NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|149731852|ref|XP_001496893|]
View 

PREDICTED: histone H2B type 1-B-like [Equus caballus]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
H2B smart00427
Histone H2B;
28-124 2.62e-52

Histone H2B;


:

Pssm-ID: 197718  Cd Length: 97  Bit Score: 162.30  E-value: 2.62e-52
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149731852    28 KKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGEL 107
Cdd:smart00427   1 KKRVKKRKETYAIYIYKVLKQVHPDTGISSRAMSIMNSFVNDIFERIAAEASKLARYNKKSTLSSREIQTAVRLILPGEL 80
                           90
                   ....*....|....*..
gi 149731852   108 AKHAVSEGTKAVTKYTS 124
Cdd:smart00427  81 AKHAVSEGTKAVTKASS 97
 
Name Accession Description Interval E-value
H2B smart00427
Histone H2B;
28-124 2.62e-52

Histone H2B;


Pssm-ID: 197718  Cd Length: 97  Bit Score: 162.30  E-value: 2.62e-52
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149731852    28 KKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGEL 107
Cdd:smart00427   1 KKRVKKRKETYAIYIYKVLKQVHPDTGISSRAMSIMNSFVNDIFERIAAEASKLARYNKKSTLSSREIQTAVRLILPGEL 80
                           90
                   ....*....|....*..
gi 149731852   108 AKHAVSEGTKAVTKYTS 124
Cdd:smart00427  81 AKHAVSEGTKAVTKASS 97
PLN00158 PLN00158
histone H2B; Provisional
12-125 2.37e-51

histone H2B; Provisional


Pssm-ID: 215081  Cd Length: 116  Bit Score: 160.63  E-value: 2.37e-51
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149731852  12 KKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTIT 91
Cdd:PLN00158   3 KTPSKKPAKKAAKGAKKKGSKSKTETYKIYIYKVLKQVHPDTGISSKAMSIMNSFINDIFEKIATEAGKLARYNKKPTVT 82
                         90       100       110
                 ....*....|....*....|....*....|....
gi 149731852  92 SREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125
Cdd:PLN00158  83 SREIQTAVRLILPGELAKHAVSEGTKAVTKFTSA 116
PTZ00463 PTZ00463
histone H2B; Provisional
15-124 2.59e-38

histone H2B; Provisional


Pssm-ID: 185642  Cd Length: 117  Bit Score: 127.21  E-value: 2.59e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149731852  15 SKKAITKAQKKdgKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSRE 94
Cdd:PTZ00463   9 AKKAATGPDGK--KKRKKSRYDSYGLYIFKVLKQVHPDTGISRKSMNIMNSFLVDTFEKIATEASRLCKYTRRDTLSSRE 86
                         90       100       110
                 ....*....|....*....|....*....|
gi 149731852  95 IQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124
Cdd:PTZ00463  87 IQTAIRLVLPGELAKHAVSEGTKAVTKFTS 116
Histone pfam00125
Core histone H2A/H2B/H3/H4;
32-102 3.37e-26

Core histone H2A/H2B/H3/H4;


Pssm-ID: 249609  Cd Length: 75  Bit Score: 94.53  E-value: 3.37e-26
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 149731852   32 RSRKESYSIYVYKVLKQVHPD----TGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLL 102
Cdd:pfam00125   1 RSRLLILKLPFSRVVRELKEGfyagLRISSKAPVALQEALEDLLEEILEDAGLLARHAKRKTITPRDIQLAVRLD 75
 
Name Accession Description Interval E-value
H2B smart00427
Histone H2B;
28-124 2.62e-52

Histone H2B;


Pssm-ID: 197718  Cd Length: 97  Bit Score: 162.30  E-value: 2.62e-52
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149731852    28 KKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGEL 107
Cdd:smart00427   1 KKRVKKRKETYAIYIYKVLKQVHPDTGISSRAMSIMNSFVNDIFERIAAEASKLARYNKKSTLSSREIQTAVRLILPGEL 80
                           90
                   ....*....|....*..
gi 149731852   108 AKHAVSEGTKAVTKYTS 124
Cdd:smart00427  81 AKHAVSEGTKAVTKASS 97
PLN00158 PLN00158
histone H2B; Provisional
12-125 2.37e-51

histone H2B; Provisional


Pssm-ID: 215081  Cd Length: 116  Bit Score: 160.63  E-value: 2.37e-51
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149731852  12 KKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTIT 91
Cdd:PLN00158   3 KTPSKKPAKKAAKGAKKKGSKSKTETYKIYIYKVLKQVHPDTGISSKAMSIMNSFINDIFEKIATEAGKLARYNKKPTVT 82
                         90       100       110
                 ....*....|....*....|....*....|....
gi 149731852  92 SREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125
Cdd:PLN00158  83 SREIQTAVRLILPGELAKHAVSEGTKAVTKFTSA 116
PTZ00463 PTZ00463
histone H2B; Provisional
15-124 2.59e-38

histone H2B; Provisional


Pssm-ID: 185642  Cd Length: 117  Bit Score: 127.21  E-value: 2.59e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149731852  15 SKKAITKAQKKdgKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSRE 94
Cdd:PTZ00463   9 AKKAATGPDGK--KKRKKSRYDSYGLYIFKVLKQVHPDTGISRKSMNIMNSFLVDTFEKIATEASRLCKYTRRDTLSSRE 86
                         90       100       110
                 ....*....|....*....|....*....|
gi 149731852  95 IQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124
Cdd:PTZ00463  87 IQTAIRLVLPGELAKHAVSEGTKAVTKFTS 116
Histone pfam00125
Core histone H2A/H2B/H3/H4;
32-102 3.37e-26

Core histone H2A/H2B/H3/H4;


Pssm-ID: 249609  Cd Length: 75  Bit Score: 94.53  E-value: 3.37e-26
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 149731852   32 RSRKESYSIYVYKVLKQVHPD----TGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLL 102
Cdd:pfam00125   1 RSRLLILKLPFSRVVRELKEGfyagLRISSKAPVALQEALEDLLEEILEDAGLLARHAKRKTITPRDIQLAVRLD 75
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH