NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|148658623|ref|YP_001278828|]
View 

protein phosphatase 2C domain-containing protein [Roseiflexus sp. RS-1]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
4-237 1.83e-63

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


:

Pssm-ID: 238083  Cd Length: 254  Bit Score: 208.34  E-value: 1.83e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623   4 RHSARTDVGRTRDHNEDDFGVGEGAGVEQYGeLLIVCDGMGGHAAGEVASRLGVETIL---STYYSDASPDRVDVLRRAF 80
Cdd:cd00143    1 FSAGVSDKGGDRKTNEDAVVIKPNLNNEDGG-LFGVFDGHGGHAAGEFASKLLVEELLeelEETLTLSEEDIEEALRKAF 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  81 ERANARIH-----AEGRGAMGTTGVAALFYQGMLHVANVGDSRAYLIRNDEICQVSRDHSLVGEQVAAGVITADQARSSY 155
Cdd:cd00143   80 LRADEEILeeaqdEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGGRVSNG 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 156 Y---RNVITRALG-----YQSEVQVDLFHLPL-QAGDMVILCSDGLHGLVGDEEICEIVRS----MPLADAVDRLIDLAN 222
Cdd:cd00143  160 RvpgVLAVTRALGdfdlkPGVSAEPDVTVVKLtEDDDFLILASDGLWDVLSNQEAVDIVRSelakEDLQEAAQELVDLAL 239
                        250
                 ....*....|....*
gi 148658623 223 ERGGTDNITAIVAQV 237
Cdd:cd00143  240 RRGSHDNITVVVVRL 254
DUF2360 super family cl10849
Predicted coiled-coil domain-containing protein (DUF2360); This is the conserved 140 amino ...
341-401 1.78e-03

Predicted coiled-coil domain-containing protein (DUF2360); This is the conserved 140 amino acid region of a family of proteins conserved from nematodes to humans. One C. elegans member is annotated as a Daf-16-dependent longevity protein 1 but this could not be confirmed. The function is unknown.


The actual alignment was detected with superfamily member pfam10152:

Pssm-ID: 255793  Cd Length: 147  Bit Score: 37.38  E-value: 1.78e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 148658623  341 APGPANLAPAEPQPTIAATQ---APPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMA 401
Cdd:pfam10152  47 IPGLEDVTVQTTPPPPASAItngGPPPPPPARAEAASPPPPEAPAEPPAEPEPEAPAENTVTVA 110
SOG2 super family cl12385
RAM signalling pathway protein; SOG2 proteins in Saccharomyces cerevisiae are involved in cell ...
332-469 8.31e-03

RAM signalling pathway protein; SOG2 proteins in Saccharomyces cerevisiae are involved in cell separation and cytokinesis.


The actual alignment was detected with superfamily member pfam10428:

Pssm-ID: 255982  Cd Length: 417  Bit Score: 37.03  E-value: 8.31e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  332 LFVAYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQN-PAIIPATPSTPSPSATQPTMATPSPSAAQP 410
Cdd:pfam10428 141 LRNAWSSLGPPLQSRKRDAVTASPGSMIARNTPSSDRLTPRSVTPTRGRrPSSSPRSLSTTLESSRNMQVATDVPPPSSN 220
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 148658623  411 GTATPSPSATQPGTASPSPGvtdtiapavtATPgASPATLIATPTRTPIPLTPLTRTPT 469
Cdd:pfam10428 221 GSSRSSTMSSSANLSIISSL----------ATP-RSGESFRSTPTSMSSSINPVSGLDE 268
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
4-237 1.83e-63

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 208.34  E-value: 1.83e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623   4 RHSARTDVGRTRDHNEDDFGVGEGAGVEQYGeLLIVCDGMGGHAAGEVASRLGVETIL---STYYSDASPDRVDVLRRAF 80
Cdd:cd00143    1 FSAGVSDKGGDRKTNEDAVVIKPNLNNEDGG-LFGVFDGHGGHAAGEFASKLLVEELLeelEETLTLSEEDIEEALRKAF 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  81 ERANARIH-----AEGRGAMGTTGVAALFYQGMLHVANVGDSRAYLIRNDEICQVSRDHSLVGEQVAAGVITADQARSSY 155
Cdd:cd00143   80 LRADEEILeeaqdEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGGRVSNG 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 156 Y---RNVITRALG-----YQSEVQVDLFHLPL-QAGDMVILCSDGLHGLVGDEEICEIVRS----MPLADAVDRLIDLAN 222
Cdd:cd00143  160 RvpgVLAVTRALGdfdlkPGVSAEPDVTVVKLtEDDDFLILASDGLWDVLSNQEAVDIVRSelakEDLQEAAQELVDLAL 239
                        250
                 ....*....|....*
gi 148658623 223 ERGGTDNITAIVAQV 237
Cdd:cd00143  240 RRGSHDNITVVVVRL 254
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
1-239 3.21e-80

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 252.28  E-value: 3.21e-80
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623   1 MKLRHSARTDVGRTRDHNEDDFGVGEGAGVEQYGeLLIVCDGMGGHAAGEVASRLGVETI----LSTYYSDASPDRVDVL 76
Cdd:COG0631    6 LSLKVAGLSDVGTVRKHNEDAFLIKPNENGNLLL-LFAVADGMGGHAAGEVASKLAVEALarlfDETNFNSLNESLEELL 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  77 RRAFERANARIHAEGRG-----AMGTTGVAALFYQGMLHVANVGDSRAYLIRNDEICQVSRDHSLVGEQVAAGVITADQA 151
Cdd:COG0631   85 KEAILKANEAIAEEGQLnedvrGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEEA 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 152 RSSYYRNVITRALGYQSEVQVDLFHLPLQAGDMVILCSDGLHGLVGDEEICEIVRS-MPLADAVDRLIDLANERGGTDNI 230
Cdd:COG0631  165 RSHPRRNALTRALGDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILKNsETPQEAADKLIELALEGGGPDNI 244

                 ....*....
gi 148658623 231 TAIVAQVDE 239
Cdd:COG0631  245 TVVLVRLNG 253
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
5-234 1.17e-43

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 155.23  E-value: 1.17e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623     5 HSARTDVGRTRDHNEDDFGVGegAGVEQYGELLIVCDGMGGHAAGEVASRLGVETILS--TYYSDASPDRVDVLRRAFER 82
Cdd:smart00332  10 RYGLSSMQGVRKPMEDAHVIT--PDLSDSGGFFGVFDGHGGSEAAKFLSKNLPEILAEelIKEKDELEDVEEALRKAFLS 87
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623    83 ANARIHAEGRGAMGTTGVAALFYQGMLHVANVGDSRAYLIRNDEICQVSRDHSLVGEQVAAGVITADQARSSYYRN---V 159
Cdd:smart00332  88 TDEEILEELEALSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKPSNEDERARIEAAGGFVINGRVNgvlA 167
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623   160 ITRALGYQS---------EVQVdlfHLPLQAGDMVILCSDGLHGLVGDEEICEIVRSMPLAD---AVDRLIDLANERGGT 227
Cdd:smart00332 168 LSRAIGDFFlkpyvsaepDVTV---VELTEKDDFLILASDGLWDVLSNQEVVDIVRKHLSKDpkeAAKRLIDLALARGSK 244

                   ....*..
gi 148658623   228 DNITAIV 234
Cdd:smart00332 245 DNITVVV 251
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
9-230 6.03e-28

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 110.92  E-value: 6.03e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623    9 TDVGRTRDHNED---DFGVGEGAGVEQYGELLIVCDGMGGHAAGEVASRLGVETILSTYYSDASPDRVDVLRRAFERANA 85
Cdd:pfam00481   6 TRMQGWRKSMEDahiDGKNLNSSSGKDSWSFFAVFDGHGGSEAAKYAGKHLHTILALRRSFLTLRKLEDALRESFLETDE 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623   86 RI----HAEGRGAMGTTGVAALFYQGMLHVANVGDSRAYLIRNDE-ICQVSRDHSLVGEQVAAGVITADQARSSYYR--- 157
Cdd:pfam00481  86 ELrsdaANHEDLSSGSTAVVALIRGNKLYVANVGDSRAVLCRNGGaIKQLTEDHKPSDEDERRRIRAAGGFVSRNGRvng 165
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  158 --NViTRALGY----QSEVQV----DLFHLPLQAGD-MVILCSDGLHGLVGDEEICEIVRSM-----PLADAVDRLIDLA 221
Cdd:pfam00481 166 vlAV-SRAFGDfdlkPGEQPVsaepDITSHKITEDDeFLILACDGLWDVLSDQEVVDIVRSNlsdggDPMEAAEKLVDEA 244

                  ....*....
gi 148658623  222 NERGGTDNI 230
Cdd:pfam00481 245 IAYGSEDNI 253
DUF2360 pfam10152
Predicted coiled-coil domain-containing protein (DUF2360); This is the conserved 140 amino ...
341-401 1.78e-03

Predicted coiled-coil domain-containing protein (DUF2360); This is the conserved 140 amino acid region of a family of proteins conserved from nematodes to humans. One C. elegans member is annotated as a Daf-16-dependent longevity protein 1 but this could not be confirmed. The function is unknown.


Pssm-ID: 255793  Cd Length: 147  Bit Score: 37.38  E-value: 1.78e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 148658623  341 APGPANLAPAEPQPTIAATQ---APPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMA 401
Cdd:pfam10152  47 IPGLEDVTVQTTPPPPASAItngGPPPPPPARAEAASPPPPEAPAEPPAEPEPEAPAENTVTVA 110
SOG2 pfam10428
RAM signalling pathway protein; SOG2 proteins in Saccharomyces cerevisiae are involved in cell ...
332-469 8.31e-03

RAM signalling pathway protein; SOG2 proteins in Saccharomyces cerevisiae are involved in cell separation and cytokinesis.


Pssm-ID: 255982  Cd Length: 417  Bit Score: 37.03  E-value: 8.31e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  332 LFVAYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQN-PAIIPATPSTPSPSATQPTMATPSPSAAQP 410
Cdd:pfam10428 141 LRNAWSSLGPPLQSRKRDAVTASPGSMIARNTPSSDRLTPRSVTPTRGRrPSSSPRSLSTTLESSRNMQVATDVPPPSSN 220
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 148658623  411 GTATPSPSATQPGTASPSPGvtdtiapavtATPgASPATLIATPTRTPIPLTPLTRTPT 469
Cdd:pfam10428 221 GSSRSSTMSSSANLSIISSL----------ATP-RSGESFRSTPTSMSSSINPVSGLDE 268
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
1-234 8.02e-42

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 156.75  E-value: 8.02e-42
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623   1 MKLRH---SARTDVGRTRDHNEDDFGVGE---------GAGVEQYGeLLIVCDGMGGHAAGEVASRLGVETIL---STYY 65
Cdd:PRK14559 370 MQLVSledAGRTDVGRQRHHNEDYFGINTriqklenphGRIVQARG-LYILCDGMGGHAAGEVASALAVETLQqyfQQHW 448
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  66 SDASPDRvDVLRRAFERANARIHA-------EGRGAMGTTGVAALFYQGMLHVANVGDSRAYLI-RNDEICQVSRDHSlV 137
Cdd:PRK14559 449 QDELPDE-ETIREAIYLANEAIYDlnqqnarSGSGRMGTTLVMALVQDTQVAVAHVGDSRLYRVtRKGGLEQLTVDHE-V 526
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 138 GEQ-VAAGV-ITADQARSSYYRnvITRALGYQSE--VQVDLFHLPLQAGDMVILCSDGL--HGLVgdEEICE------IV 205
Cdd:PRK14559 527 GQReIQRGVePQIAYARPDAYQ--LTQALGPRDNsaIQPDIQFLEIEEDTLLLLCSDGLsdNDLL--ETHWQthllplLS 602
                        250       260
                 ....*....|....*....|....*....
gi 148658623 206 RSMPLADAVDRLIDLANERGGTDNITAIV 234
Cdd:PRK14559 603 SSANLDQGLNKLIDLANQYNGHDNITAIL 631
PTZ00224 PTZ00224
protein phosphatase 2C; Provisional
96-247 6.66e-11

protein phosphatase 2C; Provisional


Pssm-ID: 240318 [Multi-domain]  Cd Length: 381  Bit Score: 62.48  E-value: 6.66e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  96 GTTGVaalFYQGM----LHVANVGDSRAYLIRNDEICQVSRDHS-----------LVGEQVAAGVITADQARSSYY--RN 158
Cdd:PTZ00224 105 GSTGT---FCVIMkdvhLQVGNVGDSRVLVCRDGKLVFATEDHKpnnpgerqrieACGGRVVSNRVDGDLAVSRAFgdRS 181
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 159 VITRALGYQSEVQV----DLFHLPLQAGDMVILCSDGL-HGLVGDEEICEIVR-----SMPLADAVDRLIDLANERGGTD 228
Cdd:PTZ00224 182 FKVKGTGDYLEQKViavpDVTHLTCQSNDFIILACDGVfEGNFSNEEVVAFVKeqletCDDLAVVAGRVCDEAIRRGSKD 261
                        170       180
                 ....*....|....*....|...
gi 148658623 229 NITAIVAQ----VDELDALPATT 247
Cdd:PTZ00224 262 NISCLIVQlkdgASYAKLFGHTS 284
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
337-470 1.60e-09

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 251763 [Multi-domain]  Cd Length: 979  Bit Score: 58.93  E-value: 1.60e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  337 PSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQP-------------------PTQNPAIIPATPSTPSPSATQ 397
Cdd:pfam03154 179 PSIQVPPGAALAPSAPPPTPSAQAVPPQGSPIAAQPAPQPqqpsplslisapslhpqrlPSPHPPLQPQTASQQSPQPPA 258
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  398 PTMATPSPSAAQPGTATPSPSATQ------PGTASPSP-GVTDTIAPAVTATPGASPATLIATPTRTPIPLTPLTRTPTP 470
Cdd:pfam03154 259 PSSRHPQSSHHGPGPPMPHALQQGpvflqhPSSNPPQPfGLAQSQVPPLPLPSQAQPHSHTPPSQSALQPQQPPREQPLP 338
PHA03269 PHA03269
envelope glycoprotein C; Provisional
334-467 6.23e-08

envelope glycoprotein C; Provisional


Pssm-ID: 165527 [Multi-domain]  Cd Length: 566  Bit Score: 53.58  E-value: 6.23e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 334 VAYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQP-PTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGT 412
Cdd:PHA03269  26 IPIPELHTSAATQKPDPAPAPHQAASRAPDPAVAPTSAASRKPdLAQAPTPAASEKFDPAPAPHQAASRAPDPAVAPQLA 105
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 148658623 413 ATPSPSATQPGTASPspgvTDTIAPAVTATPGASPATLIATPTRTPIPLTPLTRT 467
Cdd:PHA03269 106 AAPKPDAAEAFTSAA----QAHEAPADAGTSAASKKPDPAAHTQHSPPPFAYTRS 156
rad23 TIGR00601
UV excision repair protein Rad23; All proteins in this family for which functions are known ...
373-438 7.50e-05

UV excision repair protein Rad23; All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair].


Pssm-ID: 233045 [Multi-domain]  Cd Length: 378  Bit Score: 43.35  E-value: 7.50e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 148658623  373 TLQPPTQNPAIIPATPSTPSPSAtqPTMATPSPSAAQPGTATPSPSATQPGTAsPSPGVTDTIAPA 438
Cdd:TIGR00601  79 TGTGKVAPPAATPTSAPTPTPSP--PASPASGMSAAPASAVEEKSPSEESATA-TAPESPSTSVPS 141
DedD COG3147
Uncharacterized protein conserved in bacteria [Function unknown]
333-445 1.49e-04

Uncharacterized protein conserved in bacteria [Function unknown]


Pssm-ID: 225689 [Multi-domain]  Cd Length: 226  Bit Score: 41.80  E-value: 1.49e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 333 FVAYPSVLAPGPANLAPAE---PQPTIAATQAPPANVPPTDIPTLQP--PTQNPAIIPATPSTPSPsaTQPTMATPSPSA 407
Cdd:COG3147   38 VAAIPLPPKPQGDRDEPRVlpaVVQVVALPTQPPEGVAQEIQDAGDAaaASVDPQPVAQPPVESTP--AGVPVAAQTPKP 115
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 148658623 408 AQPgtATPSPSATQPGTASPSPGVTDTIAPAVTATPGA 445
Cdd:COG3147  116 VKP--PKQPPAGAVPAKPTPKPEPKPVAEPAAAPTGQA 151
PLN03209 PLN03209
translocon at the inner envelope of chloroplast subunit 62; Provisional
342-463 1.76e-04

translocon at the inner envelope of chloroplast subunit 62; Provisional


Pssm-ID: 178748 [Multi-domain]  Cd Length: 576  Bit Score: 42.61  E-value: 1.76e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 342 PGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSA-- 419
Cdd:PLN03209 339 PKPVPTKPVTPEAPSPPIEEEPPQPKAVVPRPLSPYTAYEDLKPPTSPIPTPPSSSPASSKSVDAVAKPAEPDVVPSPgs 418
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 420 ------TQPGTA---------------------SPSP------GVTDTIAPAVTATPGASPATLI----ATPTRTPIPLT 462
Cdd:PLN03209 419 asnvpeVEPAQVeakktrplspyaryedlkpptSPSPtaptgvSPSVSSTSSVPAVPDTAPATAAtdaaAPPPANMRPLS 498

                 .
gi 148658623 463 P 463
Cdd:PLN03209 499 P 499
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
4-237 1.83e-63

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 208.34  E-value: 1.83e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623   4 RHSARTDVGRTRDHNEDDFGVGEGAGVEQYGeLLIVCDGMGGHAAGEVASRLGVETIL---STYYSDASPDRVDVLRRAF 80
Cdd:cd00143    1 FSAGVSDKGGDRKTNEDAVVIKPNLNNEDGG-LFGVFDGHGGHAAGEFASKLLVEELLeelEETLTLSEEDIEEALRKAF 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  81 ERANARIH-----AEGRGAMGTTGVAALFYQGMLHVANVGDSRAYLIRNDEICQVSRDHSLVGEQVAAGVITADQARSSY 155
Cdd:cd00143   80 LRADEEILeeaqdEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGGRVSNG 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 156 Y---RNVITRALG-----YQSEVQVDLFHLPL-QAGDMVILCSDGLHGLVGDEEICEIVRS----MPLADAVDRLIDLAN 222
Cdd:cd00143  160 RvpgVLAVTRALGdfdlkPGVSAEPDVTVVKLtEDDDFLILASDGLWDVLSNQEAVDIVRSelakEDLQEAAQELVDLAL 239
                        250
                 ....*....|....*
gi 148658623 223 ERGGTDNITAIVAQV 237
Cdd:cd00143  240 RRGSHDNITVVVVRL 254
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
1-239 3.21e-80

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 252.28  E-value: 3.21e-80
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623   1 MKLRHSARTDVGRTRDHNEDDFGVGEGAGVEQYGeLLIVCDGMGGHAAGEVASRLGVETI----LSTYYSDASPDRVDVL 76
Cdd:COG0631    6 LSLKVAGLSDVGTVRKHNEDAFLIKPNENGNLLL-LFAVADGMGGHAAGEVASKLAVEALarlfDETNFNSLNESLEELL 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  77 RRAFERANARIHAEGRG-----AMGTTGVAALFYQGMLHVANVGDSRAYLIRNDEICQVSRDHSLVGEQVAAGVITADQA 151
Cdd:COG0631   85 KEAILKANEAIAEEGQLnedvrGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEEA 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 152 RSSYYRNVITRALGYQSEVQVDLFHLPLQAGDMVILCSDGLHGLVGDEEICEIVRS-MPLADAVDRLIDLANERGGTDNI 230
Cdd:COG0631  165 RSHPRRNALTRALGDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILKNsETPQEAADKLIELALEGGGPDNI 244

                 ....*....
gi 148658623 231 TAIVAQVDE 239
Cdd:COG0631  245 TVVLVRLNG 253
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
5-234 1.17e-43

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 155.23  E-value: 1.17e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623     5 HSARTDVGRTRDHNEDDFGVGegAGVEQYGELLIVCDGMGGHAAGEVASRLGVETILS--TYYSDASPDRVDVLRRAFER 82
Cdd:smart00332  10 RYGLSSMQGVRKPMEDAHVIT--PDLSDSGGFFGVFDGHGGSEAAKFLSKNLPEILAEelIKEKDELEDVEEALRKAFLS 87
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623    83 ANARIHAEGRGAMGTTGVAALFYQGMLHVANVGDSRAYLIRNDEICQVSRDHSLVGEQVAAGVITADQARSSYYRN---V 159
Cdd:smart00332  88 TDEEILEELEALSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKPSNEDERARIEAAGGFVINGRVNgvlA 167
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623   160 ITRALGYQS---------EVQVdlfHLPLQAGDMVILCSDGLHGLVGDEEICEIVRSMPLAD---AVDRLIDLANERGGT 227
Cdd:smart00332 168 LSRAIGDFFlkpyvsaepDVTV---VELTEKDDFLILASDGLWDVLSNQEVVDIVRKHLSKDpkeAAKRLIDLALARGSK 244

                   ....*..
gi 148658623   228 DNITAIV 234
Cdd:smart00332 245 DNITVVV 251
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
9-230 6.03e-28

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 110.92  E-value: 6.03e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623    9 TDVGRTRDHNED---DFGVGEGAGVEQYGELLIVCDGMGGHAAGEVASRLGVETILSTYYSDASPDRVDVLRRAFERANA 85
Cdd:pfam00481   6 TRMQGWRKSMEDahiDGKNLNSSSGKDSWSFFAVFDGHGGSEAAKYAGKHLHTILALRRSFLTLRKLEDALRESFLETDE 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623   86 RI----HAEGRGAMGTTGVAALFYQGMLHVANVGDSRAYLIRNDE-ICQVSRDHSLVGEQVAAGVITADQARSSYYR--- 157
Cdd:pfam00481  86 ELrsdaANHEDLSSGSTAVVALIRGNKLYVANVGDSRAVLCRNGGaIKQLTEDHKPSDEDERRRIRAAGGFVSRNGRvng 165
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  158 --NViTRALGY----QSEVQV----DLFHLPLQAGD-MVILCSDGLHGLVGDEEICEIVRSM-----PLADAVDRLIDLA 221
Cdd:pfam00481 166 vlAV-SRAFGDfdlkPGEQPVsaepDITSHKITEDDeFLILACDGLWDVLSDQEVVDIVRSNlsdggDPMEAAEKLVDEA 244

                  ....*....
gi 148658623  222 NERGGTDNI 230
Cdd:pfam00481 245 IAYGSEDNI 253
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
9-221 2.32e-22

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 93.95  E-value: 2.32e-22
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623     9 TDVGRTRDHNEDDFGVGEG-AGVEQYGE---LLIVCDGMG-GHAAGEVASRLGveTILSTYYSDASPdrvdvLRRAFERA 83
Cdd:smart00331   1 DDGGLIAQYYEDATQVGGDfYDVVKLPEgrlLIAIADVMGkGLAAALAMSMAR--SALRTLLSEGIS-----LSQILERL 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623    84 NARIHAEGRGAMGTTGVAAL--FYQGMLHVANVGDSRAYLIRNDEicqvsrdhslvGEQvaagVITADQarssyyrnviT 161
Cdd:smart00331  74 NRAIYENGEDGMFATLFLALydFAGGTLSYANAGHSPPYLLRADG-----------GLV----EDLDDL----------G 128
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 148658623   162 RALGYQSEVQVDLFHLPLQAGDMVILCSDGLHGLVGDEEICEIVRS---MPLADAVDRLIDLA 221
Cdd:smart00331 129 APLGLEPDVEVDVRELTLEPGDLLLLYTDGLTEARNPERLEELLEEllgSPPAEIAQRILEEL 191
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
36-238 1.58e-13

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 68.09  E-value: 1.58e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623   36 LLIVCDGMG-GHAAGEVASRLGveTILSTY-YSDASPDRVdvlrraFERANARIHAEGRGAMGTTGVAALF--YQGMLHV 111
Cdd:pfam07228   6 ALVIGDVMGhGLPAALLMGMLR--TALRALaLEGLDPAEV------LERLNRALQRNLEGERFATAVLAVYdpETGTLEY 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  112 ANVGDSRAYLIRNDEicqvsrdhslvgeqvaaGVITADQARSsyyrnvitRALGYQSEVQVDLFHLPLQAGDMVILCSDG 191
Cdd:pfam07228  78 ANAGHPPPLLLRPDG-----------------GVVELLESPG--------LPLGVLPDAPYETAEFPLEPGDTLLLYTDG 132
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  192 L-------HGLVGDEEICEIVRS---MPLADAVDRLIDLANERGG---TDNITAIVAQVD 238
Cdd:pfam07228 133 LteardpdGELFGLERLLALLAErhgLSPEELLDALLEDLLRLGGgelEDDITLLVLRVR 192
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
18-235 6.43e-13

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 66.57  E-value: 6.43e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623   18 NEDDFGVGEGAGveqyGELLIVCDGMGGHAAGEVASRLGVETILSTYYSDASPDRVDVLRRAFERANARIH------AEG 91
Cdd:pfam13672  12 CQDAFAYRVLSD----GWLIAVADGAGSAKYSDVGARLAVEAAVEALRELLDSGELPELEALVRQILNDILalvrqeAAA 87
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623   92 RG----AMGTTGVAALFYQGMLHVANVGDSRAYLI-RNDEICQVSRDHSlvGEqvaagvitadqarssyYRNVITRALGY 166
Cdd:pfam13672  88 QGleprDYATTLLLAVITPGGIVFFQIGDGAIVVRdRDGELQLLSEPDS--GE----------------YANETTFLTSP 149
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 148658623  167 QSEVQVDLFHLPLQAGDMVILCSDGLHGLVGDEEiceivrsmPLADAVDRLIDLANERGGTDNITAIVA 235
Cdd:pfam13672 150 DALEEFRIRRLTLEPGDALALMTDGLSDSLVTEE--------PFFPFFAPLLETLEEEGASEQLAEFLE 210
DUF2360 pfam10152
Predicted coiled-coil domain-containing protein (DUF2360); This is the conserved 140 amino ...
341-401 1.78e-03

Predicted coiled-coil domain-containing protein (DUF2360); This is the conserved 140 amino acid region of a family of proteins conserved from nematodes to humans. One C. elegans member is annotated as a Daf-16-dependent longevity protein 1 but this could not be confirmed. The function is unknown.


Pssm-ID: 255793  Cd Length: 147  Bit Score: 37.38  E-value: 1.78e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 148658623  341 APGPANLAPAEPQPTIAATQ---APPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMA 401
Cdd:pfam10152  47 IPGLEDVTVQTTPPPPASAItngGPPPPPPARAEAASPPPPEAPAEPPAEPEPEAPAENTVTVA 110
SOG2 pfam10428
RAM signalling pathway protein; SOG2 proteins in Saccharomyces cerevisiae are involved in cell ...
332-469 8.31e-03

RAM signalling pathway protein; SOG2 proteins in Saccharomyces cerevisiae are involved in cell separation and cytokinesis.


Pssm-ID: 255982  Cd Length: 417  Bit Score: 37.03  E-value: 8.31e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  332 LFVAYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQN-PAIIPATPSTPSPSATQPTMATPSPSAAQP 410
Cdd:pfam10428 141 LRNAWSSLGPPLQSRKRDAVTASPGSMIARNTPSSDRLTPRSVTPTRGRrPSSSPRSLSTTLESSRNMQVATDVPPPSSN 220
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 148658623  411 GTATPSPSATQPGTASPSPGvtdtiapavtATPgASPATLIATPTRTPIPLTPLTRTPT 469
Cdd:pfam10428 221 GSSRSSTMSSSANLSIISSL----------ATP-RSGESFRSTPTSMSSSINPVSGLDE 268
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
1-234 8.02e-42

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 156.75  E-value: 8.02e-42
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623   1 MKLRH---SARTDVGRTRDHNEDDFGVGE---------GAGVEQYGeLLIVCDGMGGHAAGEVASRLGVETIL---STYY 65
Cdd:PRK14559 370 MQLVSledAGRTDVGRQRHHNEDYFGINTriqklenphGRIVQARG-LYILCDGMGGHAAGEVASALAVETLQqyfQQHW 448
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  66 SDASPDRvDVLRRAFERANARIHA-------EGRGAMGTTGVAALFYQGMLHVANVGDSRAYLI-RNDEICQVSRDHSlV 137
Cdd:PRK14559 449 QDELPDE-ETIREAIYLANEAIYDlnqqnarSGSGRMGTTLVMALVQDTQVAVAHVGDSRLYRVtRKGGLEQLTVDHE-V 526
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 138 GEQ-VAAGV-ITADQARSSYYRnvITRALGYQSE--VQVDLFHLPLQAGDMVILCSDGL--HGLVgdEEICE------IV 205
Cdd:PRK14559 527 GQReIQRGVePQIAYARPDAYQ--LTQALGPRDNsaIQPDIQFLEIEEDTLLLLCSDGLsdNDLL--ETHWQthllplLS 602
                        250       260
                 ....*....|....*....|....*....
gi 148658623 206 RSMPLADAVDRLIDLANERGGTDNITAIV 234
Cdd:PRK14559 603 SSANLDQGLNKLIDLANQYNGHDNITAIL 631
PTZ00224 PTZ00224
protein phosphatase 2C; Provisional
96-247 6.66e-11

protein phosphatase 2C; Provisional


Pssm-ID: 240318 [Multi-domain]  Cd Length: 381  Bit Score: 62.48  E-value: 6.66e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  96 GTTGVaalFYQGM----LHVANVGDSRAYLIRNDEICQVSRDHS-----------LVGEQVAAGVITADQARSSYY--RN 158
Cdd:PTZ00224 105 GSTGT---FCVIMkdvhLQVGNVGDSRVLVCRDGKLVFATEDHKpnnpgerqrieACGGRVVSNRVDGDLAVSRAFgdRS 181
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 159 VITRALGYQSEVQV----DLFHLPLQAGDMVILCSDGL-HGLVGDEEICEIVR-----SMPLADAVDRLIDLANERGGTD 228
Cdd:PTZ00224 182 FKVKGTGDYLEQKViavpDVTHLTCQSNDFIILACDGVfEGNFSNEEVVAFVKeqletCDDLAVVAGRVCDEAIRRGSKD 261
                        170       180
                 ....*....|....*....|...
gi 148658623 229 NITAIVAQ----VDELDALPATT 247
Cdd:PTZ00224 262 NISCLIVQlkdgASYAKLFGHTS 284
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
260-453 1.51e-09

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 58.73  E-value: 1.51e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 260 PTTVTSATVEFPATARFPAEPATERISPPPAAPPTAPPPPALPPQRESVPRRMNWLGATLATALFAGLVAVTLFVAYPSV 339
Cdd:PRK12323 374 PATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGPGGAPAPAPA 453
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 340 LAPGPANLAP---AEPQPTIAATQAPPANVPPTDIPTLQPPTQNP-AIIPATPSTPSPSATQPTMA------TPSPSAAQ 409
Cdd:PRK12323 454 PAAAPAAAARpaaAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPwEELPPEFASPAPAQPDAAPAgwvaesIPDPATAD 533
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....
gi 148658623 410 PgtATPSPSATQPGTASPSPGVTDTIAPAVTATPGASPATLIAT 453
Cdd:PRK12323 534 P--DDAFETLAPAPAAAPAPRAAAATEPVVAPRPPRASASGLPD 575
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
337-470 1.60e-09

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 251763 [Multi-domain]  Cd Length: 979  Bit Score: 58.93  E-value: 1.60e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  337 PSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQP-------------------PTQNPAIIPATPSTPSPSATQ 397
Cdd:pfam03154 179 PSIQVPPGAALAPSAPPPTPSAQAVPPQGSPIAAQPAPQPqqpsplslisapslhpqrlPSPHPPLQPQTASQQSPQPPA 258
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  398 PTMATPSPSAAQPGTATPSPSATQ------PGTASPSP-GVTDTIAPAVTATPGASPATLIATPTRTPIPLTPLTRTPTP 470
Cdd:pfam03154 259 PSSRHPQSSHHGPGPPMPHALQQGpvflqhPSSNPPQPfGLAQSQVPPLPLPSQAQPHSHTPPSQSALQPQQPPREQPLP 338
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
319-468 1.55e-08

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 55.49  E-value: 1.55e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 319 LATALFAGLVAVTL-FVAY-PSVLAPGPANLAPAEPQPTIAATQAPpANVPPTDIPTLQPPTQnPAIIPATPstPSPSAT 396
Cdd:PRK14951 346 LAPDEYAALTMVLLrLLAFkPAAAAEAAAPAEKKTPARPEAAAPAA-APVAQAAAAPAPAAAP-AAAASAPA--APPAAA 421
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 148658623 397 QPTMATPSPSAAQPGTATPSPSATQPGTASPSPGVTDTIAPAVTATPGASPATLIATPTRTPIPlTPLTRTP 468
Cdd:PRK14951 422 PPAPVAAPAAAAPAAAPAAAPAAVALAPAPPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAA-ARLTPTE 492
PRK10856 PRK10856
cytoskeletal protein RodZ; Provisional
350-456 2.83e-08

cytoskeletal protein RodZ; Provisional


Pssm-ID: 236776 [Multi-domain]  Cd Length: 331  Bit Score: 53.88  E-value: 2.83e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 350 AEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPGTASPSP 429
Cdd:PRK10856 159 GQSVPLDTSTTTDPATTPAPAAPVDTTPTNSQTPAVATAPAPAVDPQQNAVVAPSQANVDTAATPAPAAPATPDGAAPLP 238
                         90       100
                 ....*....|....*....|....*..
gi 148658623 430 gvtdtIAPAVTATPGASPATLIATPTR 456
Cdd:PRK10856 239 -----TDQAGVSTPAADPNALVMNFTA 260
TFIIA pfam03153
Transcription factor IIA, alpha/beta subunit; Transcription initiation factor IIA (TFIIA) is a ...
349-460 3.93e-08

Transcription factor IIA, alpha/beta subunit; Transcription initiation factor IIA (TFIIA) is a heterotrimer, the three subunits being known as alpha, beta, and gamma, in order of molecular weight. The N and C-terminal domains of the gamma subunit are represented in pfam02268 and pfam02751, respectively. This family represents the precursor that yields both the alpha and beta subunits. The TFIIA heterotrimer is an essential general transcription initiation factor for the expression of genes transcribed by RNA polymerase II. Together with TFIID, TFIIA binds to the promoter region; this is the first step in the formation of a pre-initiation complex (PIC). Binding of the rest of the transcription machinery follows this step. After initiation, the PIC does not completely dissociate from the promoter. Some components, including TFIIA, remain attached and re-initiate a subsequent round of transcription.


Pssm-ID: 251762 [Multi-domain]  Cd Length: 302  Bit Score: 53.22  E-value: 3.93e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  349 PAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPgtasPS 428
Cdd:pfam03153  51 PSPPAPPPPLQLPQPLPPPPQAPPALQALPAGDAQQHNTPTSSPAAAPPAAFATPAGMGAGPTIQTPPGQLYQV----NV 126
                          90       100       110
                  ....*....|....*....|....*....|..
gi 148658623  429 PGVTDTIAPAVTATPGASPATLIATPTRTPIP 460
Cdd:pfam03153 127 PVMVNQNSANSQLAQPAQERAAQQLTQRYGAP 158
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
324-452 6.18e-08

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 53.84  E-value: 6.18e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 324 FAGLVAVTLFVAYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATP 403
Cdd:PRK07764 387 VAGGAGAPAAAAPSAAAAAPAAAPAPAAAAPAAAAAPAPAAAPQPAPAPAPAPAPPSPAGNAPAGGAPSPPPAAAPSAQP 466
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*....
gi 148658623 404 SPSAAQPGTATPSPSATQPGTASPSPgvtdtiAPAVTATPGASPATLIA 452
Cdd:PRK07764 467 APAPAAAPEPTAAPAPAPPAAPAPAA------APAAPAAPAAPAGADDA 509
PHA03269 PHA03269
envelope glycoprotein C; Provisional
334-467 6.23e-08

envelope glycoprotein C; Provisional


Pssm-ID: 165527 [Multi-domain]  Cd Length: 566  Bit Score: 53.58  E-value: 6.23e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 334 VAYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQP-PTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGT 412
Cdd:PHA03269  26 IPIPELHTSAATQKPDPAPAPHQAASRAPDPAVAPTSAASRKPdLAQAPTPAASEKFDPAPAPHQAASRAPDPAVAPQLA 105
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 148658623 413 ATPSPSATQPGTASPspgvTDTIAPAVTATPGASPATLIATPTRTPIPLTPLTRT 467
Cdd:PHA03269 106 AAPKPDAAEAFTSAA----QAHEAPADAGTSAASKKPDPAAHTQHSPPPFAYTRS 156
PHA03247 PHA03247
large tegument protein UL36; Provisional
252-470 9.22e-08

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 53.40  E-value: 9.22e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  252 PERATVELPTTVTSATVEFPATARFPAEPATERISPPPAAPPTAPPPPALPPQRESVPRRMNWLGATLATALFAGLVAVT 331
Cdd:PHA03247 2714 ALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSE 2793
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  332 LFVAYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPST-------------PSPSATQP 398
Cdd:PHA03247 2794 SRESLPSPWDPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLggsvapggdvrrrPPSRSPAA 2873
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 148658623  399 TMATPS----PSAAQPGTATPSPSATQPGTASPSPGVTDTIAPAVTATPGASPATLIATPTRTPIPLTPLTRTPTP 470
Cdd:PHA03247 2874 KPAAPArppvRRLARPAVSRSTESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPTTDP 2949
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
307-470 1.02e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 52.93  E-value: 1.02e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 307 SVPRRMNWLGATLATALFAGLVAVTLFVAYPSVLAPGPANLAPAEPQPTIAATQAPPanvPPTDIPTLQPPTQNPAIIPA 386
Cdd:PRK07003 375 RVAGAVPAPGARAAAAVGASAVPAVTAVTGAAGAALAPKAAAAAAATRAEAPPAAPA---PPATADRGDDAADGDAPVPA 451
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 387 TPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPGTASPSPGVTDTIAPAVTATPGASPATLIATPTRTPIPLTPLTR 466
Cdd:PRK07003 452 KANARASADSRCDERDAQPPADSGSASAPASDAPPDAAFEPAPRAAAPSAATPAAVPDARAPAAASREDAPAAAAPPAPE 531

                 ....
gi 148658623 467 TPTP 470
Cdd:PRK07003 532 ARPP 535
PHA03247 PHA03247
large tegument protein UL36; Provisional
221-470 2.59e-07

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 52.25  E-value: 2.59e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  221 ANERGGTDNITAIVAQVDELDALPATTddAEPERATVELPTTVTSATVEFPA--TARFPAEPATERISPPPAAPptappp 298
Cdd:PHA03247 2635 ANEPDPHPPPTVPPPERPRDDPAPGRV--SRPRRARRLGRAAQASSPPQRPRrrAARPTVGSLTSLADPPPPPP------ 2706
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  299 palppqrESVPRRMNWLGATLATALFAGlvAVTLFVAYPSVLAPGPANLAPAEP-----QPTIAATQAPPANVPPTDIPT 373
Cdd:PHA03247 2707 -------TPEPAPHALVSATPLPPGPAA--ARQASPALPAAPAPPAVPAGPATPggparPARPPTTAGPPAPAPPAAPAA 2777
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  374 LQPPTQN-PAIIPATPSTPS----------------PSATQPTMATPSPSAAQPGTATPSPSATQPGTASPSPGVTDTIA 436
Cdd:PHA03247 2778 GPPRRLTrPAVASLSESRESlpspwdpadppaavlaPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVA 2857
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|
gi 148658623  437 PA---VTATPGASPATLIATPTRTP---IPLTPLTRTPTP 470
Cdd:PHA03247 2858 PGgdvRRRPPSRSPAAKPAAPARPPvrrLARPAVSRSTES 2897
PHA03378 PHA03378
EBNA-3B; Provisional
336-470 4.23e-07

