 352
Cdd:pfam00028   1 YSASVPENAPVGTEVLTVTATDADLGPNGRIFYSILGGGPGGWFRI--DPDT--GDLSTTKPLDRESIGEYELTVLATDS 76
                          90       100
                  ....*....|....*....|...
gi 149732972  353 HVEPRFlylgpfkDSATVRIMVE 375
Cdd:pfam00028  77 GSPPLS-------STTTVTITVL 92
Cadherin pfam00028
Cadherin domain;
388-479 2.83e-15

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 72.72  E-value: 2.83e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972  388 YILQIREDAQINTTIGSVSAQDPDAARNP-VKYSVDRHtDMDRIFNIDSGNGSIFTSKLLDRETLLWHNITVIATEINNP 466
Cdd:pfam00028   1 YSASVPENAPVGTEVLTVTATDADLGPNGrIFYSILGG-GPGGWFRIDPDTGDLSTTKPLDRESIGEYELTVLATDSGSP 79
                          90
                  ....*....|...
gi 149732972  467 KQSSRVPLYIKVL 479
Cdd:pfam00028  80 PLSSTTTVTITVL 92
Cadherin pfam00028
Cadherin domain;
79-150 1.92e-09

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 55.78  E-value: 1.92e-09
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 149732972   79 SDQDRGD-GSLKYILSGDGAGDLFIINENTGDIQATKRLDREEKPVYILRAQAINRRTgRPVEPESEFIIKIH 150
Cdd:pfam00028  21 TDADLGPnGRIFYSILGGGPGGWFRIDPDTGDLSTTKPLDRESIGEYELTVLATDSGS-PPLSSTTTVTITVL 92
CA smart00112
Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. ...
510-589 3.12e-09

Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.


Pssm-ID: 214520  Cd Length: 81  Bit Score: 54.66  E-value: 3.12e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972   510 RAVDKDDPYSGhQFSFSLAPEAASGsNFTIqdnkDNTAGILTRKNGYNRHEMSTYLLPVVISDNDYPVQSSTGTVTVRVC 589
Cdd:smart00112   1 SATDADSGENG-KVTYSILSGNDDG-LFSI----DPETGEITTTKPLDREEQPEYTLTVEATDGGGPPLSSTATVTITVL 74
Cadherin pfam00028
Cadherin domain;
492-589 3.40e-09

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 55.01  E-value: 3.40e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972  492 YETFVCEKAKADQLIQTLRAVDKDDPYSGHQFSFSLAPEaaSGSNFTIqdNKDNtaGILTRKNGYNRHEMSTYLLPVVIS 571
Cdd:pfam00028   1 YSASVPENAPVGTEVLTVTATDADLGPNGRIFYSILGGG--PGGWFRI--DPDT--GDLSTTKPLDRESIGEYELTVLAT 74
                          90
                  ....*....|....*...
gi 149732972  572 DNDYPVQSSTGTVTVRVC 589
Cdd:pfam00028  75 DSGSPPLSSTTTVTITVL 92
 
Name Accession Description Interval E-value
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
163-264 4.85e-29

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 112.41  E-value: 4.85e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972 163 VYTATVPEMSDVGTFVVQVTATDADDptyGNSAKVVYSILQGQP--YFSVESETGIIKTAlLNMDRENREQYQVVIQAKD 240
Cdd:cd11304    1 SYEVSVPENAPPGTVVLTVSATDPDS---GENGEVTYSIVSGNEdgLFSIDPSTGEITTA-KPLDREEQSSYTLTVTATD 76
                         90       100
                 ....*....|....*....|....
gi 149732972 241 MGGQmgGLSGTTTVNITLTDVNDN 264
Cdd:cd11304   77 GGGP--PLSSTATVTITVLDVNDN 98
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
272-379 9.34e-27

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 105.86  E-value: 9.34e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972 272 TYQFKTPESSPPGTPIGRIKASDADVGENAAIEYSITEGEGLDMFDVitDQETqeGIITVKKLLDFEKKKVYTLKVEASN 351
Cdd:cd11304    1 SYEVSVPENAPPGTVVLTVSATDPDSGENGEVTYSIVSGNEDGLFSI--DPST--GEITTAKPLDREEQSSYTLTVTATD 76
                         90       100
                 ....*....|....*....|....*...
gi 149732972 352 PHVEPRFlylgpfkDSATVRIMVEDVDE 379
Cdd:cd11304   77 GGGPPLS-------STATVTITVLDVND 97
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
388-484 9.48e-26

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 102.78  E-value: 9.48e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972 388 YILQIREDAQINTTIGSVSAQDPDAARN-PVKYSVDRHTDmDRIFNIDSGNGSIFTSKLLDRETLLWHNITVIATEINNP 466
Cdd:cd11304    2 YEVSVPENAPPGTVVLTVSATDPDSGENgEVTYSIVSGNE-DGLFSIDPSTGEITTAKPLDREEQSSYTLTVTATDGGGP 80
                         90
                 ....*....|....*...
gi 149732972 467 KQSSRVPLYIKVLDVNDN 484
Cdd:cd11304   81 PLSSTATVTITVLDVNDN 98
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
72-155 1.37e-15

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 73.89  E-value: 1.37e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972  72 QYVGKLH-SDQDRGD-GSLKYILSGDGAGDLFIINENTGDIQATKRLDREEKPVYILRAQAINRRtGRPVEPESEFIIKI 149
Cdd:cd11304   14 TVVLTVSaTDPDSGEnGEVTYSIVSGNEDGLFSIDPSTGEITTAKPLDREEQSSYTLTVTATDGG-GPPLSSTATVTITV 92

                 ....*.
gi 149732972 150 HDINDN 155
Cdd:cd11304   93 LDVNDN 98
Cadherin_repeat cd11304
Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
492-589 2.98e-12

Cadherin tandem repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers.


Pssm-ID: 206637 [Multi-domain]  Cd Length: 98  Bit Score: 64.26  E-value: 2.98e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972 492 YETFVCEKAKADQLIQTLRAVDKDDPYSGhQFSFSLAPEAASGsNFTIqdnkDNTAGILTRKNGYNRHEMSTYLLPVVIS 571
Cdd:cd11304    2 YEVSVPENAPPGTVVLTVSATDPDSGENG-EVTYSIVSGNEDG-LFSI----DPSTGEITTAKPLDREEQSSYTLTVTAT 75
                         90
                 ....*....|....*...
gi 149732972 572 DNDYPVQSSTGTVTVRVC 589
Cdd:cd11304   76 DGGGPPLSSTATVTITVL 93
Cadherin_C pfam01049
Cadherin cytoplasmic region; Cadherins are vital in cell-cell adhesion during tissue ...
637-783 3.84e-72

Cadherin cytoplasmic region; Cadherins are vital in cell-cell adhesion during tissue differentiation. Cadherins are linked to the cytoskeleton by catenins. Catenins bind to the cytoplasmic tail of the cadherin. Cadherins cluster to form foci of homophilic binding units. A key determinant to the strength of the binding that it is mediated by cadherins is the juxtamembrane region of the cadherin. This region induces clustering and also binds to the protein p120ctn.


Pssm-ID: 250323  Cd Length: 144  Bit Score: 233.73  E-value: 3.84e-72
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972  637 RRQRKKEPLIISKE-DIRDNIVSYNDEGGGEEDTQAFDIGTLRNPEAIEDSKlrrdIVPEALFLPRRTPAarDNTDVRDF 715
Cdd:pfam01049   2 RRKKEPEKLIISEEdDIRENIVNYDDEGGGEEDTDAYDISALRNPLDPEPEK----IPPLISAQPRYRPP--DPGDVGDF 75
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 149732972  716 INQRLKENDTDPTAPPYDSLATYAYEGTGSVADSLSSLESVTTDGDQDYDYLSDWGPRFKKLADMYGG 783
Cdd:pfam01049  76 IHEKLPEADNDPTAPPYDSLLTYAYEGRGSVAGSLSSLNSSSSDGDQDYDYLSDWGPRFKKLADLYGG 143
CA smart00112
Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. ...
182-266 9.90e-22

Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.