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 51.22  E-value: 4.23e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 336 YPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPS---PSAAQPGT 412
Cdd:PHA03378 624 WPMPLRPIPMRPLRMQPITFNVLVFPTPHQPPQVEITPYKPTWTQIGHIPYQPSPTGANTMLPIQWAPGtmqPPPRAPTP 703
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 148658623 413 ATP---SPSATQPGTASPSPGVTDTIAPAVTATPGASPATL---IATPTRTPIPLTPLTRTPTP 470
Cdd:PHA03378 704 MRPpaaPPGRAQRPAAATGRARPPAAAPGRARPPAAAPGRArppAAAPGRARPPAAAPGRARPP 767
PHA03378 PHA03378
EBNA-3B; Provisional
335-463 4.26e-07

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 51.22  E-value: 4.26e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 335 AYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQnpaiipATPSTPSPSATQPTMAtpSPSAAQPGTAT 414
Cdd:PHA03378 704 MRPPAAPPGRAQRPAAATGRARPPAAAPGRARPPAAAPGRARPPA------AAPGRARPPAAAPGRA--RPPAAAPGAPT 775
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*....
gi 148658623 415 PspsaTQPGTASPSPGVTDTIAPAVTATPGASPATLIATPTRTPIPLTP 463
Cdd:PHA03378 776 P----QPPPQAPPAPQQRPRGAPTPQPPPQAGPTSMQLMPRAAPGQQGP 820
PRK14950 PRK14950
DNA polymerase III subunits gamma and tau; Provisional
378-470 4.90e-07

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237864 [Multi-domain]  Cd Length: 585  Bit Score: 50.58  E-value: 4.90e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 378 TQNPAIIPATPSTPSPSATQPTMATPSPSAAQPgTATPSPSATQPGTASPSPGVTDTIAPAVTATPGASPATliaTPTRT 457
Cdd:PRK14950 361 VPVPAPQPAKPTAAAPSPVRPTPAPSTRPKAAA-AANIPPKEPVRETATPPPVPPRPVAPPVPHTPESAPKL---TRAAI 436
                         90
                 ....*....|...
gi 148658623 458 PIPLTPLTRTPTP 470
Cdd:PRK14950 437 PVDEKPKYTPPAP 449
PHA03247 PHA03247
large tegument protein UL36; Provisional
232-470 4.97e-07

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 51.09  E-value: 4.97e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  232 AIVAQVDELDALPATTDDAEPERATVELPTTVTSATVEFPATARFPAEPATERISPPPAAPPTAPPPPALPPQRESVPRR 311
Cdd:PHA03247 2581 AVTSRARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPPPSPSPAANEPDPHPPPTVPPPERPRDDPAPGR 2660
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  312 MNWLGATLATALFAGLVAVTL---------FVAYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTD-----IPTLQPP 377
Cdd:PHA03247 2661 VSRPRRARRLGRAAQASSPPQrprrraarpTVGSLTSLADPPPPPPTPEPAPHALVSATPLPPGPAAArqaspALPAAPA 2740
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  378 TQNPAIIPATPSTPSPSATQPTMATP-SPSAAQPGTATPSPSATQPGTASPSPGVTDTIAPAVTATPGA--SPATLIATP 454
Cdd:PHA03247 2741 PPAVPAGPATPGGPARPARPPTTAGPpAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPADPPAavLAPAAALPP 2820
                         250
                  ....*....|....*.
gi 148658623  455 TRTPIPLTPLTRTPTP 470
Cdd:PHA03247 2821 AASPAGPLPPPTSAQP 2836
PRK14950 PRK14950
DNA polymerase III subunits gamma and tau; Provisional
331-429 7.44e-07

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237864 [Multi-domain]  Cd Length: 585  Bit Score: 50.19  E-value: 7.44e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 331 TLFVAYPSVLAPGPANLAPAEPQPTIAATQAPPAnvpptdIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAqP 410
Cdd:PRK14950 358 ALLVPVPAPQPAKPTAAAPSPVRPTPAPSTRPKA------AAAANIPPKEPVRETATPPPVPPRPVAPPVPHTPESAP-K 430
                         90
                 ....*....|....*....
gi 148658623 411 GTATPSPSATQPGTASPSP 429
Cdd:PRK14950 431 LTRAAIPVDEKPKYTPPAP 449
TALPID3 pfam15324
Hedgehog signalling target; TALPID3 is a family of eukaryotic proteins that are targets for ...
357-470 8.03e-07

Hedgehog signalling target; TALPID3 is a family of eukaryotic proteins that are targets for Hedgehog signalling. Mutations in this gene noticed first in chickens lead to multiple abnormalities of development.


Pssm-ID: 259457 [Multi-domain]  Cd Length: 1180  Bit Score: 50.26  E-value: 8.03e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623   357 AATQAPPANVPPTDIPTLQppTQNPAIIPATPSTPSPSatqPTMATPSPSAAQPGTATP--SPSATQPGTASPspgVTDT 434
Cdd:pfam15324  847 AKKQVPAATSVPGDVSTNE--TYLPARVCTPVATPQPT---PPPSPPSPPKELVLVKTPdsSPCVSDHDGAFP---VKEI 918
                           90       100       110
                   ....*....|....*....|....*....|....*.
gi 148658623   435 IAPAVTATPGAspaTLIATPTRTPIPLTPLTRTPTP 470
Cdd:pfam15324  919 LAEKGSDMPAI---TLVNTPVVTPVTTPPPAATPTP 951
PRK14950 PRK14950
DNA polymerase III subunits gamma and tau; Provisional
304-441 9.17e-07

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237864 [Multi-domain]  Cd Length: 585  Bit Score: 49.81  E-value: 9.17e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 304 QRESVPRRMNWLGATLATALFAGLVA---VTLFVAYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQN 380
Cdd:PRK14950 314 ALQKVSQIANLEALTKWVKAFSQLDFqlrTTSYGQLPLELAVIEALLVPVPAPQPAKPTAAAPSPVRPTPAPSTRPKAAA 393
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 148658623 381 PAIIPATPSTPSPsATQPTmaTPSPSAAQPGTATPSPSATQPGTASPSPGVTDTIAPAVTA 441
Cdd:PRK14950 394 AANIPPKEPVRET-ATPPP--VPPRPVAPPVPHTPESAPKLTRAAIPVDEKPKYTPPAPPK 451
PHA02682 PHA02682
ORF080 virion core protein; Provisional
337-447 1.54e-06

ORF080 virion core protein; Provisional


Pssm-ID: 177464 [Multi-domain]  Cd Length: 280  Bit Score: 48.32  E-value: 1.54e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 337 PSVLAPGPANLAPAEPQPTIAAT-QAPPANVPPTDIPTLQPPTQNPAIIPATPSTPsPSATQPTMATPSPSAAQPGTATP 415
Cdd:PHA02682  86 PACAAPAPACPACAPAAPAPAVTcPAPAPACPPATAPTCPPPAVCPAPARPAPACP-PSTRQCPPAPPLPTPKPAPAAKP 164
                         90       100       110
                 ....*....|....*....|....*....|..
gi 148658623 416 SPSATQpgtaSPSPGVTDTIAPAVTATPGASP 447
Cdd:PHA02682 165 IFLHNQ----LPPPDYPAASCPTIETAPAASP 192
PHA03378 PHA03378
EBNA-3B; Provisional
349-470 1.96e-06

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 48.91  E-value: 1.96e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 349 PAEPQPTIAATQAPPANVPPTdiptLQPPTQNPAiiPATPSTPSPSATQPTMATPS---PSAAQPGTATP---SPSATQP 422
Cdd:PHA03378 673 PYQPSPTGANTMLPIQWAPGT----MQPPPRAPT--PMRPPAAPPGRAQRPAAATGrarPPAAAPGRARPpaaAPGRARP 746
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 148658623 423 GTASPSPGVTDTIAPAVTATPGASPATliATPTRTP-IPLTPLTR---TPTP 470
Cdd:PHA03378 747 PAAAPGRARPPAAAPGRARPPAAAPGA--PTPQPPPqAPPAPQQRprgAPTP 796
PRK10905 PRK10905
cell division protein DamX; Validated
334-449 2.73e-06

cell division protein DamX; Validated


Pssm-ID: 236792 [Multi-domain]  Cd Length: 328  Bit Score: 47.62  E-value: 2.73e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 334 VAYPSVLAPGPANLAPAEPQptiAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTA 413
Cdd:PRK10905 117 VAVNSTLPTEPATVAPVRNG---NASRQTAKTQTAERPATTRPARKQAVIEPKKPQATAKTEPKPVAQTPKRTEPAAPVA 193
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 148658623 414 TPSPSATqpgTASPSPGVTDTIAPAVTATPGASPAT 449
Cdd:PRK10905 194 STKAPAA---TSTPAPKETATTAPVQTASPAQTTAT 226
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
334-470 3.96e-06

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 47.95  E-value: 3.96e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 334 VAYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTA 413
Cdd:PRK12323 377 AAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGPGGAPAPAPAPAA 456
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 148658623 414 TPSPSATQPGTASPSPGVTDTIAPAVTATPGASPATLIATPTRTPIPLTPLTRTPTP 470
Cdd:PRK12323 457 APAAAARPAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQ 513
PRK07994 PRK07994
DNA polymerase III subunits gamma and tau; Validated
340-470 4.49e-06

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236138 [Multi-domain]  Cd Length: 647  Bit Score: 47.55  E-value: 4.49e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 340 LAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAA-------QPGT 412
Cdd:PRK07994 357 LAFHPAAPLPEPEVPPQSAAPAASAQATAAPTAAVAPPQAPAVPPPPASAPQQAPAVPLPETTSQLLAArqqlqraQGAT 436
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 148658623 413 ATPSPSATQPGTASPSPGVTDTIAPAVTATPGASPATLIATPTR---TPIPLTPLTRTPTP 470
Cdd:PRK07994 437 KAKKSEPAAASRARPVNSALERLASVRPAPSALEKAPAKKEAYRwkaTNPVEVKKEPVATP 497
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
340-465 4.74e-06

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 47.67  E-value: 4.74e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 340 LAPGPANLAPAEPQPTIAATQAPPANVPPTDIPtlqPPTQNPAIIPATPSTPSP-SATQPTMATPSPSAAQPGTATPSPS 418
Cdd:PRK07764 385 LGVAGGAGAPAAAAPSAAAAAPAAAPAPAAAAP---AAAAAPAPAAAPQPAPAPaPAPAPPSPAGNAPAGGAPSPPPAAA 461
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 148658623 419 ATQPGTASPSPGVTDTIAPAVTATPGASPATLIATPTRTPIPLTPLT 465
Cdd:PRK07764 462 PSAQPAPAPAAAPEPTAAPAPAPPAAPAPAAAPAAPAAPAAPAGADD 508
rne PRK10811
ribonuclease E; Reviewed
328-470 4.89e-06

ribonuclease E; Reviewed


Pssm-ID: 236766 [Multi-domain]  Cd Length: 1068  Bit Score: 47.73  E-value: 4.89e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  328 VAVTLFVAYPSVLA-PGPANLAPAE---PQPTIAATQAPPANVPPTDIPTLQPPTQNPAiiPATPSTPSPSATQPTMATP 403
Cdd:PRK10811  889 EAVAEVVEEPVVVAePQPEEVVVVEtthPEVIAAPVTEQPQVITESDVAVAQEVAEHAE--PVVEPQDETADIEEAAETA 966
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  404 SPSAAQPGTATPSPSATQPgtASPSPGVTDTIAPAVTATPGASPATL---IATptrtpiplTPLTRTPTP 470
Cdd:PRK10811  967 EVVVAEPEVVAQPAAPVVA--EVAAEVETVTAVEPEVAPAQVPEATVehnHAT--------APMTRAPAP 1026
PHA03378 PHA03378
EBNA-3B; Provisional
344-470 5.07e-06

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 47.75  E-value: 5.07e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 344 PANLAPAEPQPTIAA-TQAPPANVPPTdipTLQPPTQNPAiiPATPSTPSPSATQPTMATPSPsaAQPGTATPS---PSA 419
Cdd:PHA03378 686 PIQWAPGTMQPPPRApTPMRPPAAPPG---RAQRPAAATG--RARPPAAAPGRARPPAAAPGR--ARPPAAAPGrarPPA 758
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 148658623 420 TQPGTASPSPGVTDtiAPAVTATPGASPATLiATPTRTPIPLTPLTRTPTP 470
Cdd:PHA03378 759 AAPGRARPPAAAPG--APTPQPPPQAPPAPQ-QRPRGAPTPQPPPQAGPTS 806
motB PRK12799
flagellar motor protein MotB; Reviewed
346-468 5.42e-06

flagellar motor protein MotB; Reviewed


Pssm-ID: 183756 [Multi-domain]  Cd Length: 421  Bit Score: 47.02  E-value: 5.42e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 346 NLAPAEPQPTIAATQAPPANVPP--TDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPG 423
Cdd:PRK12799 283 DIEKATGLKQIDTHGTVPVAAVTpsSAVTQSSAITPSSAAIPSPAVIPSSVTTQSATTTQASAVALSSAGVLPSDVTLPG 362
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 148658623 424 T-ASPSPGVTDTIAPAVTATPGASPATLIATPTR----TPIPLTPLTRTP 468
Cdd:PRK12799 363 TvALPAAEPVNMQPQPMSTTETQQSSTGNITSTAngptTSLPAAPASNIP 412
PHA03247 PHA03247
large tegument protein UL36; Provisional
341-466 5.58e-06

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 47.63  E-value: 5.58e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  341 APGPANLAPAEPQPTIAATQAPPANVPPTDI-PTLQ--------PPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPG 411
Cdd:PHA03247 2548 AGDPPPPLPPAAPPAAPDRSVPPPRPAPRPSePAVTsrarrpdaPPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPP 2627
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 148658623  412 TATPSPSATQPGTASPSPGVTDTIAPAVTATPGASPATLIATPTRTPIPLTPLTR 466
Cdd:PHA03247 2628 PPSPSPAANEPDPHPPPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQR 2682
DUF4106 pfam13388
Protein of unknown function (DUF4106); This family of proteins are found in large numbers in ...
331-423 8.46e-06

Protein of unknown function (DUF4106); This family of proteins are found in large numbers in the Trichomonas vaginalis proteome. The function of this protein is unknown.


Pssm-ID: 257714 [Multi-domain]  Cd Length: 422  Bit Score: 46.59  E-value: 8.46e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  331 TLFVAYPSVLAPGPANLAPAEPQP-TIAATQ------AP-PANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMAT 402
Cdd:pfam13388 163 TYILASGTYIPPNPPREAPAPGLPkTFTSSHghrhrhAPkPTQQPTVQNPAQQPTVQNPAQQPQQQPQQQPVQPAQQPTP 242
                          90       100
                  ....*....|....*....|.
gi 148658623  403 PSPSAAQPGTATPSPSATQPG 423
Cdd:pfam13388 243 QNPAQQPPQTEQGHKRSREQG 263
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
337-470 9.31e-06

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralizing antibodies in vivo.


Pssm-ID: 253014 [Multi-domain]  Cd Length: 830  Bit Score: 46.69  E-value: 9.31e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  337 PSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPT-QNPAIIPATPSTPSPSaTQPTMATPSPSAAQPGTATP 415
Cdd:pfam05109 457 PASTGPTVSTADPTSGTPTGTTSSTLPEDTSPTSRTTSATPNaTSPTPAVTTPNATSPT-TQKTSDTPNATSPTPIVIGV 535
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 148658623  416 SPSATQP--GTASP----SPGVTDTIAPAVTATPGASPATLIATPTRTP------------IPLTPLTRTPTP 470
Cdd:pfam05109 536 TTTATSPptGTTSVpnatSPQVTEESPVNNTNTPVVTSAPSVLTSAVTTgqhgtgssptsqQPGIPSSSHSTP 608
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
337-452 9.54e-06

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 46.90  E-value: 9.54e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 337 PSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPS 416
Cdd:PRK07764 418 AAAAAPAPAAAPQPAPAPAPAPAPPSPAGNAPAGGAPSPPPAAAPSAQPAPAPAAAPEPTAAPAPAPPAAPAPAAAPAAP 497
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 148658623 417 PSATQPGTASPSPGVTDTIAPAVTATPGASPATLIA 452
Cdd:PRK07764 498 AAPAAPAGADDAATLRERWPEILAAVPKRSRKTWAI 533
kgd PRK12270
alpha-ketoglutarate decarboxylase; Reviewed
358-458 9.65e-06

alpha-ketoglutarate decarboxylase; Reviewed


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 46.81  E-value: 9.65e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  358 ATQAPPANVPPTDIPTlqpptqnpaiiPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPGTASPSPGVTDTIAP 437
Cdd:PRK12270   34 ADYGPGSTAAPTAAAA-----------AAAAAASAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAAPPAA 102
                          90       100
                  ....*....|....*....|.
gi 148658623  438 AVTATPGASPATLIATPTRTP 458
Cdd:PRK12270  103 AAAAAPAAAAVEDEVTPLRGA 123
PAT1 pfam09770
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ...
348-470 1.39e-05

Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division.


Pssm-ID: 255543 [Multi-domain]  Cd Length: 806  Bit Score: 46.31  E-value: 1.39e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  348 APAEPQPTIAATQAPPANVPPTDI--PTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPGTA 425
Cdd:pfam09770 166 RQQAPQLPQPPQQVLPQGMPPRQAafPQQGPPEQPPGYPQPPQGHPEQVQPQQFLPAPSQAPAQPPLPPQLPQQPPPLQQ 245
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 148658623  426 SPSPGVTDTIAPAVTATPGASPATLIA----TPTRTPIPLTPLTRTPTP 470
Cdd:pfam09770 246 PQFPGLSQQMPPPPPQPPQQQQQPPQPqaqpPPQNQPTPHPGLPQGQNA 294
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
353-470 1.55e-05

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 46.02  E-value: 1.55e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 353 QPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTP--SPSATQPTMATPSPSAAQPGTATPSPSATQPGTASPS-- 428
Cdd:PRK12323 364 RPGQSGGGAGPATAAAAPVAQPAPAAAAPAAAAPAPAAPpaAPAAAPAAAAAARAVAAAPARRSPAPEALAAARQASArg 443
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|..
gi 148658623 429 PGVTDTIAPAVTATPGASPATLIATPTRTPIPLTPLTRTPTP 470
Cdd:PRK12323 444 PGGAPAPAPAPAAAPAAAARPAAAGPRPVAAAAAAAPARAAP 485
MCPVI pfam02993
Minor capsid protein VI; This minor capsid protein may act as a link between the external ...
341-446 1.60e-05

Minor capsid protein VI; This minor capsid protein may act as a link between the external capsid and the internal DNA-protein core. The C-terminal 11 residues may function as a protease cofactor leading to enzyme activation.


Pssm-ID: 251663 [Multi-domain]  Cd Length: 238  Bit Score: 44.79  E-value: 1.60e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  341 APGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPtqnPAIIPATPSTPSPSA-TQPTMATPSPSAAQPGTATPSPSA 419
Cdd:pfam02993 112 EEEPAPQEETVADPIQALQPRPRPDVEEVLVPAAPEP---PSYEETIKPGPAPVEePVDSMAIAVPAIDTPVTLELPPAP 188
                          90       100
                  ....*....|....*....|....*..
gi 148658623  420 TQPGTASPSPGVTDTIAPAVTATPGAS 446
Cdd:pfam02993 189 QPPPPVVPQPSTMVVHRRSRIKRTRSS 215
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
341-463 1.66e-05

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 45.93  E-value: 1.66e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  341 APGPANLAPAEPQPTIAatqaPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSAT 420
Cdd:PHA03307  105 SPTPPGPSSPDPPPPTP----PPASPPPSPAPDLSEMLRPVGSPGPPPAASPPAAGASPAAVASDAASSRQAALPLSSPE 180
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 148658623  421 QPGTASPSPGVTDTIAPAVTATPGASPAT--LIATPTRTPIPLTP 463
Cdd:PHA03307  181 ETARAPSSPPAEPPPSTPPAAASPRPPRRssPISASASSPAPAPG 225
kgd PRK12270
alpha-ketoglutarate decarboxylase; Reviewed
342-424 1.67e-05

alpha-ketoglutarate decarboxylase; Reviewed


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 46.04  E-value: 1.67e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  342 PGPANLAPAEPQPTIAATQAPPAnVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPgtATPSPSATQ 421
Cdd:PRK12270   38 PGSTAAPTAAAAAAAAAASAPAA-APAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAAPPAAAAA--AAPAAAAVE 114

                  ...
gi 148658623  422 PGT 424
Cdd:PRK12270  115 DEV 117
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
333-460 1.96e-05

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 251763 [Multi-domain]  Cd Length: 979  Bit Score: 45.83  E-value: 1.96e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  333 FVAYPSVLAPGPAnLAPAEPQPTIAATQA--PPANVPPTDIPtLQPPTQNPAIIPATPSTPSPSATQPTMATP-----SP 405
Cdd:pfam03154 374 FPQMPSNLPPPPA-LKPLSSLPTHHPPSAhpPPLQLMPQSQP-LQSVPAQPPVLTQSQSLPPKASTHPHSGLHsgppqSP 451
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 148658623  406 SAAQPGTATPSPSATQPGTASPS-PGVTDTIAPAVTATPGASPATLIATPTRTPIP 460
Cdd:pfam03154 452 FAQHPFTSGGLPAIGPPPSLPTStPAAPPRASSGSQPPGSALPSSGGCAGPGPPLP 507
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
348-470 2.34e-05

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralizing antibodies in vivo.


Pssm-ID: 253014 [Multi-domain]  Cd Length: 830  Bit Score: 45.54  E-value: 2.34e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  348 APAEPQPTIAATQAPPANVPPTDI--------PTLQPPTQNPAIIPATP--STPSPSATQPTMATPSPSAA---QPGTAT 414
Cdd:pfam05109 482 LPEDTSPTSRTTSATPNATSPTPAvttpnatsPTTQKTSDTPNATSPTPivIGVTTTATSPPTGTTSVPNAtspQVTEES 561
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 148658623  415 PSPSATQPGTASPSPGVTDTIAPA---VTATPGAS----PATLIATPTRTPIPLTPLTRTPTP 470
Cdd:pfam05109 562 PVNNTNTPVVTSAPSVLTSAVTTGqhgTGSSPTSQqpgiPSSSHSTPRSNSTSTTPLLTSAHP 624
PTZ00436 PTZ00436
60S ribosomal protein L19-like protein; Provisional
341-460 2.51e-05

60S ribosomal protein L19-like protein; Provisional


Pssm-ID: 185616 [Multi-domain]  Cd Length: 357  Bit Score: 44.94  E-value: 2.51e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 341 APGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAqpgTATPSPSAT 420
Cdd:PTZ00436 221 APAKAAAAPAKAAAPPAKAAAAPAKAAAAPAKAAAPPAKAAAPPAKAAAPPAKAAAPPAKAAAPPAKA---AAPPAKAAA 297
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|
gi 148658623 421 QPGTASPSPGVTDTiAPAVTATPgasPATLIATPTRTPIP 460
Cdd:PTZ00436 298 APAKAAAAPAKAAA-APAKAAAP---PAKAAAPPAKAATP 333
PHA02682 PHA02682
ORF080 virion core protein; Provisional
321-470 2.82e-05

ORF080 virion core protein; Provisional


Pssm-ID: 177464 [Multi-domain]  Cd Length: 280  Bit Score: 44.47  E-value: 2.82e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 321 TALFAGLVAVTLFVAYPSVLAPgpanlAPAEPQPtiaatqaPPANVPPTDIPTL-------QPPTQNPAIIPATPSTPSP 393
Cdd:PHA02682  14 TKLVLADTSSSLFTKCPQATIP-----APAAPCP-------PDADVDPLDKYSVkeagryyQSRLKANSACMQRPSGQSP 81
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 148658623 394 SATQPTMATPSPSAAQPGTATPSPSATQPGTASPSPGVTDTIAPAVTATPGASPATLIATPTRTPIPLTPLTRTPTP 470
Cdd:PHA02682  82 LAPSPACAAPAPACPACAPAAPAPAVTCPAPAPACPPATAPTCPPPAVCPAPARPAPACPPSTRQCPPAPPLPTPKP 158
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
348-460 2.90e-05

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 45.25  E-value: 2.90e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 348 APAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSA------AQPGTATPSPSATQ 421
Cdd:PRK12323 373 GPATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEAlaaarqASARGPGGAPAPAP 452
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 148658623 422 PGTASPSPGVTDTIAPAVTATPGASPATLIATPTRTPIP 460
Cdd:PRK12323 453 APAAAPAAAARPAAAGPRPVAAAAAAAPARAAPAAAPAP 491
Rib_recp_KP_reg pfam05104
Ribosome receptor lysine/proline rich region; This highly conserved region is found towards ...
349-439 3.22e-05

Ribosome receptor lysine/proline rich region; This highly conserved region is found towards the C-terminus of the transmembrane domain. The function is unclear.


Pssm-ID: 253010 [Multi-domain]  Cd Length: 151  Bit Score: 42.65  E-value: 3.22e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  349 PAEPQPTIAATQAPPANVPPTDIPTLQPpTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPGTASPS 428
Cdd:pfam05104  60 VTEVEVIIEKEPVPAVAVAPVPVAVVAP-VVAPKPKKSQPVMSQEKTASPQKSVPAPSPKEKKKKKVAKVEPAPAKAVAV 138
                          90
                  ....*....|.
gi 148658623  429 PGVTDTIAPAV 439
Cdd:pfam05104 139 PVLASKSAPVP 149
PRK10263 PRK10263
DNA translocase FtsK; Provisional
338-468 3.44e-05

DNA translocase FtsK; Provisional


Pssm-ID: 236669 [Multi-domain]  Cd Length: 1355  Bit Score: 45.08  E-value: 3.44e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  338 SVLAPGPANLAPAEPQPTIAATQAPPANVPPtdIPTLQPPTQNPAI----IPAtPSTPSPS-ATQPTMATPSPSAAQPGT 412
Cdd:PRK10263  315 PITEPVAVAAAATTATQSWAAPVEPVTQTPP--VASVDVPPAQPTVawqpVPG-PQTGEPViAPAPEGYPQQSQYAQPAV 391
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 148658623  413 ATPSPsATQPGTASPSPGVTDTIAPAVTATPGASPATLIATPTRTPIPLTPLTRTP 468
Cdd:PRK10263  392 QYNEP-LQQPVQPQQPYYAPAAEQPAQQPYYAPAPEQPAQQPYYAPAPEQPVAGNA 446
PTZ00436 PTZ00436
60S ribosomal protein L19-like protein; Provisional
341-459 3.90e-05

60S ribosomal protein L19-like protein; Provisional


Pssm-ID: 185616 [Multi-domain]  Cd Length: 357  Bit Score: 44.17  E-value: 3.90e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 341 APGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPG----TATPS 416
Cdd:PTZ00436 228 APAKAAAPPAKAAAAPAKAAAAPAKAAAPPAKAAAPPAKAAAPPAKAAAPPAKAAAPPAKAAAPPAKAAAApakaAAAPA 307
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 148658623 417 PSATQPGTASPSPGVTdTIAPAVTATPGASPATLIATPTRTPI 459
Cdd:PTZ00436 308 KAAAAPAKAAAPPAKA-AAPPAKAATPPAKAAAPPAKAAAAPV 349
PRK07994 PRK07994
DNA polymerase III subunits gamma and tau; Validated
338-460 4.23e-05

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236138 [Multi-domain]  Cd Length: 647  Bit Score: 44.47  E-value: 4.23e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 338 SVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAiIPATPSTPSPSATQPTMATPSPSAAQPGTA-TPS 416
Cdd:PRK07994 387 PTAAVAPPQAPAVPPPPASAPQQAPAVPLPETTSQLLAARQQLQR-AQGATKAKKSEPAAASRARPVNSALERLASvRPA 465
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 148658623 417 PSATQPGTASPSPGVTDTIAPAVTAT-PGASPATLIATPTRTPIP 460
Cdd:PRK07994 466 PSALEKAPAKKEAYRWKATNPVEVKKePVATPKALKKALEHEKTP 510
PRK11907 PRK11907
bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase ...
328-429 6.73e-05

bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed


Pssm-ID: 237019 [Multi-domain]  Cd Length: 814  Bit Score: 44.07  E-value: 6.73e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 328 VAVTLFVaypsvLAPGPANLAPAEPQ-PTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPS 406
Cdd:PRK11907  11 VALTLAL-----LTASNPKLAQAEEIvTTTPATSTEAEQTTPVESDATEEADNTETPVAATTAAEAPSSSETAETSDPTS 85
                         90       100
                 ....*....|....*....|...
gi 148658623 407 AAQPGTATPSPSATQPGTASPSP 429
Cdd:PRK11907  86 EATDTTTSEARTVTPAATETSKP 108
rad23 TIGR00601
UV excision repair protein Rad23; All proteins in this family for which functions are known ...
373-438 7.50e-05

UV excision repair protein Rad23; All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair].


Pssm-ID: 233045 [Multi-domain]  Cd Length: 378  Bit Score: 43.35  E-value: 7.50e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 148658623  373 TLQPPTQNPAIIPATPSTPSPSAtqPTMATPSPSAAQPGTATPSPSATQPGTAsPSPGVTDTIAPA 438
Cdd:TIGR00601  79 TGTGKVAPPAATPTSAPTPTPSP--PASPASGMSAAPASAVEEKSPSEESATA-TAPESPSTSVPS 141
rad23 TIGR00601
UV excision repair protein Rad23; All proteins in this family for which functions are known ...
351-434 9.17e-05

UV excision repair protein Rad23; All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair].


Pssm-ID: 233045 [Multi-domain]  Cd Length: 378  Bit Score: 43.35  E-value: 9.17e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  351 EPQPTIAATQAPPANvpPTDIPTlqpPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPGTASPSPG 430
Cdd:TIGR00601  76 KPKTGTGKVAPPAAT--PTSAPT---PTPSPPASPASGMSAAPASAVEEKSPSEESATATAPESPSTSVPSSGSDAASTL 150

                  ....
gi 148658623  431 VTDT 434
Cdd:TIGR00601 151 VVGS 154
PHA03269 PHA03269
envelope glycoprotein C; Provisional
355-470 1.01e-04

envelope glycoprotein C; Provisional


Pssm-ID: 165527 [Multi-domain]  Cd Length: 566  Bit Score: 43.18  E-value: 1.01e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 355 TIAATQAPPANVPpTDIPTLQPPTQNPAIIPatpsTPSPSATQPTMATPSPSAAQPGTAT------------------PS 416
Cdd:PHA03269  11 TIACINLIIANLN-TNIPIPELHTSAATQKP----DPAPAPHQAASRAPDPAVAPTSAASrkpdlaqaptpaasekfdPA 85
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 148658623 417 PSATQPGTASPSPGVTDTIAPAVTATPGASPATliaTPTRTP----IPLTPLTRTPTP 470
Cdd:PHA03269  86 PAPHQAASRAPDPAVAPQLAAAPKPDAAEAFTS---AAQAHEapadAGTSAASKKPDP 140
PRK14971 PRK14971
DNA polymerase III subunits gamma and tau; Provisional
353-468 1.10e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237874 [Multi-domain]  Cd Length: 614  Bit Score: 43.23  E-value: 1.10e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 353 QPTIAATQAPPANVPPTdipTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPGTASPSPG-V 431
Cdd:PRK14971 361 QLTQKGDDASGGRGPKQ---HIKPVFTQPAAAPQPSAAAAASPSPSQSSAAAQPSAPQSATQPAGTPPTVSVDPPAAVpV 437
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 148658623 432 TDTIAPAVTATPGASPATLIATPTRTPiPLTPLTRTP 468
Cdd:PRK14971 438 NPPSTAPQAVRPAQFKEEKKIPVSKVS-SLGPSTLRP 473
PRK11907 PRK11907
bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase ...
385-470 1.22e-04

bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed


Pssm-ID: 237019 [Multi-domain]  Cd Length: 814  Bit Score: 43.30  E-value: 1.22e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 385 PATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPGTASPSPgvtdtiaPAVTATPGASPATLIATPTRTPIPLTPL 464
Cdd:PRK11907  30 EIVTTTPATSTEAEQTTPVESDATEEADNTETPVAATTAAEAPSS-------SETAETSDPTSEATDTTTSEARTVTPAA 102

                 ....*.
gi 148658623 465 TRTPTP 470
Cdd:PRK11907 103 TETSKP 108
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
304-470 1.28e-04

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralizing antibodies in vivo.


Pssm-ID: 253014 [Multi-domain]  Cd Length: 830  Bit Score: 43.23  E-value: 1.28e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  304 QRESVPRRMnwLGATLATALFAGLVAVTLFVAYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAI 383
Cdd:pfam05109 372 QNPEGCERS--LGFFNSNRTFEVTVANPVADAKTLIITRTATNATTTTHKVVFHKAPDTTKSVIFVYTLVHVEPHKTTAV 449
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  384 iPATPSTPsPSATQPTMATPSPSAAQPGTATPS--PSATQPGTASPSPGVTDTIAPAVTATPGASPATLIAT-PTRTPIP 460
Cdd:pfam05109 450 -PTTPSLP-PASTGPTVSTADPTSGTPTGTTSStlPEDTSPTSRTTSATPNATSPTPAVTTPNATSPTTQKTsDTPNATS 527
                         170
                  ....*....|
gi 148658623  461 LTPLTRTPTP 470
Cdd:pfam05109 528 PTPIVIGVTT 537
PRK13335 PRK13335
superantigen-like protein; Reviewed
345-458 1.31e-04

superantigen-like protein; Reviewed


Pssm-ID: 139494 [Multi-domain]  Cd Length: 356  Bit Score: 42.81  E-value: 1.31e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 345 ANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATqptmaTPSPSAAQPGTATPSPSATQPgt 424
Cdd:PRK13335  63 TQAANTRQERTPKLEKAPNTNEEKTSASKIEKISQPKQEEQKTLNISATPAP-----KQEQSQTTTESTTPKTKVTTP-- 135
                         90       100       110
                 ....*....|....*....|....*....|....
gi 148658623 425 asPSPGVTDTIAPAVTATPgASPATLIATPTRTP 458
Cdd:PRK13335 136 --PSTNTPQPMQSTKSDTP-QSPTIKQAQTDMTP 166
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
353-470 1.45e-04

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 251763 [Multi-domain]  Cd Length: 979  Bit Score: 43.14  E-value: 1.45e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  353 QPTIAATQAPPANVPPtdiPTLQPPTQNPAIIPATPSTP---SPSATQPTMATPSPSaaqPGTATPSPSATQPGTASPSP 429
Cdd:pfam03154 169 QQQLLQPQGPPSIQVP---PGAALAPSAPPPTPSAQAVPpqgSPIAAQPAPQPQQPS---PLSLISAPSLHPQRLPSPHP 242
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
gi 148658623  430 GVTDTIAPAVTATPGASPATLIATPTRTPIPLTPLTRTPTP 470
Cdd:pfam03154 243 PLQPQTASQQSPQPPAPSSRHPQSSHHGPGPPMPHALQQGP 283
DedD COG3147
Uncharacterized protein conserved in bacteria [Function unknown]
333-445 1.49e-04

Uncharacterized protein conserved in bacteria [Function unknown]


Pssm-ID: 225689 [Multi-domain]  Cd Length: 226  Bit Score: 41.80  E-value: 1.49e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 333 FVAYPSVLAPGPANLAPAE---PQPTIAATQAPPANVPPTDIPTLQP--PTQNPAIIPATPSTPSPsaTQPTMATPSPSA 407
Cdd:COG3147   38 VAAIPLPPKPQGDRDEPRVlpaVVQVVALPTQPPEGVAQEIQDAGDAaaASVDPQPVAQPPVESTP--AGVPVAAQTPKP 115
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 148658623 408 AQPgtATPSPSATQPGTASPSPGVTDTIAPAVTATPGA 445
Cdd:COG3147  116 VKP--PKQPPAGAVPAKPTPKPEPKPVAEPAAAPTGQA 151
PRK05641 PRK05641
putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated
370-417 1.56e-04

putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated


Pssm-ID: 235540 [Multi-domain]  Cd Length: 153  Bit Score: 40.62  E-value: 1.56e-04
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*....
gi 148658623 370 DIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTAT-PSP 417
Cdd:PRK05641  44 DLSAVQEQVPTPAPAPAPAVPSAPTPVAPAAPAPAPASAGENVVTaPMP 92
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
320-447 1.57e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 42.78  E-value: 1.57e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 320 ATALFAGLVAVTLFVAYPSVLAPGPANLAPAEPQPTIAATQA---PPANVPPTDIPTlqPPTQNPAIIPATPSTPSPSAT 396
Cdd:PRK14951 367 AAAAEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAaaaSAPAAPPAAAPP--APVAAPAAAAPAAAPAAAPAA 444
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 148658623 397 QPtMATPSPSAAQPGTATPsPSATQPGTASPSPGVTDTIAPAVTATPGASP 447
Cdd:PRK14951 445 VA-LAPAPPAQAAPETVAI-PVRVAPEPAVASAAPAPAAAPAAARLTPTEE 493
kgd PRK12270
alpha-ketoglutarate decarboxylase; Reviewed
348-429 1.66e-04

alpha-ketoglutarate decarboxylase; Reviewed


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 42.96  E-value: 1.66e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  348 APAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPGTASP 427
Cdd:PRK12270   38 PGSTAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAAPPAAAAAAAPAAAAVEDEV 117

                  ..
gi 148658623  428 SP 429
Cdd:PRK12270  118 TP 119
PRK14971 PRK14971
DNA polymerase III subunits gamma and tau; Provisional
349-446 1.75e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237874 [Multi-domain]  Cd Length: 614  Bit Score: 42.46  E-value: 1.75e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 349 PAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPsPSATQPTMATPSPSAAQPGTATPSPSATQPGTASPS 428
Cdd:PRK14971 372 GRGPKQHIKPVFTQPAAAPQPSAAAAASPSPSQSSAAAQPSAP-QSATQPAGTPPTVSVDPPAAVPVNPPSTAPQAVRPA 450
                         90
                 ....*....|....*....
gi 148658623 429 PG-VTDTIAPAVTATPGAS 446
Cdd:PRK14971 451 QFkEEKKIPVSKVSSLGPS 469
PLN03209 PLN03209
translocon at the inner envelope of chloroplast subunit 62; Provisional
342-463 1.76e-04

translocon at the inner envelope of chloroplast subunit 62; Provisional


Pssm-ID: 178748 [Multi-domain]  Cd Length: 576  Bit Score: 42.61  E-value: 1.76e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 342 PGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSA-- 419
Cdd:PLN03209 339 PKPVPTKPVTPEAPSPPIEEEPPQPKAVVPRPLSPYTAYEDLKPPTSPIPTPPSSSPASSKSVDAVAKPAEPDVVPSPgs 418
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 420 ------TQPGTA---------------------SPSP------GVTDTIAPAVTATPGASPATLI----ATPTRTPIPLT 462
Cdd:PLN03209 419 asnvpeVEPAQVeakktrplspyaryedlkpptSPSPtaptgvSPSVSSTSSVPAVPDTAPATAAtdaaAPPPANMRPLS 498

                 .
gi 148658623 463 P 463
Cdd:PLN03209 499 P 499
FAP pfam07174
Fibronectin-attachment protein (FAP); This family contains bacterial fibronectin-attachment ...
304-438 1.78e-04

Fibronectin-attachment protein (FAP); This family contains bacterial fibronectin-attachment proteins (FAP). Family members are rich in alanine and proline, are approximately 300 long, and seem to be restricted to mycobacteria. These proteins contain a fibronectin-binding motif that allows mycobacteria to bind to fibronectin in the extracellular matrix.