Pssm-ID: 214520  Cd Length: 81  Bit Score: 90.87  E-value: 9.90e-22
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972   182 TATDADDptyGNSAKVVYSILQG--QPYFSVESETGIIKTALlNMDRENREQYQVVIQAKDMGGQmgGLSGTTTVNITLT 259
Cdd:smart00112   1 SATDADS---GENGKVTYSILSGndDGLFSIDPETGEITTTK-PLDREEQPEYTLTVEATDGGGP--PLSSTATVTITVL 74

                   ....*..
gi 149732972   260 DVNDNPP 266
Cdd:smart00112  75 DVNDNAP 81
Cadherin pfam00028
Cadherin domain;
164-259 7.13e-20

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 85.82  E-value: 7.13e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972  164 YTATVPEMSDVGTFVVQVTATDADDPTygnSAKVVYSILQGQPY--FSVESETGIIKTAlLNMDRENREQYQVVIQAKDM 241
Cdd:pfam00028   1 YSASVPENAPVGTEVLTVTATDADLGP---NGRIFYSILGGGPGgwFRIDPDTGDLSTT-KPLDRESIGEYELTVLATDS 76
                          90
                  ....*....|....*...
gi 149732972  242 GGQmgGLSGTTTVNITLT 259
Cdd:pfam00028  77 GSP--PLSSTTTVTITVL 92
CA smart00112
Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. ...
406-486 5.10e-18

Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.


Pssm-ID: 214520  Cd Length: 81  Bit Score: 80.47  E-value: 5.10e-18
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972   406 SAQDPDAARN-PVKYSVDRHTDmDRIFNIDSGNGSIFTSKLLDRETLLWHNITVIATEINNPKQSSRVPLYIKVLDVNDN 484
Cdd:smart00112   1 SATDADSGENgKVTYSILSGND-DGLFSIDPETGEITTTKPLDREEQPEYTLTVEATDGGGPPLSSTATVTITVLDVNDN 79

                   ..
gi 149732972   485 AP 486
Cdd:smart00112  80 AP 81
CA smart00112
Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. ...
79-157 1.30e-16

Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.


Pssm-ID: 214520  Cd Length: 81  Bit Score: 76.23  E-value: 1.30e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972    79 SDQDRGD-GSLKYILSGDGAGDLFIINENTGDIQATKRLDREEKPVYILRAQAINrRTGRPVEPESEFIIKIHDINDNEP 157
Cdd:smart00112   3 TDADSGEnGKVTYSILSGNDDGLFSIDPETGEITTTKPLDREEQPEYTLTVEATD-GGGPPLSSTATVTITVLDVNDNAP 81
CA smart00112
Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. ...
291-381 1.58e-16

Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.


Pssm-ID: 214520  Cd Length: 81  Bit Score: 75.85  E-value: 1.58e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972   291 KASDADVGENAAIEYSITEGEGLDMFDVitDQETqeGIITVKKLLDFEKKKVYTLKVEASNPHVEPRflylgpfKDSATV 370
Cdd:smart00112   1 SATDADSGENGKVTYSILSGNDDGLFSI--DPET--GEITTTKPLDREEQPEYTLTVEATDGGGPPL-------SSTATV 69
                           90
                   ....*....|..
gi 149732972   371 RIMVEDV-DEPP 381
Cdd:smart00112  70 TITVLDVnDNAP 81
Cadherin pfam00028
Cadherin domain;
273-375 2.60e-16