Pssm-ID: 254090 [Multi-domain]  Cd Length: 297  Bit Score: 41.80  E-value: 1.78e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  304 QRESVPRRMNWLGATLATALFAGLVAVTlfVAYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAI 383
Cdd:pfam07174   3 QVDPNSTRRKGLWTTLAIAAVAGASAVA--IALPATANADPAPPPPPPSTAAAAPAPAAPPPPPPPAAPPAPQPDDPNAA 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 148658623  384 IPATPSTPSpsatqptmaTPSPSAAQPGTatPSPSATQPGTASPSPGVTDTIAPA 438
Cdd:pfam07174  81 PPPPPADPN---------APPPPPVDPNA--PPPPAPEPGRIDNAVGGFSYVVPA 124
PRK11907 PRK11907
bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase ...
355-454 2.03e-04

bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed


Pssm-ID: 237019 [Multi-domain]  Cd Length: 814  Bit Score: 42.53  E-value: 2.03e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 355 TIAATQAPPANVPPTDiPTLQPPTQNPAIIPATPSTPSPsATQPTMATPSPSAAQPGTATPSPSATqpgTASPSPGVTDT 434
Cdd:PRK11907  14 TLALLTASNPKLAQAE-EIVTTTPATSTEAEQTTPVESD-ATEEADNTETPVAATTAAEAPSSSET---AETSDPTSEAT 88
                         90       100
                 ....*....|....*....|
gi 148658623 435 IAPAVTATPGASPATLIATP 454
Cdd:PRK11907  89 DTTTSEARTVTPAATETSKP 108
Med3 pfam11593
Mediator complex subunit 3 fungal; Mediator is a large complex of up to 33 proteins that is ...
375-447 2.04e-04

Mediator complex subunit 3 fungal; Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function. Mediator subunit Hrs1/Med3 is a physical target for Cyc8-Tup1, a yeast transcriptional co-repressor.


Pssm-ID: 256520 [Multi-domain]  Cd Length: 381  Bit Score: 41.93  E-value: 2.04e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 148658623  375 QPPTQNPAIIPATPSTPSPSATQPTmATPSPSAAqPGTATPSPSATQPGTASPSPGVTDTIAPAVTATPGASP 447
Cdd:pfam11593 121 QLGNAGASASITKTSNGSDAATTSS-TANTPAAA-KVLKANAASAPNTTTGVGSAATTAAISATTATTPTTTQ 191
DUF605 pfam04652
Vta1 like; Vta1 (VPS20-associated protein 1) is a positive regulator of Vps4. Vps4 is an ...
340-463 2.32e-04

Vta1 like; Vta1 (VPS20-associated protein 1) is a positive regulator of Vps4. Vps4 is an ATPase that is required in the multivesicular body (MVB) sorting pathway to dissociate the endosomal sorting complex required for transport (ESCRT). Vta1 promotes correct assembly of Vps4 and stimulates its ATPase activity through its conserved Vta1/SBP1/LIP5 region.


Pssm-ID: 252721 [Multi-domain]  Cd Length: 312  Bit Score: 41.59  E-value: 2.32e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  340 LAPGPANLAPAEPQPTIAATQAPPANVPPTdiPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSA 419
Cdd:pfam04652 162 LANLDPSFFGEDAGPASASPSDPPSSSPGE--PSFPSPPEGPDSPSDSSLPPAPSSFQSDTPPSSPEEPTNPSPPPSPFA 239
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....
gi 148658623  420 tqpgtasPSPGVTDTIAPAVTATPGASPATLiATPTRTPIPLTP 463
Cdd:pfam04652 240 -------PSPPPQQQVPPLSTAKPSPPHTSA-TPAPIGPITPDD 275
DUF605 pfam04652
Vta1 like; Vta1 (VPS20-associated protein 1) is a positive regulator of Vps4. Vps4 is an ...
334-445 2.38e-04

Vta1 like; Vta1 (VPS20-associated protein 1) is a positive regulator of Vps4. Vps4 is an ATPase that is required in the multivesicular body (MVB) sorting pathway to dissociate the endosomal sorting complex required for transport (ESCRT). Vta1 promotes correct assembly of Vps4 and stimulates its ATPase activity through its conserved Vta1/SBP1/LIP5 region.


Pssm-ID: 252721 [Multi-domain]  Cd Length: 312  Bit Score: 41.59  E-value: 2.38e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  334 VAYPSVLAPGPANLAPAEPQPTiAATQAPPA--NVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPG 411
Cdd:pfam04652 158 DEDALANLDPSFFGEDAGPASA-SPSDPPSSspGEPSFPSPPEGPDSPSDSSLPPAPSSFQSDTPPSSPEEPTNPSPPPS 236
                          90       100       110
                  ....*....|....*....|....*....|....
gi 148658623  412 TATPSPSATQPGTASPSPGVTDTIAPAVTATPGA 445
Cdd:pfam04652 237 PFAPSPPPQQQVPPLSTAKPSPPHTSATPAPIGP 270
Retinal pfam15449
Retinal protein; This family of proteins is found in the photoreceptor cells of the retina. ...
344-448 2.70e-04

Retinal protein; This family of proteins is found in the photoreceptor cells of the retina. Mutations of the gene encoding this protein have been associated with retinal disorders such as retinitis pigmentosa and late-onset progressive retinal atrophy. The function of this family of proteins is unknown, but it is likely to be important in the development and function of the retina.


Pssm-ID: 259580 [Multi-domain]  Cd Length: 1286  Bit Score: 42.11  E-value: 2.70e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623   344 PANLAPAepQPTIAATQAPPAnvPPTDIPTLQPPTqnpaiiPATPSTPSPSATQPTMATPSPSAAQpgtATPSPSATQPG 423
Cdd:pfam15449 1035 PSSHRPA--QPSLPSVQGSPS--PPLSPRTLSPPT------RKKRTSPPPQHKLPSPPPQSPPAQH---KLSSPPTQRTE 1101
                           90       100
                   ....*....|....*....|....*
gi 148658623   424 TASPSPGvtdtiapaVTATPGASPA 448
Cdd:pfam15449 1102 ASSPSSG--------PSPSPPVSPS 1118
PRK14948 PRK14948
DNA polymerase III subunits gamma and tau; Provisional
344-418 2.71e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237862 [Multi-domain]  Cd Length: 620  Bit Score: 41.87  E-value: 2.71e-04
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 148658623 344 PANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAiiPATPSTPSPSATQPTMATPSPSAAQPGTATPSPS 418
Cdd:PRK14948 367 EIANASAPANPTPAPNPSPPPAPIQPSAPKTKQAATTPS--PPPAKASPPIPVPAEPTEPSPTPPANAANAPPSL 439
PLN03145 PLN03145
Protein phosphatase 2c; Provisional
94-134 2.74e-04

Protein phosphatase 2c; Provisional


Pssm-ID: 215603 [Multi-domain]  Cd Length: 365  Bit Score: 41.44  E-value: 2.74e-04
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|.
gi 148658623  94 AMGTTGVAALFYQGMLHVANVGDSRAYLIRNDEICQVSRDH 134
Cdd:PLN03145 165 ASGTTALAALVVGRSLVVANAGDCRAVLCRRGKAIEMSRDH 205
PLN03209 PLN03209
translocon at the inner envelope of chloroplast subunit 62; Provisional
337-468 3.12e-04

translocon at the inner envelope of chloroplast subunit 62; Provisional


Pssm-ID: 178748 [Multi-domain]  Cd Length: 576  Bit Score: 41.84  E-value: 3.12e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 337 PSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAiiPATPSTPSPSATQPTMATPSPSAAQPGTATPS 416
Cdd:PLN03209 324 PSQRVPPKESDAADGPKPVPTKPVTPEAPSPPIEEEPPQPKAVVPR--PLSPYTAYEDLKPPTSPIPTPPSSSPASSKSV 401
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 148658623 417 PSATQPGTASPSPGVTDTIAPAVTATpgaspatlIATPTRTPIPLTPLTRTP 468
Cdd:PLN03209 402 DAVAKPAEPDVVPSPGSASNVPEVEP--------AQVEAKKTRPLSPYARYE 445
PHA03291 PHA03291
envelope glycoprotein I; Provisional
348-453 3.17e-04

envelope glycoprotein I; Provisional


Pssm-ID: 223033 [Multi-domain]  Cd Length: 401  Bit Score: 41.48  E-value: 3.17e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 348 APAEPQPTIAATQAPPANVPptdIPTLQPPTQNPAIIPATPSTPsPSATQPTMATPSPSAAQPGTATPSPSATQPGT-AS 426
Cdd:PHA03291 184 GSCDPALPLSAPRLGPADVF---VPATPRPTPRTTASPETTPTP-STTTSPPSTTIPAPSTTIAAPQAGTTPEAEGTpAP 259
                         90       100
                 ....*....|....*....|....*..
gi 148658623 427 PSPGVTDTIAPAVTATPGASPATLIAT 453
Cdd:PHA03291 260 PTPGGGEAPPANATPAPEASRYELTVT 286
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
347-470 3.19e-04

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralizing antibodies in vivo.


Pssm-ID: 253014 [Multi-domain]  Cd Length: 830  Bit Score: 41.69  E-value: 3.19e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  347 LAPAEPQPTIA---ATQAPPANVPPT---DIPTLQPPTqnpaiipATPSTPSPSATQPTMAT--PSPSAAQPGTATPSPS 418
Cdd:pfam05109 438 LVHVEPHKTTAvptTPSLPPASTGPTvstADPTSGTPT-------GTTSSTLPEDTSPTSRTtsATPNATSPTPAVTTPN 510
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 148658623  419 ATQPGTASPSPGVTDTiapavtatpgaSPATLIATPTRTpIPLTPLTRTPTP 470
Cdd:pfam05109 511 ATSPTTQKTSDTPNAT-----------SPTPIVIGVTTT-ATSPPTGTTSVP 550
PHA03291 PHA03291
envelope glycoprotein I; Provisional
363-470 3.23e-04

envelope glycoprotein I; Provisional


Pssm-ID: 223033 [Multi-domain]  Cd Length: 401  Bit Score: 41.48  E-value: 3.23e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 363 PANVPPTDIPTLQPPTQ---NPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPGTASPSPGVTDTIAPAV 439
Cdd:PHA03291 167 PAEGTLAAPPLGEGSADgscDPALPLSAPRLGPADVFVPATPRPTPRTTASPETTPTPSTTTSPPSTTIPAPSTTIAAPQ 246
                         90       100       110
                 ....*....|....*....|....*....|.
gi 148658623 440 TATPGASPATlIATPTRTPIPLTPLTRTPTP 470
Cdd:PHA03291 247 AGTTPEAEGT-PAPPTPGGGEAPPANATPAP 276
PRK03427 PRK03427
cell division protein ZipA; Provisional
341-447 3.42e-04

cell division protein ZipA; Provisional


Pssm-ID: 235124 [Multi-domain]  Cd Length: 333  Bit Score: 41.17  E-value: 3.42e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 341 APGPANLAPAEP-----QPTIAATQAPPANVPPTDIPtlQPPTQNPAIIPATPSTPSPSATQPTMATPSpSAAQPGTATP 415
Cdd:PRK03427  83 AARPSPQHQYQPpyasaQPRQPVQQPPEAQVPPQHAP--RPAQPAPQPVQQPAYQPQPEQPLQQPVSPQ-VAPAPQPVHS 159
                         90       100       110
                 ....*....|....*....|....*....|..
gi 148658623 416 SPSATQPGTASPSPGVTDTIAPAVTATPGASP 447
Cdd:PRK03427 160 APQPAQQAFQPAEPVAAPQPEPVAEPAPVMDK 191
PAT1 pfam09770
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ...
337-430 3.49e-04

Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division.


Pssm-ID: 255543 [Multi-domain]  Cd Length: 806  Bit Score: 41.69  E-value: 3.49e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  337 PSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPS--PSAAQPGTAT 414
Cdd:pfam09770 216 PQQFLPAPSQAPAQPPLPPQLPQQPPPLQQPQFPGLSQQMPPPPPQPPQQQQQPPQPQAQPPPQNQPTphPGLPQGQNAP 295
                          90
                  ....*....|....*.
gi 148658623  415 PSPSATQPGTASPSPG 430
Cdd:pfam09770 296 LPPPQQPQLLPLVQQP 311
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
286-466 3.52e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 41.79  E-value: 3.52e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 286 SPPPAAPPTAPPPPALPPQRESVPRRMNWLGATLATALFAGLVAVTLFVAyPSVLAPGPANLAPAEPQPTI--AATQAPP 363
Cdd:PRK12323 373 GPATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAA-PARRSPAPEALAAARQASARgpGGAPAPA 451
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 364 ANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQP------GTATPSPSATQPGTA------SPSPGV 431
Cdd:PRK12323 452 PAPAAAPAAAARPAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPweelppEFASPAPAQPDAAPAgwvaesIPDPAT 531
                        170       180       190
                 ....*....|....*....|....*....|....*
gi 148658623 432 TDTIAPAVTATPGASPATLiATPTRTPIPLTPLTR 466
Cdd:PRK12323 532 ADPDDAFETLAPAPAAAPA-PRAAAATEPVVAPRP 565
FtsN COG3087
Cell division protein [Cell division and chromosome partitioning]
347-456 3.75e-04

Cell division protein [Cell division and chromosome partitioning]


Pssm-ID: 225629 [Multi-domain]  Cd Length: 264  Bit Score: 40.98  E-value: 3.75e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 347 LAPAEPQPTIAATQAPPAN---VPPTDIPTLQPPTQNPAIIPaTPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPG 423
Cdd:COG3087   78 PQPTEPAAVKDAERLTPEQrqlLEQMEVDQKAQPTQLGEQPE-QARIEEQPRTQSQKAQSQATTVQTQPVKPKPRPEKPQ 156
                         90       100       110
                 ....*....|....*....|....*....|....
gi 148658623 424 TASPSP-GVTDTIAPAVTATPGASPATLIATPTR 456
Cdd:COG3087  157 PVAPAPaPEPVEKAPKAEAAPPPKPKAEDAAETR 190
PHA03379 PHA03379
EBNA-3A; Provisional
342-470 4.59e-04

EBNA-3A; Provisional


Pssm-ID: 223066 [Multi-domain]  Cd Length: 935  Bit Score: 41.58  E-value: 4.59e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 342 PGPANLAPAEP-QPTIAATQAPPANVPPTDIPTLQPPTQNPAII--PATPSTPSPSATQPTMATPSPSAAQPGTATPSPS 418
Cdd:PHA03379 445 PPPVHDLEPGPlHDQHSMAPCPVAQLPPGPLQDLEPGDQLPGVVqdGRPACAPVPAPAGPIVRPWEASLSQVPGVAFAPV 524
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 148658623 419 ATQPGTASPSPGVTDTIAPAVTATPGASPATLIATPT---RTPIPLTPLTRTPTP 470
Cdd:PHA03379 525 MPQPMPVEPVPVPTVALERPVCPAPPLIAMQGPGETSgivRVRERWRPAPWTPNP 579
DedD COG3147
Uncharacterized protein conserved in bacteria [Function unknown]
329-410 4.60e-04

Uncharacterized protein conserved in bacteria [Function unknown]


Pssm-ID: 225689 [Multi-domain]  Cd Length: 226  Bit Score: 40.26  E-value: 4.60e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 329 AVTLFVAYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAA 408
Cdd:COG3147   59 AVVQVVALPTQPPEGVAQEIQDAGDAAAASVDPQPVAQPPVESTPAGVPVAAQTPKPVKPPKQPPAGAVPAKPTPKPEPK 138

                 ..
gi 148658623 409 QP 410
Cdd:COG3147  139 PV 140
DUF1421 pfam07223
Protein of unknown function (DUF1421); This family represents a conserved region approximately ...
337-463 4.65e-04

Protein of unknown function (DUF1421); This family represents a conserved region approximately 350 residues long within a number of plant proteins of unknown function.


Pssm-ID: 254110 [Multi-domain]  Cd Length: 357  Bit Score: 40.70  E-value: 4.65e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  337 PSVLAPGPANL--APAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQ-----PTMATPSPSAAQ 409
Cdd:pfam07223 125 PSQPQPPPAQQpqAQQPQPPPQVPQQQQYQSPPQQPQYQQNPPPQAQSAPQVSGLYPEESPYQpqsypPNEPLPSSMAMQ 204
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 148658623  410 PGTATPSPSATQPGTASPSPGVTDtiaPAVTATPGASPATLIATPTRTPIPLTP 463
Cdd:pfam07223 205 PPYSGAPPSQQFYGPPQPSPYMYG---GPGGRPNSGFPSGQQPPPSQGQEGYGY 255
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
216-430 4.76e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 41.40  E-value: 4.76e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 216 RLIDLANERGGTDNITAIVAQVDELDALPAttddAEPERATVELPTTVTSATVEFPATARFPAEPAT--ERISPPPAAPP 293
Cdd:PRK12323 359 RMLAFRPGQSGGGAGPATAAAAPVAQPAPA----AAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAapARRSPAPEALA 434
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 294 TAPPPPALPPQRESVPrrmnwlgatlATALFAGLVAVTLFVAYPSVLAPGPANLAPAEPQPTIAATQAPPANVP----PT 369
Cdd:PRK12323 435 AARQASARGPGGAPAP----------APAPAAAPAAAARPAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPweelPP 504
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 148658623 370 DIPTLQPPTQNPAIIPA-TPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPGTASPSPG 430
Cdd:PRK12323 505 EFASPAPAQPDAAPAGWvAESIPDPATADPDDAFETLAPAPAAAPAPRAAAATEPVVAPRPP 566
DUF2486 pfam10667
Protein of unknown function (DUF2486); This family is made up of members from various ...
339-464 4.87e-04

Protein of unknown function (DUF2486); This family is made up of members from various Burkholderia spp. The function is unknown.


Pssm-ID: 256112 [Multi-domain]  Cd Length: 245  Bit Score: 40.28  E-value: 4.87e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  339 VLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPS-------ATQPTMATPSPSAAQPG 411
Cdd:pfam10667  46 QIVPGAEQAASAAPVHAAREATADPEFVAVEPVPTPHVPAVALPGDTDAPAEPGAAphvvaerAAAMQAPLPSALAADDP 125
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
gi 148658623  412 TATPSpSATQPGTASPSPgvtDTIAPAVTATpgaSPATLIATPTRTPIPLTPL 464
Cdd:pfam10667 126 QAPPA-GATAADAGDAAP---DATPPAAGDA---SPPAAAQAAASAAAALTDL 171
PHA03247 PHA03247
large tegument protein UL36; Provisional
255-470 4.91e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 41.46  E-value: 4.91e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  255 ATVELPTTVTSATVEFPATARFPAEPATERISPPPAAPPTAPPPPALPPQRESVPrrmnwlgatlATALFAGLVAVTLFV 334
Cdd:PHA03247 2794 SRESLPSPWDPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPP----------SLPLGGSVAPGGDVR 2863
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  335 AYPSVLAPGPANLAPAEP------QPTIAATQAPPANVPPTDIPTLQPPTQNpaiiPATPSTPSPSATQPTMATPSPSAA 408
Cdd:PHA03247 2864 RRPPSRSPAAKPAAPARPpvrrlaRPAVSRSTESFALPPDQPERPPQPQAPP----PPQPQPQPPPPPQPQPPPPPPPRP 2939
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 148658623  409 QPgtaTPSPSATQPGTASPSPGVTDTIAPAVtaTPGASPATLIATPTRTPIPLTPLTRTPTP 470
Cdd:PHA03247 2940 QP---PLAPTTDPAGAGEPSGAVPQPWLGAL--VPGRVAVPRFRVPQPAPSREAPASSTPPL 2996
PLN03209 PLN03209
translocon at the inner envelope of chloroplast subunit 62; Provisional
362-470 5.15e-04

translocon at the inner envelope of chloroplast subunit 62; Provisional


Pssm-ID: 178748 [Multi-domain]  Cd Length: 576  Bit Score: 41.07  E-value: 5.15e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 362 PPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTmATPSPSAAQPGTATPSPSATQPGTaSPSPGVTDTIAPAvTA 441
Cdd:PLN03209 449 PPTSPSPTAPTGVSPSVSSTSSVPAVPDTAPATAATDA-AAPPPANMRPLSPYAVYDDLKPPT-SPSPAAPVGKVAP-SS 525
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 148658623 442 TPGASPATLIATPTRT----------PIPLTPLTR--------TPTP 470
Cdd:PLN03209 526 TNEVVKVGNSAPPTALadeqhhaqpkPRPLSPYTMyedlkpptSPTP 572
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
342-470 5.21e-04

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralizing antibodies in vivo.


Pssm-ID: 253014 [Multi-domain]  Cd Length: 830  Bit Score: 41.30  E-value: 5.21e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  342 PGPANLAPAEPQPTIAA---TQAPPANVPPTDIPTLQPPTqnpaiipATPSTPSPSATQPTMATPSPSAAQP--GTATPS 416
Cdd:pfam05109 450 PTTPSLPPASTGPTVSTadpTSGTPTGTTSSTLPEDTSPT-------SRTTSATPNATSPTPAVTTPNATSPttQKTSDT 522
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 148658623  417 PSATQPGTASPSPGVTDTIAPAVTATPGA---------SPATLIATPTRTPIPlTPLTRTPTP 470
Cdd:pfam05109 523 PNATSPTPIVIGVTTTATSPPTGTTSVPNatspqvteeSPVNNTNTPVVTSAP-SVLTSAVTT 584
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
335-460 5.23e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 41.01  E-value: 5.23e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 335 AYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTAT 414
Cdd:PRK12323 372 AGPATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGPGGAPAPA 451
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 148658623 415 PSPSAT-QPGTASPSPGVTDTIAPAVTATPGASPATLIATPTRTPIP 460
Cdd:PRK12323 452 PAPAAApAAAARPAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPP 498
PRK14948 PRK14948
DNA polymerase III subunits gamma and tau; Provisional
347-426 6.16e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237862 [Multi-domain]  Cd Length: 620  Bit Score: 40.72  E-value: 6.16e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 347 LAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPGTAS 426
Cdd:PRK14948 360 LPSAFISEIANASAPANPTPAPNPSPPPAPIQPSAPKTKQAATTPSPPPAKASPPIPVPAEPTEPSPTPPANAANAPPSL 439
DUF4045 pfam13254
Domain of unknown function (DUF4045); This presumed domain is functionally uncharacterized. ...
362-470 6.34e-04

Domain of unknown function (DUF4045); This presumed domain is functionally uncharacterized. This domain family is found in bacteria and eukaryotes, and is typically between 384 and 430 amino acids in length.


Pssm-ID: 257608 [Multi-domain]  Cd Length: 414  Bit Score: 40.60  E-value: 6.34e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  362 PPANVPPTDIPTLQPPTQNPAI--IPATPSTPSPSATQP--TMATPSPSAAQPGTATPSPSATQPGTASPSPGVTDTiaP 437
Cdd:pfam13254 200 EVTPVGLMRTPPPGSHSKSPSKsgIPDLPSSRDSEKTKPekPQQETSSMDTEKSSAPKPRETLDPKSPEKAPPIDTT--E 277
                          90       100       110
                  ....*....|....*....|....*....|....*
gi 148658623  438 AVTATPGASPAT--LIATPTRTPIPLTPLTRTPTP 470
Cdd:pfam13254 278 EELKSPEASPKEseEASARKRSPSLLSPSPKAESP 312
PRK10905 PRK10905
cell division protein DamX; Validated
349-430 6.35e-04

cell division protein DamX; Validated


Pssm-ID: 236792 [Multi-domain]  Cd Length: 328  Bit Score: 40.31  E-value: 6.35e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 349 PAEPQPTIAATQAPPAnVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPGTASPS 428
Cdd:PRK10905 165 PKKPQATAKTEPKPVA-QTPKRTEPAAPVASTKAPAATSTPAPKETATTAPVQTASPAQTTATPAAGGKTAGNVGSLKSA 243

                 ..
gi 148658623 429 PG 430
Cdd:PRK10905 244 PS 245
PRK14971 PRK14971
DNA polymerase III subunits gamma and tau; Provisional
338-442 6.36e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237874 [Multi-domain]  Cd Length: 614  Bit Score: 40.91  E-value: 6.36e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 338 SVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAiiPATPSTPSPSATQPTMATPSPSAAQPGTATPSP 417
Cdd:PRK14971 386 PAAAPQPSAAAAASPSPSQSSAAAQPSAPQSATQPAGTPPTVSVD--PPAAVPVNPPSTAPQAVRPAQFKEEKKIPVSKV 463
                         90       100
                 ....*....|....*....|....*....
gi 148658623 418 SATQPGTASP----SPGVTDTIAPAVTAT 442
Cdd:PRK14971 464 SSLGPSTLRPiqekAEQATGNIKEAPTGT 492
PLN02983 PLN02983
biotin carboxyl carrier protein of acetyl-CoA carboxylase
375-463 6.51e-04

biotin carboxyl carrier protein of acetyl-CoA carboxylase


Pssm-ID: 215533 [Multi-domain]  Cd Length: 274  Bit Score: 40.21  E-value: 6.51e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 375 QPPtqnpaiiPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATqPGTASPSPgvtdTIAPAVTATPGASPatLIATP 454
Cdd:PLN02983 143 QPP-------PPAPVVMMQPPPPHAMPPASPPAAQPAPSAPASSPP-PTPASPPP----AKAPKSSHPPLKSP--MAGTF 208

                 ....*....
gi 148658623 455 TRTPIPLTP 463
Cdd:PLN02983 209 YRSPAPGEP 217
flhF PRK06995
flagellar biosynthesis regulator FlhF; Validated
334-442 6.74e-04

flagellar biosynthesis regulator FlhF; Validated


Pssm-ID: 235904 [Multi-domain]  Cd Length: 484  Bit Score: 40.72  E-value: 6.74e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 334 VAYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDI--------PTLQPPTQNPAIIPATPSTPSPSATQPTMATPSP 405
Cdd:PRK06995  51 LAPPAAAAPAAAQPPPAAAPAAVSRPAAPAAEPAPWLVehakrltaQREQLVARAAAPAAPEAQAPAAPAERAAAENAAR 130
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 148658623 406 SAAQPGTATPSPSATQPGTASPSPGVTDTIAPAVTAT 442
Cdd:PRK06995 131 RLARAAAAAPRPRVPADAAAAVADAVKARIERIVNDT 167
PRK10118 PRK10118
flagellar hook-length control protein; Provisional
353-470 7.67e-04

flagellar hook-length control protein; Provisional


Pssm-ID: 236652 [Multi-domain]  Cd Length: 408  Bit Score: 40.23  E-value: 7.67e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 353 QPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPsPSAAQPGTATPSPsatqpgtASPSPGVT 432
Cdd:PRK10118 153 QDNTTPVADAPSTVLPAEKPTLLTKDMPSAPQDETHTLSSDEHEKGLTSAQ-LTTAQPDDAPGTP-------AQPLTPLA 224
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 148658623 433 DTIAPAVTATPGASPATLIATPTRTPIPLTPLTRTPTP 470
Cdd:PRK10118 225 AEAQAKAEVISTPSPVTAAASPTITPHQTQPLPTAAAP 262
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
161-238 7.76e-04

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 40.08  E-value: 7.76e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 161 TRALGYQSEVQVDLFHLPLQAGDMVILCSDGLH-------GLVGDEEICEIVRSM---PLADAVD----RLIDLANERGG 226
Cdd:COG2208  275 GLPIGLLPDYQYEVASLQLEPGDLLVLYTDGVTearnsdgEFFGLERLLKILGRLlgqPAEEILEaileSLEELQGDQIQ 354
                         90
                 ....*....|..
gi 148658623 227 TDNITAIVAQVD 238
Cdd:COG2208  355 DDDITLLVLKVK 366
PLN02983 PLN02983
biotin carboxyl carrier protein of acetyl-CoA carboxylase
356-430 8.65e-04

biotin carboxyl carrier protein of acetyl-CoA carboxylase


Pssm-ID: 215533 [Multi-domain]  Cd Length: 274  Bit Score: 39.82  E-value: 8.65e-04
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 148658623 356 IAATQAPPANVPPTDIPTLQPPTQnPAIIPATPSTPSPSATQPTmATPSPSAAQPgTATPSPSATQPGTASPSPG 430
Cdd:PLN02983 135 IRKKEALPQPPPPAPVVMMQPPPP-HAMPPASPPAAQPAPSAPA-SSPPPTPASP-PPAKAPKSSHPPLKSPMAG 206
PRK14971 PRK14971
DNA polymerase III subunits gamma and tau; Provisional
344-429 8.91e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237874 [Multi-domain]  Cd Length: 614  Bit Score: 40.14  E-value: 8.91e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 344 PANLAPAEPQPTIAATQAPPAnvPPTDIPTLQPPTQNPAiipatpSTPSPSATQPTMATPSPSAAQPgTATPSPSATQPG 423
Cdd:PRK14971 381 PVFTQPAAAPQPSAAAAASPS--PSQSSAAAQPSAPQSA------TQPAGTPPTVSVDPPAAVPVNP-PSTAPQAVRPAQ 451

                 ....*.
gi 148658623 424 TASPSP 429
Cdd:PRK14971 452 FKEEKK 457
SLAIN pfam15301
SLAIN motif-containing family; The SLAIN motif containing family is named after the presence ...
368-460 9.50e-04

SLAIN motif-containing family; The SLAIN motif containing family is named after the presence of a SLAIN motif in SLAIN1. They are a family of microtubule plus-end tracking proteins.


Pssm-ID: 259434 [Multi-domain]  Cd Length: 347  Bit Score: 39.91  E-value: 9.50e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  368 PTDIPTLQPPTQNPAIIPATPSTPS--PSATQPTMATPSPSAAQpGTATPSPSATQPGTASPSPGVTDTIAPAVTATPGA 445
Cdd:pfam15301 236 QSSISTLQSRVKSVGHSPLSLRQPLkaTAYVSPTIQGTASTTLQ-SIPQSSPSASSKPTATATPARSALPRPSTFGGGSP 314
                          90
                  ....*....|....*
gi 148658623  446 SPATLIATPTRTPIP 460
Cdd:pfam15301 315 VPRSKLAQPVRSSLP 329
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
342-469 1.00e-03

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 251763 [Multi-domain]  Cd Length: 979  Bit Score: 40.44  E-value: 1.00e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  342 PGPANLAPAEPqPTIAATQAPP---ANVPPTDIPTL--QPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPS 416
Cdd:pfam03154 412 SQPLQSVPAQP-PVLTQSQSLPpkaSTHPHSGLHSGppQSPFAQHPFTSGGLPAIGPPPSLPTSTPAAPPRASSGSQPPG 490
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
gi 148658623  417 PSATQPGTASPSPGVTDTIAPAVTATPGASPATLIATPTRTPIPLTPLTRTPT 469
Cdd:pfam03154 491 SALPSSGGCAGPGPPLPPIQIKEEPLDEAEEPESPPPPPRSPSPEPTVVNTPS 543
PTZ00395 PTZ00395
Sec24-related protein; Provisional
342-458 1.04e-03

Sec24-related protein; Provisional


Pssm-ID: 185594 [Multi-domain]  Cd Length: 1560  Bit Score: 40.44  E-value: 1.04e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  342 PGPANLAPAEPQPTIAATQAPP-ANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPG---TATPSP 417
Cdd:PTZ00395  417 PGNSNPGYNNAPNSNTPYNNPPnSNTPYSNPPNSNPPYSNLPYSNTPYSNAPLSNAPPSSAKDHHSAYHAAyqhRAANQP 496
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*..
gi 148658623  418 SATQPGTASPSP-----GVTDTIAPAVTATP-GASPATLIATPTRTP 458
Cdd:PTZ00395  497 AANLPTANQPAAnnfhgAAGNSVGNPFASRPfGSAPYGGNAATTADP 543
Hamartin pfam04388
Hamartin protein; This family includes the hamartin protein which is thought to function as a ...
381-450 1.04e-03

Hamartin protein; This family includes the hamartin protein which is thought to function as a tumor suppressor. The hamartin protein interacts with the tuberin protein pfam03542. Tuberous sclerosis complex (TSC) is an autosomal dominant disorder and is characterized by the presence of hamartomas in many organs, such as brain, skin, heart, lung, and kidney. It is caused by mutation either TSC1 or TSC2 tumor suppressor gene. TSC1 encodes a protein, hamartin, containing two coiled-coil regions, which have been shown to mediate binding to tuberin. The TSC2 gene codes for tuberin pfam03542. These two proteins function within the same pathway(s) regulating cell cycle, cell growth, adhesion, and vesicular trafficking.


Pssm-ID: 252560 [Multi-domain]  Cd Length: 667  Bit Score: 40.34  E-value: 1.04e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  381 PAIIPATPSTPSPSATQPTMATPSPSAAQPGtaTPSPSATqPGTASPSPGVTDTIAPAVTATPGASPATL 450
Cdd:pfam04388 345 PSSIGMSPLILSLSPSHLSGRAPGTTGSGKG--EPASEST-PSTSPPPPGLADDIVRAIFATSSRSAPRK 411
PRK14948 PRK14948
DNA polymerase III subunits gamma and tau; Provisional
350-429 1.08e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237862 [Multi-domain]  Cd Length: 620  Bit Score: 39.95  E-value: 1.08e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 350 AEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSAtqPTMATPSPSAAQPGTATPSPSATQPGTASPSP 429
Cdd:PRK14948 361 PSAFISEIANASAPANPTPAPNPSPPPAPIQPSAPKTKQAATTPSP--PPAKASPPIPVPAEPTEPSPTPPANAANAPPS 438
APC_basic pfam05956
APC basic domain; This region of the APC family of proteins is known as the basic domain. It ...
342-457 1.18e-03

APC basic domain; This region of the APC family of proteins is known as the basic domain. It contains a high proportion of positively charged amino acids and interacts with microtubules.


Pssm-ID: 253475 [Multi-domain]  Cd Length: 359  Bit Score: 39.73  E-value: 1.18e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  342 PGPANLApaepQPTIAATQAPPANVPPTDIPTLQPPTQN-------PAIIP--ATPSTPSPSATQPTMATPSPSAAQPGT 412
Cdd:pfam05956  12 PGPANRS----QSTTPSKKGPPLKTQPSDPPKSPSPGQQrsrslhrPAKPSelAELSPPPRSATPPARLAKTPSSSSSQT 87
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 148658623  413 ATPSPSATQPGTASPSPGVTDTIAPAVTATPGASPATliATPTRT 457
Cdd:pfam05956  88 STPSQPLPRPLPRPTQSAGRNSILPGPGNSLSQVPRT--SSPARA 130
PRK03427 PRK03427
cell division protein ZipA; Provisional
334-422 1.19e-03

cell division protein ZipA; Provisional


Pssm-ID: 235124 [Multi-domain]  Cd Length: 333  Bit Score: 39.63  E-value: 1.19e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 334 VAYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDipTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPG-- 411
Cdd:PRK03427 104 PVQQPPEAQVPPQHAPRPAQPAPQPVQQPAYQPQPEQ--PLQQPVSPQVAPAPQPVHSAPQPAQQAFQPAEPVAAPQPep 181
                         90
                 ....*....|.
gi 148658623 412 TATPSPSATQP 422
Cdd:PRK03427 182 VAEPAPVMDKP 192
PRK12727 PRK12727
flagellar biosynthesis regulator FlhF; Provisional
347-470 1.23e-03

flagellar biosynthesis regulator FlhF; Provisional


Pssm-ID: 237182 [Multi-domain]  Cd Length: 559  Bit Score: 39.97  E-value: 1.23e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 347 LAPAEPQPTIAATQAPPANVPPTDIPT-LQPPTQNPAIIPATPSTPSPSA----------TQPTMATPSPSAAQPGTATP 415
Cdd:PRK12727  55 LETARSDTPATAAAPAPAPQAPTKPAApVHAPLKLSANANMSQRQRVASAaedmiaamalRQPVSVPRQAPAAAPVRAAS 134
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 148658623 416 SPSatqPGTASPSPGVTDTIAPAVTATPGASPATLIA-TPTRTPIPLTPLTRTPTP 470
Cdd:PRK12727 135 IPS---PAAQALAHAAAVRTAPRQEHALSAVPEQLFAdFLTTAPVPRAPVQAPVVA 187
PRK08691 PRK08691
DNA polymerase III subunits gamma and tau; Validated
339-463 1.24e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236333 [Multi-domain]  Cd Length: 709  Bit Score: 40.08  E-value: 1.24e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 339 VLAPGPANLAPAEPQPTIAAT--QAPPANVPPTDIPTLQP-PTQNPAIIPATPSTPSPSATQPTMATPSPSAAQ------ 409
Cdd:PRK08691 355 MLAFAPLAAASCDANAVIENTelQSPSAQTAEKETAAKKPqPRPEAETAQTPVQTASAAAMPSEGKTAGPVSNQenndvp 434
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 148658623 410 PGTATPSPSATQPGTASPSPGVTDTIAPAVTATP----------GASPATLIATPTRTPIPLTP 463
Cdd:PRK08691 435 PWEDAPDEAQTAAGTAQTSAKSIQTASEAETPPEnqvsknkaadNETDAPLSEVPSENPIQATP 498
PHA03369 PHA03369
capsid maturational protease; Provisional
310-446 1.25e-03

capsid maturational protease; Provisional


Pssm-ID: 223061 [Multi-domain]  Cd Length: 663  Bit Score: 39.98  E-value: 1.25e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 310 RRMNWLGATLATALFAGLVAVTlfvaypSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDiPTLQPPTQNPAIIPATPS 389
Cdd:PHA03369 336 STINGLKAHNEILKTASLTAPS------RVLAAAAKVAVIAAPQTHTGPADRQRPQRPDGI-PYSVPARSPMTAYPPVPQ 408
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 148658623 390 TPS-PSATQPTMATPSPSAAQPGTATPSPSatQPGTASPSPGVTDTIAPAVTATPGAS 446
Cdd:PHA03369 409 FCGdPGLVSPYNPQSPGTSYGPEPVGPVPP--QPTNPYVMPISMANMVYPGHPQEHGH 464
DUF1421 pfam07223
Protein of unknown function (DUF1421); This family represents a conserved region approximately ...
337-455 1.28e-03

Protein of unknown function (DUF1421); This family represents a conserved region approximately 350 residues long within a number of plant proteins of unknown function.


Pssm-ID: 254110 [Multi-domain]  Cd Length: 357  Bit Score: 39.54  E-value: 1.28e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  337 PSVLAPGPANLAPAEPQPTiaatQAPPANVPPTD-IPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPsaAQPgtatP 415
Cdd:pfam07223  67 QQVNAALPPAPAPQSPQPD----QQQQSQAPPSHqYPSQLPPQQVQSVPQQPTPQQEPYYPPPSQPQPPP--AQQ----P 136
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 148658623  416 SPSATQPGTASPSPGVTDTIAPAVTATPGASPATLIATPT 455
Cdd:pfam07223 137 QAQQPQPPPQVPQQQQYQSPPQQPQYQQNPPPQAQSAPQV 176
tatB PRK00404
sec-independent translocase; Provisional
347-410 1.37e-03

sec-independent translocase; Provisional


Pssm-ID: 166942 [Multi-domain]  Cd Length: 141  Bit Score: 37.89  E-value: 1.37e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 148658623 347 LAPAEPQPTiaatqAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQP 410
Cdd:PRK00404  79 LAPLTPPAP-----PEPVTPPTAQSPAPAVPTPPPTSTPAVPPAPAAAVPAPAAAPPPSDPPQP 137
Caprin-1_C pfam12287
Cytoplasmic activation/proliferation-associated protein-1 C term; This family of proteins is ...
377-470 1.38e-03

Cytoplasmic activation/proliferation-associated protein-1 C term; This family of proteins is found in eukaryotes. Proteins in this family are typically between 343 and 708 amino acids in length. This family is the C terminal region of caprin-1. Caprin-1 is a protein involved in regulating cellular proliferation. In mutated phenotypes, the G1 phase of the cell cycle is greatly lengthened, impairing normal proliferation. The C terminal region of caprin-1 contains RGG motifs which are characteristic of RNA binding domains. It is possible that caprin-1 functions through an RNA binding mechanism.


Pssm-ID: 256956 [Multi-domain]  Cd Length: 319  Bit Score: 39.19  E-value: 1.38e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  377 PTQNPAIIPATPSTPSPSATQPTMATP----SPSAAQPGTATPSPSATQPGTASPSPGVTDTIAPAV--TATPGASPATL 450
Cdd:pfam12287  17 QPLDPAIVSAQPMKPAQSMDLPQMVCPpvhsESRLSQPSAVPVQPEPTQVPMVSPTSEGYTSSPPLYqpSHTAEPRPQTD 96
                          90       100
                  ....*....|....*....|
gi 148658623  451 IATPTRTPIPLTPlTRTPTP 470
Cdd:pfam12287  97 PIDPIQASMSLNS-EQTPTS 115
PRK10905 PRK10905
cell division protein DamX; Validated
354-469 1.43e-03

cell division protein DamX; Validated


Pssm-ID: 236792 [Multi-domain]  Cd Length: 328  Bit Score: 39.15  E-value: 1.43e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 354 PTIAATQAPPAN-VPPTDIPTLQPPTQNPaiipatpsTPSPSATQPTMATPSPSAAqpGTATPSPSATQPGTASPSPGVT 432
Cdd:PRK10905 124 PTEPATVAPVRNgNASRQTAKTQTAERPA--------TTRPARKQAVIEPKKPQAT--AKTEPKPVAQTPKRTEPAAPVA 193
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 148658623 433 DTIAPAVTATPgASPATLIATPTRTPIPLTPLTRTPT 469
Cdd:PRK10905 194 STKAPAATSTP-APKETATTAPVQTASPAQTTATPAA 229
MCPVI pfam02993
Minor capsid protein VI; This minor capsid protein may act as a link between the external ...
348-449 1.45e-03

Minor capsid protein VI; This minor capsid protein may act as a link between the external capsid and the internal DNA-protein core. The C-terminal 11 residues may function as a protease cofactor leading to enzyme activation.


Pssm-ID: 251663 [Multi-domain]  Cd Length: 238  Bit Score: 39.02  E-value: 1.45e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  348 APAEPQPTIAATQAPpaNVPPTDIPTLQPPTQNPAIiPATPSTPSPSATQPTMATPSPSAAQPgTATPSPSATQPGTASP 427
Cdd:pfam02993 109 VLGEEEPAPQEETVA--DPIQALQPRPRPDVEEVLV-PAAPEPPSYEETIKPGPAPVEEPVDS-MAIAVPAIDTPVTLEL 184
                          90       100
                  ....*....|....*....|..
gi 148658623  428 SPgvTDTIAPAVTATPGASPAT 449
Cdd:pfam02993 185 PP--APQPPPPVVPQPSTMVVH 204
PRK11633 PRK11633
cell division protein DedD; Provisional
393-470 1.47e-03

cell division protein DedD; Provisional


Pssm-ID: 236940 [Multi-domain]  Cd Length: 226  Bit Score: 38.83  E-value: 1.47e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 148658623 393 PSATQPTMATPSPSAAQ-PGTATPSPSATQPgTASPSPGVTDTIAPAVTATPGASPATlIATPTRTPIPLTPLTRTPTP 470
Cdd:PRK11633  57 PAATQALPTQPPEGAAEaVRAGDAAAPSLDP-ATVAPPNTPVEPEPAPVEPPKPKPVE-KPKPKPKPQQKVEAPPAPKP 133
PRK10819 PRK10819
transport protein TonB; Provisional
309-428 1.60e-03

transport protein TonB; Provisional


Pssm-ID: 236768 [Multi-domain]  Cd Length: 246  Bit Score: 38.90  E-value: 1.60e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 309 PRRMNWlGATLATALFAGLVAVTLFVAYPSVL----APGP---ANLAPAEPQPTIAATQAP-PANVP-PTDIPTLQPPTQ 379
Cdd:PRK10819   9 PRRFPW-PTLLSVGLHGAVVAGLLYTSVHQVIelpaPAQPisvTMVAPADLEPPQAVQPPPePVVEPePEPEPIPEPPKE 87
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 148658623 380 NPAIIPATPSTPSPS----------------------ATQPTMATPSPSAAQPGTATPSPSATQPGTASPS 428
Cdd:PRK10819  88 APVVIPKPEPKPKPKpkpkpkpvkkveeqpkrevkpvEPRPASPFENTAPARPTSSTATAAASKPVTSVSS 158
motB PRK12799
flagellar motor protein MotB; Reviewed
385-469 1.61e-03

flagellar motor protein MotB; Reviewed


Pssm-ID: 183756 [Multi-domain]  Cd Length: 421  Bit Score: 39.31  E-value: 1.61e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 385 PATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPGTASPSPGVT---------DTIAPAVTATPGASPATLIATPT 455
Cdd:PRK12799 300 PVAAVTPSSAVTQSSAITPSSAAIPSPAVIPSSVTTQSATTTQASAVAlssagvlpsDVTLPGTVALPAAEPVNMQPQPM 379
                         90       100
                 ....*....|....*....|.
gi 148658623 456 RTPIP-------LTPLTRTPT 469
Cdd:PRK12799 380 STTETqqsstgnITSTANGPT 400
PRK10672 PRK10672
rare lipoprotein A; Provisional
334-429 1.64e-03

rare lipoprotein A; Provisional


Pssm-ID: 236733 [Multi-domain]  Cd Length: 361  Bit Score: 39.28  E-value: 1.64e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 334 VAYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTA 413
Cdd:PRK10672 187 VAKQSYALPARPDLSGGMGTPSVQPAPAPQGDVLPVSNSTLKSEDPTGAPVTSSGFLGAPTTLAPGVLEGSEPTPTAPSS 266
                         90
                 ....*....|....*...
gi 148658623 414 TP--SPSATQPGTASPSP 429
Cdd:PRK10672 267 APatAPAAAAPQAAATSS 284
PRK11901 PRK11901
hypothetical protein; Reviewed
345-419 1.86e-03

hypothetical protein; Reviewed


Pssm-ID: 237015 [Multi-domain]  Cd Length: 327  Bit Score: 38.90  E-value: 1.86e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 148658623 345 ANLAPAEPQPTIAATQAPPANVPPTDIPTlQPPTQnpaiiPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSA 419
Cdd:PRK11901 166 NAQGNTSTLPTAPATVAPSKGAKVPATAE-THPTP-----PQKPATKKPAVNHHKTATVAVPPATSGKPKSGAAS 234
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
315-458 1.95e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 39.20  E-value: 1.95e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 315 LGATLATALFAGLVAVTLFVAYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPS 394
Cdd:PRK07764 588 VGPAPGAAGGEGPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGD 667
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 148658623 395 ATQPTMATPSPSAAQPGTA-TPSPSATQPGTASPSPGVTDTIAPAVTATPGASPATLIATPTRTP 458
Cdd:PRK07764 668 GWPAKAGGAAPAAPPPAPApAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPS 732
PHA01929 PHA01929
putative scaffolding protein
337-448 1.96e-03

putative scaffolding protein


Pssm-ID: 177328 [Multi-domain]  Cd Length: 306  Bit Score: 38.88  E-value: 1.96e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 337 PSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPtmATPSPSAAQPGTATPs 416
Cdd:PHA01929  13 AGLVANVPPAAAPTPQPNPVIQPQAPVQPGQPGAPQQLAIPTQQPQPVPTSAMTPHVVQQAP--AQPAPAAPPAAGAAL- 89
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 148658623 417 PSATQPG---TASPSPGVTDTIAPAVTATPGASPA 448
Cdd:PHA01929  90 PEALEVPpppAFTPNGEIVGTLAGNLEGDPQLAPS 124
PTZ00436 PTZ00436
60S ribosomal protein L19-like protein; Provisional
348-468 2.03e-03

60S ribosomal protein L19-like protein; Provisional


Pssm-ID: 185616 [Multi-domain]  Cd Length: 357  Bit Score: 38.78  E-value: 2.03e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 348 APAEPQPTIAATQAPPANVPPtdiptlqPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAqpgTATPSPSATQPGTASP 427
Cdd:PTZ00436 221 APAKAAAAPAKAAAPPAKAAA-------APAKAAAAPAKAAAPPAKAAAPPAKAAAPPAKA---AAPPAKAAAPPAKAAA 290
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 148658623 428 SPGVTDTiAPAVTATP----GASPATLIATPTRTPIPLTPLTRTP 468
Cdd:PTZ00436 291 PPAKAAA-APAKAAAApakaAAAPAKAAAPPAKAAAPPAKAATPP 334
PLN02217 PLN02217
probable pectinesterase/pectinesterase inhibitor
314-458 2.09e-03

probable pectinesterase/pectinesterase inhibitor


Pssm-ID: 215130 [Multi-domain]  Cd Length: 670  Bit Score: 39.30  E-value: 2.09e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 314 WLGATLATALFAGLV-------AVTLFVAYPSVLAPGPANLAPAEPQPTIAA-TQAPPANVPPtdIPTLQppTQNPAIIP 385
Cdd:PLN02217 495 WLGDFGLNTLFYSEVqntgpgaAITKRVTWPGIKKLSDEEILKFTPAQYIQGdAWIPGKGVPY--IPGLF--AGNPGSTN 570
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 386 ATPS-TPSPSATQPTMATPS----PSAAQPGTATPSPSATQPGTASP--SPGVTDTIAPAVTATPGASPATLIATPTRTP 458
Cdd:PLN02217 571 STPTgSAASSNTTFSSDSPStvvaPSTSPPAGHLGSPPATPSKIVSPstSPPASHLGSPSTTPSSPESSIKVASTETASP 650
PRK03427 PRK03427
cell division protein ZipA; Provisional
335-427 2.16e-03

cell division protein ZipA; Provisional


Pssm-ID: 235124 [Multi-domain]  Cd Length: 333  Bit Score: 38.86  E-value: 2.16e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 335 AYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTAT 414
Cdd:PRK03427  95 PYASAQPRQPVQQPPEAQVPPQHAPRPAQPAPQPVQQPAYQPQPEQPLQQPVSPQVAPAPQPVHSAPQPAQQAFQPAEPV 174
                         90
                 ....*....|...
gi 148658623 415 PSPSATQPGTASP 427
Cdd:PRK03427 175 AAPQPEPVAEPAP 187
kgd PRK12270
alpha-ketoglutarate decarboxylase; Reviewed
385-464 2.20e-03

alpha-ketoglutarate decarboxylase; Reviewed


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 39.10  E-value: 2.20e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  385 PATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPGTASPSPGVTDTIAPAVTATPGASPATLIATPTRTPIP-LTP 463
Cdd:PRK12270   40 STAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAAPPAAAAAAAPAAAAVEDeVTP 119

                  .
gi 148658623  464 L 464
Cdd:PRK12270  120 L 120
PAT1 pfam09770
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ...
340-470 2.26e-03

Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division.


Pssm-ID: 255543 [Multi-domain]  Cd Length: 806  Bit Score: 38.99  E-value: 2.26e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  340 LAPGPANLAPAEPQptiaatQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSA 419
Cdd:pfam09770 128 TAPKPEPQPPQAPE------SQPQPQTPAQKMLSLEEVEAQLQQRQQAPQLPQPPQQVLPQGMPPRQAAFPQQGPPEQPP 201
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
gi 148658623  420 --TQPGTASPSPGVTDTIAPAvtatPGASPATlIATPTRTPIPLTPLTRTPTP 470
Cdd:pfam09770 202 gyPQPPQGHPEQVQPQQFLPA----PSQAPAQ-PPLPPQLPQQPPPLQQPQFP 249
half-pint TIGR01645
poly-U binding splicing factor, half-pint family; The proteins represented by this model ...
367-470 2.54e-03

poly-U binding splicing factor, half-pint family; The proteins represented by this model contain three RNA recognition motifs (rrm: pfam00076) and have been characterized as poly-pyrimidine tract binding proteins associated with RNA splicing factors. In the case of PUF60 (GP|6176532), in complex with p54, and in the presence of U2AF, facilitates association of U2 snRNP with pre-mRNA.


Pssm-ID: 130706 [Multi-domain]  Cd Length: 612  Bit Score: 38.90  E-value: 2.54e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  367 PPTdiPTLQPPTqnPAIIPATPSTPSPSATQPTMAtpspSAAQPGTATPSPSATQPGTASPSPgVTDTIAPAVTATPGAS 446
Cdd:TIGR01645 284 PPD--ALLQPAT--VSAIPAAAAVAAAAATAKIMA----AEAVAGAAVLGPRAQSPATPSSSL-PTDIGNKAVVSSAKKE 354
                          90       100
                  ....*....|....*....|....*
gi 148658623  447 PATLIATPTRTPIPLTP-LTRTPTP 470
Cdd:TIGR01645 355 AEEVPPLPQAAPAVVKPgPMEIPTP 379
uvrC PRK14666
excinuclease ABC subunit C; Provisional
352-467 2.69e-03

excinuclease ABC subunit C; Provisional


Pssm-ID: 237782 [Multi-domain]  Cd Length: 694  Bit Score: 38.71  E-value: 2.69e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 352 PQPTIaatqaPPANVPPTDIPTLQppTQNPAIIPATPSTPSPSATQPTMATPSPSAAqpGTATPSPSATQPGTASPSPGV 431
Cdd:PRK14666 303 PQSTI-----PPRIVVPWLPDTEG--REGDDLAPTAVCTDAGLLPDTPLLPDAPEGS--SDPVVPVAAATPVDASLPDVR 373
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 148658623 432 TDTIAPAVTATPGASPATLIATPTRTPIPLTPLTRT 467
Cdd:PRK14666 374 TGTAPTSLANVSHADPAVAQPTQAATLAGAAPKGAT 409
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
244-470 2.77e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 38.68  E-value: 2.77e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 244 PATTDDAEPERATVELPTTVTSATVEFPATARFPAEPATERISPPPAAPPTAPPPPALPPQRESVPRrmnwlGATLATAL 323
Cdd:PRK07003 368 PGGGVPARVAGAVPAPGARAAAAVGASAVPAVTAVTGAAGAALAPKAAAAAAATRAEAPPAAPAPPA-----TADRGDDA 442
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 324 FAGLVAVTLFVAYPSVLAPGPANLApAEPQPTIAATQAPPANVPPTDIPTLQPP-------TQNPAIIPATPSTPSPSAT 396
Cdd:PRK07003 443 ADGDAPVPAKANARASADSRCDERD-AQPPADSGSASAPASDAPPDAAFEPAPRaaapsaaTPAAVPDARAPAAASREDA 521
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 397 QPTMATPSPSAAQPGTATPSPSATQPGTASP-----SPGVTDT----IAPAVTATPGASPAtliatPTRTPIPLTPLTRT 467
Cdd:PRK07003 522 PAAAAPPAPEARPPTPAAAAPAARAGGAAAAldvlrNAGMRVSsdrgARAAAAAKPAAAPA-----AAPKPAAPRVAVQV 596

                 ...
gi 148658623 468 PTP 470
Cdd:PRK07003 597 PTP 599
PHA02030 PHA02030
hypothetical protein
370-448 2.93e-03

hypothetical protein


Pssm-ID: 222843 [Multi-domain]  Cd Length: 336  Bit Score: 38.42  E-value: 2.93e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 370 DIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPGTASPSPGVTDTIAPAVTATP--GASP 447
Cdd:PHA02030 252 DLIIKPKSKAAGSNLPAVPNVAADAGSAAAPAVPAAAAAVAQAAPSVPQVPNVAVLPDVPQVAPVAAPAAPEVPavPVVP 331

                 .
gi 148658623 448 A 448
Cdd:PHA02030 332 A 332
motB PRK12799
flagellar motor protein MotB; Reviewed
341-455 3.05e-03

flagellar motor protein MotB; Reviewed


Pssm-ID: 183756 [Multi-domain]  Cd Length: 421  Bit Score: 38.54  E-value: 3.05e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 341 APGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPpTQNPAIipATPSTPSPSATQPTMATPSPSAAQPGTATPSPSAT 420
Cdd:PRK12799 305 TPSSAVTQSSAITPSSAAIPSPAVIPSSVTTQSATT-TQASAV--ALSSAGVLPSDVTLPGTVALPAAEPVNMQPQPMST 381
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 148658623 421 QPGTASPSPGVTDTIAPAVTATPGASPATLIATPT 455
Cdd:PRK12799 382 TETQQSSTGNITSTANGPTTSLPAAPASNIPVSPT 416
PRK11633 PRK11633
cell division protein DedD; Provisional
333-429 3.12e-03

cell division protein DedD; Provisional


Pssm-ID: 236940 [Multi-domain]  Cd Length: 226  Bit Score: 37.67  E-value: 3.12e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 333 FVAYPSVLAPG----PANLAPAEP----QP---TIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMA 401
Cdd:PRK11633  38 FAAIPLVPKPGdrdePDMMPAATQalptQPpegAAEAVRAGDAAAPSLDPATVAPPNTPVEPEPAPVEPPKPKPVEKPKP 117
                         90       100
                 ....*....|....*....|....*...
gi 148658623 402 TPSPSAAQPGTATPSPSATQPGTASPSP 429
Cdd:PRK11633 118 KPKPQQKVEAPPAPKPEPKPVVEEKAAP 145
omega_3_PfaA TIGR02813
polyketide-type polyunsaturated fatty acid synthase PfaA; Members of the seed for this ...
358-454 3.32e-03

polyketide-type polyunsaturated fatty acid synthase PfaA; Members of the seed for this alignment are involved in omega-3 polyunsaturated fatty acid biosynthesis, such as the protein PfaA from the eicosapentaenoic acid biosynthesis operon in Photobacterium profundum strain SS9. PfaA is encoded together with PfaB, PfaC, and PfaD, and the functions of the individual polypeptides have not yet been described. More distant homologs of PfaA, also included with the reach of this model, appear to be involved in polyketide-like biosynthetic mechanisms of polyunsaturated fatty acid biosynthesis, an alternative to the more familiar iterated mechanism of chain extension and desaturation, and in most cases are encoded near genes for homologs of PfaB, PfaC, and/or PfaD.


Pssm-ID: 234022 [Multi-domain]  Cd Length: 2582  Bit Score: 38.83  E-value: 3.32e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623   358 ATQAPPANVPPTDIPTLQPPTqnpAIIPATPSTPSpsATQPTMATPSPsAAQPGTATPSPSATQPGTASPspgVTDTIAP 437
Cdd:TIGR02813 1123 ATQAPVIKSVVTQAPVVQVTI---SVAPAAPVLPA--VVSPPVVSAAP-AQSVATAVAMAPVAEVPIAVP---VQQSVDY 1193
                           90
                   ....*....|....*..
gi 148658623   438 AVTATPGASPATLIATP 454
Cdd:TIGR02813 1194 MPSVAQAAAPQASVNDS 1210
Med3 pfam11593
Mediator complex subunit 3 fungal; Mediator is a large complex of up to 33 proteins that is ...
392-458 3.41e-03

Mediator complex subunit 3 fungal; Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function. Mediator subunit Hrs1/Med3 is a physical target for Cyc8-Tup1, a yeast transcriptional co-repressor.


Pssm-ID: 256520 [Multi-domain]  Cd Length: 381  Bit Score: 38.08  E-value: 3.41e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 148658623  392 SPSATQPTmaTPSPsAAQPGTATPSPSATQPGTASPSPGVTDTIAPAVTATPGASPATLIATPTRTP 458
Cdd:pfam11593 128 SASITKTS--NGSD-AATTSSTANTPAAAKVLKANAASAPNTTTGVGSAATTAAISATTATTPTTTQ 191
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
337-470 3.42e-03

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 38.61  E-value: 3.42e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  337 PSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPS 416
Cdd:PHA03307  784 AGSSPPVRAEAAFRRPGRLRRSGPAADAASRTASKRKSRSHTPDGGSESSGPARPPGAAARPPPARSSESSKSKPAAAGG 863
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 148658623  417 PSATQPGTASPSPGVTDTIAPAVTATPGASPATLIATPTRTPIPLTPLTRTPTP 470
Cdd:PHA03307  864 RARGKNGRRRPRPPEPRARPGAAAPPKAAAAAPPAGAPAPRPRPAPRVKLGPMP 917
PHA03291 PHA03291
envelope glycoprotein I; Provisional
343-442 3.53e-03

envelope glycoprotein I; Provisional


Pssm-ID: 223033 [Multi-domain]  Cd Length: 401  Bit Score: 38.01  E-value: 3.53e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 343 GPANL-APAEPQPTiAATQAPPANVPPTDIPTLQPPTQNPAIIPaTPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQ 421
Cdd:PHA03291 198 GPADVfVPATPRPT-PRTTASPETTPTPSTTTSPPSTTIPAPST-TIAAPQAGTTPEAEGTPAPPTPGGGEAPPANATPA 275
                         90       100
                 ....*....|....*....|.
gi 148658623 422 PGTASPSPGVTDTIAPAVTAT 442
Cdd:PHA03291 276 PEASRYELTVTQIIQIAIPAS 296
COG4982 COG4982
3-oxoacyl-[acyl-carrier protein]
386-429 3.87e-03

3-oxoacyl-[acyl-carrier protein]


Pssm-ID: 227315 [Multi-domain]  Cd Length: 866  Bit Score: 38.30  E-value: 3.87e-03
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*
gi 148658623 386 ATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQ-PGTASPSP 429
Cdd:COG4982    4 ATDAKEEPAKEEATPPAPAASAPAPAAAAPAPVAAAaPAAAGPRP 48
DUF1421 pfam07223
Protein of unknown function (DUF1421); This family represents a conserved region approximately ...
337-460 3.92e-03

Protein of unknown function (DUF1421); This family represents a conserved region approximately 350 residues long within a number of plant proteins of unknown function.


Pssm-ID: 254110 [Multi-domain]  Cd Length: 357  Bit Score: 38.00  E-value: 3.92e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  337 PSVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQ-----------PPTQNPAIIPATPSTPSPSATQPTMATPSP 405
Cdd:pfam07223  53 PEQVAKHELADAPLQQVNAALPPAPAPQSPQPDQQQQSQappshqypsqlPPQQVQSVPQQPTPQQEPYYPPPSQPQPPP 132
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 148658623  406 S------AAQPGTATPSPSATQPGTASP-----SPGVTDTIAPAVTATPGASPATLIATPTRTPIP 460
Cdd:pfam07223 133 AqqpqaqQPQPPPQVPQQQQYQSPPQQPqyqqnPPPQAQSAPQVSGLYPEESPYQPQSYPPNEPLP 198
PRK14950 PRK14950
DNA polymerase III subunits gamma and tau; Provisional
334-409 4.21e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237864 [Multi-domain]  Cd Length: 585  Bit Score: 38.25  E-value: 4.21e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 334 VAYPSVLAPGPA-----NLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAA 408
Cdd:PRK14950 373 AAAPSPVRPTPApstrpKAAAAANIPPKEPVRETATPPPVPPRPVAPPVPHTPESAPKLTRAAIPVDEKPKYTPPAPPKE 452

                 .
gi 148658623 409 Q 409
Cdd:PRK14950 453 E 453
tatB PRK00404
sec-independent translocase; Provisional
339-401 4.29e-03

sec-independent translocase; Provisional


Pssm-ID: 166942 [Multi-domain]  Cd Length: 141  Bit Score: 36.34  E-value: 4.29e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 148658623 339 VLAP--GPANLAPAEPQPtiAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMA 401
Cdd:PRK00404  78 ILAPltPPAPPEPVTPPT--AQSPAPAVPTPPPTSTPAVPPAPAAAVPAPAAAPPPSDPPQPPRA 140
PRK10118 PRK10118
flagellar hook-length control protein; Provisional
349-432 4.43e-03

flagellar hook-length control protein; Provisional


Pssm-ID: 236652 [Multi-domain]  Cd Length: 408  Bit Score: 37.92  E-value: 4.43e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 349 PAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQP---TMATPSPSAAQPGTaTPSPSATQPGTA 425
Cdd:PRK10118 180 PSAPQDETHTLSSDEHEKGLTSAQLTTAQPDDAPGTPAQPLTPLAAEAQAkaeVISTPSPVTAAASP-TITPHQTQPLPT 258

                 ....*..
gi 148658623 426 SPSPGVT 432
Cdd:PRK10118 259 AAAPVLS 265
PRK14959 PRK14959
DNA polymerase III subunits gamma and tau; Provisional
344-419 4.46e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 184923 [Multi-domain]  Cd Length: 624  Bit Score: 38.12  E-value: 4.46e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 148658623 344 PANLAPAEPQPTIA-ATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSA 419
Cdd:PRK14959 416 PSSAAPATPAPSAApSPRVPWDDAPPAPPRSGIPPRPAPRMPEASPVPGAPDSVASASDAPPTLGDPSDTAEHTPSG 492
Pneumo_att_G pfam05539
Pneumovirinae attachment membrane glycoprotein G;
355-468 4.49e-03

Pneumovirinae attachment membrane glycoprotein G;


Pssm-ID: 114270 [Multi-domain]  Cd Length: 408  Bit Score: 37.72  E-value: 4.49e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  355 TIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTpspsATQPTMATPSPSAAQPGTATPSPSATQPGTASPSPGVTDT 434
Cdd:pfam05539 173 TTSKTTSWPTEVSHPTYPSQVTPQSQPATQGHQTAT----ANQRLSSTEPVGTQGTTTSSNPEPQTEPPPSQRGPSGSPQ 248
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 148658623  435 IAPAVTA----TPGASPATliaTPTRTPIPLTPLTRTP 468
Cdd:pfam05539 249 HPPSTTSqdqsTTGDGQEH---TQRRKTPPATSNRRSP 283
PRK10856 PRK10856
cytoskeletal protein RodZ; Provisional
394-470 4.81e-03

cytoskeletal protein RodZ; Provisional


Pssm-ID: 236776 [Multi-domain]  Cd Length: 331  Bit Score: 37.70  E-value: 4.81e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 148658623 394 SATQPTMATPSPSAAQPGTATPSPSatqPGTASPSPGVTDTIAPAVTATPGASPATliATPTRTPIPLTPLTRTPTP 470
Cdd:PRK10856 167 STTTDPATTPAPAAPVDTTPTNSQT---PAVATAPAPAVDPQQNAVVAPSQANVDT--AATPAPAAPATPDGAAPLP 238
PRK14963 PRK14963
DNA polymerase III subunits gamma and tau; Provisional
345-433 4.84e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 184927 [Multi-domain]  Cd Length: 504  Bit Score: 37.90  E-value: 4.84e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 345 ANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPsPSATQPTMATPSPSAAQPGTATPSPSATQPGT 424
Cdd:PRK14963 338 ALLALGGAPSEGVAAVAPPAPAPADLTQRLNRLEKEVRSLRSAPTAA-ATAAGAPLPDFDPRPRGPPAPEPARSAEAPPL 416

                 ....*....
gi 148658623 425 ASPSPGVTD 433
Cdd:PRK14963 417 VAPAAAPAG 425
2A1904 TIGR00927
K+-dependent Na+/Ca+ exchanger; [Transport and binding proteins, Cations and iron carrying ...
343-469 4.91e-03

K+-dependent Na+/Ca+ exchanger; [Transport and binding proteins, Cations and iron carrying compounds].


Pssm-ID: 233191 [Multi-domain]  Cd Length: 1096  Bit Score: 38.05  E-value: 4.91e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623   343 GPANLAPAEPQ----PTIAATQAPPANVPPTD--IPTLQPPTQN-PAIIPATPST--------PSPSATQPTMATPSPSA 407
Cdd:TIGR00927  117 RTAKITPTTPKnnysPTAAGTERVKEDTPATPsrALNHYISTSGrQRVKSYTPKPrgevksssPTQTREKVRKYTPSPLG 196
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 148658623   408 AQPGTATPSPSATQP--GTASPSPGVTDTIAPAVTATPGASPATLIATPTrTPIPLTPLT-RTPT 469
Cdd:TIGR00927  197 RMVNSYAPSTFMTMPrsHGITPRTTVKDSEITATYKMLETNPSKRTAGKT-TPTPLKGMTdNTPT 260
PRK14948 PRK14948
DNA polymerase III subunits gamma and tau; Provisional
362-438 5.07e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237862 [Multi-domain]  Cd Length: 620  Bit Score: 38.02  E-value: 5.07e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 148658623 362 PPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPGTASPSPGVTDTIAPA 438
Cdd:PRK14948 361 PSAFISEIANASAPANPTPAPNPSPPPAPIQPSAPKTKQAATTPSPPPAKASPPIPVPAEPTEPSPTPPANAANAPP 437
PHA03378 PHA03378
EBNA-3B; Provisional
345-470 5.15e-03

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 38.12  E-value: 5.15e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 345 ANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPST-PSPSATQPtmaTPSPSAAQPGTATPS----PSA 419
Cdd:PHA03378 522 ATLLPPSPPQPRAGRRAPCVYTEDLDIESDEPASTEPVHDQLLPAPgLGPLQIQP---LTSPTTSQLASSAPSyaqtPWP 598
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 148658623 420 TQPGTASPSPGVTDTIAPAvTATPGASPATLIATPTR----TPIPLTPLTRtPTP 470
Cdd:PHA03378 599 VPHPSQTPEPPTTQSHIPE-TSAPRQWPMPLRPIPMRplrmQPITFNVLVF-PTP 651
PRK10856 PRK10856
cytoskeletal protein RodZ; Provisional
341-419 5.16e-03

cytoskeletal protein RodZ; Provisional


Pssm-ID: 236776 [Multi-domain]  Cd Length: 331  Bit Score: 37.31  E-value: 5.16e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 341 APGPANLAPAEPQPTIA-ATQAPPANVPPTDIPTLQPPTQNPAiipATPSTPSPSATQPTMATPSPSAAQPGTATPSPSA 419
Cdd:PRK10856 175 TPAPAAPVDTTPTNSQTpAVATAPAPAVDPQQNAVVAPSQANV---DTAATPAPAAPATPDGAAPLPTDQAGVSTPAADP 251
PAT1 pfam09770
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ...
335-429 5.58e-03

Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division.


Pssm-ID: 255543 [Multi-domain]  Cd Length: 806  Bit Score: 37.83  E-value: 5.58e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  335 AYPSVLaPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAiiPATPSTPSPSATQPTMATPSPSAAQPGTAT 414
Cdd:pfam09770 231 PLPPQL-PQQPPPLQQPQFPGLSQQMPPPPPQPPQQQQQPPQPQAQPP--PQNQPTPHPGLPQGQNAPLPPPQQPQLLPL 307
                          90
                  ....*....|....*
gi 148658623  415 PSPSATQPGTASPSP 429
Cdd:pfam09770 308 VQQPQGQQRGPQFRE 322
PRK12495 PRK12495
hypothetical protein; Provisional
386-467 5.66e-03

hypothetical protein; Provisional


Pssm-ID: 183558 [Multi-domain]  Cd Length: 226  Bit Score: 37.16  E-value: 5.66e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 386 ATPSTPSPSATQPTMATPSPSAAQPGTATPSPsATQPGTASPSPGVTdtiAPAVTATPGASPATLIATPTRTPIPLTPLT 465
Cdd:PRK12495 100 AQPAAEAEAADQSAPPEASSTSATDEAATDPP-ATAAARDGPTPDPT---AQPATPDERRSPRQRPPVSGEPPTPSTPDA 175

                 ..
gi 148658623 466 RT 467
Cdd:PRK12495 176 HV 177
PRK11901 PRK11901
hypothetical protein; Reviewed
357-444 5.68e-03

hypothetical protein; Reviewed


Pssm-ID: 237015 [Multi-domain]  Cd Length: 327  Bit Score: 37.36  E-value: 5.68e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 357 AATQAppANVPPTDIPTlqpptqNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQPGTASPSPGVTDTI- 435
Cdd:PRK11901 162 AASQN--AQGNTSTLPT------APATVAPSKGAKVPATAETHPTPPQKPATKKPAVNHHKTATVAVPPATSGKPKSGAa 233
                         90
                 ....*....|
gi 148658623 436 -APAVTATPG 444
Cdd:PRK11901 234 sARALSSAPA 243
VirB10 COG2948
Type IV secretory pathway, VirB10 components [Intracellular trafficking and secretion]
321-466 5.69e-03

Type IV secretory pathway, VirB10 components [Intracellular trafficking and secretion]


Pssm-ID: 225499 [Multi-domain]  Cd Length: 360  Bit Score: 37.45  E-value: 5.69e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 321 TALFAGLVAVTLFVAYP-SVLAPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQN---PAIIPATPSTPSPSAT 396
Cdd:COG2948   24 RALLIAIVAVGRIALVGfALIALQGEKKRINNTQPPSNVERGTPPLPPLPDDPPLPPPLPVdlgAPVLPDQQVEEAKDQP 103
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 148658623 397 ----QPTMATPS----PSAAQPGTATPSPSATQPGTASPSPGVTDTIAPAVTATPGASPATLIATPTR-TPIPLTPLTR 466
Cdd:COG2948  104 rrlrAAELAATSgsrvESDRAVGRVRAALANAAPAAAAPPPAGQPSGQSAKEDFAGAVNPTQPFEVAAgTVIPAVLITA 182
FAP pfam07174
Fibronectin-attachment protein (FAP); This family contains bacterial fibronectin-attachment ...
381-458 5.82e-03

Fibronectin-attachment protein (FAP); This family contains bacterial fibronectin-attachment proteins (FAP). Family members are rich in alanine and proline, are approximately 300 long, and seem to be restricted to mycobacteria. These proteins contain a fibronectin-binding motif that allows mycobacteria to bind to fibronectin in the extracellular matrix.


Pssm-ID: 254090 [Multi-domain]  Cd Length: 297  Bit Score: 37.18  E-value: 5.82e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 148658623  381 PAIIPATPS-TPSPSATQPTMATPSPSAAQPGTATPSPSATQPGTASPSPGVTDTIAPAVTATPGASPATLIATPTRTP 458
Cdd:pfam07174  34 PATANADPApPPPPPSTAAAAPAPAAPPPPPPPAAPPAPQPDDPNAAPPPPPADPNAPPPPPVDPNAPPPPAPEPGRID 112
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
334-441 6.02e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 37.77  E-value: 6.02e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 334 VAYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPtdiptlqPPTQNPAIIPATPSTPSPSATQ-PTMATPSPSAAQPGT 412
Cdd:PRK14951 405 AAPAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPA-------AAPAAVALAPAPPAQAAPETVAiPVRVAPEPAVASAAP 477
                         90       100
                 ....*....|....*....|....*....
gi 148658623 413 ATPSPSATQPGTASPSPGVTDTIAPAVTA 441
Cdd:PRK14951 478 APAAAPAAARLTPTEEGDVWHATVQQLAA 506
PRK10263 PRK10263
DNA translocase FtsK; Provisional
337-470 6.12e-03

DNA translocase FtsK; Provisional


Pssm-ID: 236669 [Multi-domain]  Cd Length: 1355  Bit Score: 37.76  E-value: 6.12e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  337 PSVLaPGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMAT-PSPSAAQPGT-AT 414
Cdd:PRK10263  747 PIVE-PVQQPQQPVAPQQQYQQPQQPVAPQPQYQQPQQPVAPQPQYQQPQQPVAPQPQYQQPQQPVaPQPQYQQPQQpVA 825
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 148658623  415 PSPSATQPgTASPSPGVTDT-IAPAVTATPGASPatlIATPTrTPIPLTPLTrTPTP 470
Cdd:PRK10263  826 PQPQYQQP-QQPVAPQPQDTlLHPLLMRNGDSRP---LHKPT-TPLPSLDLL-TPPP 876
PRK14971 PRK14971
DNA polymerase III subunits gamma and tau; Provisional
337-441 6.17e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237874 [Multi-domain]  Cd Length: 614  Bit Score: 37.45  E-value: 6.17e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 337 PSVLAPGPANLAPAEPQPTIAATQAPPANVPPTdiptlQPPTQNPAIIPATPSTPSPSATQptmaTPSPSAAQPGTATPS 416
Cdd:PRK14971 381 PVFTQPAAAPQPSAAAAASPSPSQSSAAAQPSA-----PQSATQPAGTPPTVSVDPPAAVP----VNPPSTAPQAVRPAQ 451
                         90       100
                 ....*....|....*....|....*....
gi 148658623 417 PSATQP----GTASPSPGVTDTIAPAVTA 441
Cdd:PRK14971 452 FKEEKKipvsKVSSLGPSTLRPIQEKAEQ 480
PRK04654 PRK04654
sec-independent translocase; Provisional
334-451 6.22e-03

sec-independent translocase; Provisional


Pssm-ID: 135173 [Multi-domain]  Cd Length: 214  Bit Score: 36.71  E-value: 6.22e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 334 VAYPSVLAPGPANLAPAEPQPTIAATQAPPANVPPtdiptlqpPTQNPAIIPATPSTPSPSATqptmATPSPSaaqpGTA 413
Cdd:PRK04654 108 VATPLELAHADLSASAQVDAAAGAEPGAGQAHTPV--------PAPAPVIAQAQPIAPAPHQT----LVPAPH----DTI 171
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 148658623 414 TPSPSATQPGTASPSPGVTDTIAPAVTATPGASPATLI 451
Cdd:PRK04654 172 VPAPHAAHLPSAPATPVSVAPVDAGTSASPTPSEPTKI 209
tatB PRK00404
sec-independent translocase; Provisional
372-429 6.25e-03

sec-independent translocase; Provisional


Pssm-ID: 166942 [Multi-domain]  Cd Length: 141  Bit Score: 35.96  E-value: 6.25e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 148658623 372 PTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAqPGTATPSPSATQPGTASPSP 429
Cdd:PRK00404  81 PLTPPAPPEPVTPPTAQSPAPAVPTPPPTSTPAVPPA-PAAAVPAPAAAPPPSDPPQP 137
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
341-460 6.32e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 37.66  E-value: 6.32e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 341 APGPANLAPAEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSAT 420
Cdd:PRK07764 602 APASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKAGGAAPAAP 681
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|
gi 148658623 421 QPGTASPSPGVTDTIAPAVTATPGASPATLIATPTRTPIP 460
Cdd:PRK07764 682 PPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQP 721
PRK12495 PRK12495
hypothetical protein; Provisional
386-468 6.47e-03

hypothetical protein; Provisional


Pssm-ID: 183558 [Multi-domain]  Cd Length: 226  Bit Score: 36.77  E-value: 6.47e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623 386 ATPSTPSPSATQPTMATP-SPSAAQPGTATPSPSATQPGTASPS-PGVTDTIAPAVTATPGASPATliATPTRTPIPLTP 463
Cdd:PRK12495  85 TAPSDAGSQASPDDDAQPaAEAEAADQSAPPEASSTSATDEAATdPPATAAARDGPTPDPTAQPAT--PDERRSPRQRPP 162

                 ....*
gi 148658623 464 LTRTP 468
Cdd:PRK12495 163 VSGEP 167
SLAIN pfam15301
SLAIN motif-containing family; The SLAIN motif containing family is named after the presence ...
343-429 6.55e-03

SLAIN motif-containing family; The SLAIN motif containing family is named after the presence of a SLAIN motif in SLAIN1. They are a family of microtubule plus-end tracking proteins.


Pssm-ID: 259434 [Multi-domain]  Cd Length: 347  Bit Score: 37.21  E-value: 6.55e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623  343 GPANLAPAEPQPTIAAtqappANVPPTDIPTLQPPTQ-NPAIIPATPSTPSPSATQPTMATPSPSAAQPGTATPSPSATQ 421
Cdd:pfam15301 248 SVGHSPLSLRQPLKAT-----AYVSPTIQGTASTTLQsIPQSSPSASSKPTATATPARSALPRPSTFGGGSPVPRSKLAQ 322

                  ....*...
gi 148658623  422 PGTASPSP 429
Cdd:pfam15301 323 PVRSSLPP 330
Retinal pfam15449
Retinal protein; This family of proteins is found in the photoreceptor cells of the retina. ...
337-468 6.55e-03

Retinal protein; This family of proteins is found in the photoreceptor cells of the retina. Mutations of the gene encoding this protein have been associated with retinal disorders such as retinitis pigmentosa and late-onset progressive retinal atrophy. The function of this family of proteins is unknown, but it is likely to be important in the development and function of the retina.


Pssm-ID: 259580 [Multi-domain]  Cd Length: 1286  Bit Score: 37.88  E-value: 6.55e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148658623   337 PSVLAPGPANLAP-AEPQPTIAATQAPPANVPPTDIPTLQPPTQNPAiipATPSTPSPSATQPTMA-TPSPSAAQP-GTA 413
Cdd:pfam15449 1046 PSVQGSPSPPLSPrTLSPPTRKKRTSPPPQHKLPSPPPQSPPAQHKL---SSPPTQRTEASSPSSGpSPSPPVSPSqGPK 1122
                           90       100       110       120       130
                   ....*....|..