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 75.81  E-value: 2.60e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972  273 YQFKTPESSPPGTPIGRIKASDADVGENAAIEYSITEGEGLDMFDVitDQETqeGIITVKKLLDFEKKKVYTLKVEASNP 352
Cdd:pfam00028   1 YSASVPENAPVGTEVLTVTATDADLGPNGRIFYSILGGGPGGWFRI--DPDT--GDLSTTKPLDRESIGEYELTVLATDS 76
                          90       100
                  ....*....|....*....|...
gi 149732972  353 HVEPRFlylgpfkDSATVRIMVE 375
Cdd:pfam00028  77 GSPPLS-------STTTVTITVL 92
Cadherin pfam00028
Cadherin domain;
388-479 2.83e-15

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 72.72  E-value: 2.83e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972  388 YILQIREDAQINTTIGSVSAQDPDAARNP-VKYSVDRHtDMDRIFNIDSGNGSIFTSKLLDRETLLWHNITVIATEINNP 466
Cdd:pfam00028   1 YSASVPENAPVGTEVLTVTATDADLGPNGrIFYSILGG-GPGGWFRIDPDTGDLSTTKPLDRESIGEYELTVLATDSGSP 79
                          90
                  ....*....|...
gi 149732972  467 KQSSRVPLYIKVL 479
Cdd:pfam00028  80 PLSSTTTVTITVL 92
Cadherin pfam00028
Cadherin domain;
79-150 1.92e-09

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 55.78  E-value: 1.92e-09
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 149732972   79 SDQDRGD-GSLKYILSGDGAGDLFIINENTGDIQATKRLDREEKPVYILRAQAINRRTgRPVEPESEFIIKIH 150
Cdd:pfam00028  21 TDADLGPnGRIFYSILGGGPGGWFRIDPDTGDLSTTKPLDRESIGEYELTVLATDSGS-PPLSSTTTVTITVL 92
CA smart00112
Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. ...
510-589 3.12e-09

Cadherin repeats; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.


Pssm-ID: 214520  Cd Length: 81  Bit Score: 54.66  E-value: 3.12e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972   510 RAVDKDDPYSGhQFSFSLAPEAASGsNFTIqdnkDNTAGILTRKNGYNRHEMSTYLLPVVISDNDYPVQSSTGTVTVRVC 589
Cdd:smart00112   1 SATDADSGENG-KVTYSILSGNDDG-LFSI----DPETGEITTTKPLDREEQPEYTLTVEATDGGGPPLSSTATVTITVL 74
Cadherin pfam00028
Cadherin domain;
492-589 3.40e-09

Cadherin domain;


Pssm-ID: 249522  Cd Length: 92  Bit Score: 55.01  E-value: 3.40e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972  492 YETFVCEKAKADQLIQTLRAVDKDDPYSGHQFSFSLAPEaaSGSNFTIqdNKDNtaGILTRKNGYNRHEMSTYLLPVVIS 571
Cdd:pfam00028   1 YSASVPENAPVGTEVLTVTATDADLGPNGRIFYSILGGG--PGGWFRI--DPDT--GDLSTTKPLDRESIGEYELTVLAT 74
                          90
                  ....*....|....*...
gi 149732972  572 DNDYPVQSSTGTVTVRVC 589
Cdd:pfam00028  75 DSGSPPLSSTTTVTITVL 92
CA_like cd00031
Cadherin repeat-like domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell ...
72-155 8.40e-06

Cadherin repeat-like domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. This family also includes the cadherin-like repeats of extracellular alpha-dystroglycan.


Pssm-ID: 206635  Cd Length: 98  Bit Score: 44.64  E-value: 8.40e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149732972  72 QYVGKLHSDQDRGDGSLKYILS--GDGAGDLFIINENTGDIQATKRLDREEKPVYILRAQAINRRTGRPVEPeSEFIIKI 149
Cdd:cd00031   14 SFRVSIPTDLIASSGEIIKISAagKEALPSWLHWEPHSGILEGLEKLDREDKGVHYISVSAASLGANVPQTS-SVFSIEV 92

                 ....*.
gi 149732972 150 HDINDN 155
Cdd:cd00031   93 YDENDN 98
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH