NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|148539554|ref|NP_919270.2|]
View 

indoleamine 2,3-dioxygenase 2

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
IDO pfam01231
Indoleamine 2,3-dioxygenase;
26-416 0e+00

Indoleamine 2,3-dioxygenase;


:

Pssm-ID: 250463  Cd Length: 407  Bit Score: 563.40  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148539554   26 PLSLESYHISEEYGFLL-PDSLKELPD-HYRPWMEIANKLPQLIDAHQLQAHVDKMPLLSCQFLKGHREQRLAHLVLSFL 103
Cdd:pfam01231   2 IPSLEDYGVSPDTGFLPdEDPLERLPDpYYAPWEEIASNLPSLILSKRLRDAVDKLPVLDTSKLQGEREWRRAYLVLGFI 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148539554  104 TMGYVWQeGEAQPAEVLPRNLALPFVEVSRNLGLPPILVHSDLVLTNWTKKDPDGFLEIGNLETIISFPGGESLHGFILV 183
Cdd:pfam01231  82 AHAYVWG-GEDKPADVLPPCIAVPLLEVSEHLGLPPILTYADLVLWNWKPIDPDDPLDLDNLSTINTFTGTKDESWFYLV 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148539554  184 TALVEKEAVPGIKALVQATNAILQPNQEALLQALQRLRLSIQDITKTLGQMHDYVDPDIFYAGIRIFLSGWKDNPA--MP 261
Cdd:pfam01231 161 SVAIEAAGAPAIPAMLNAIDAARADDSARVTKALQQLAESIDRLGKLLERMHEKCDPEVFYHVIRPYLAGWKNMADagLP 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148539554  262 AGLMYEGVSQEPLKYSGGSAAQSTVLHAFDEFLGIRHSKESG------DFLYRMRDYMPPSHKAFIEDIHSAPSLRDYIL 335
Cdd:pfam01231 241 NGLIYEGVSGEPRQYSGGSAAQSSLIQFLDILLGIEHSPTGErkpskaGFLQEMRNYMPGPHRRFLEHLESVPNIREYVL 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148539554  336 SSGQDH-LLTAYNQCVQALAELRSYHITMVTKYLITAAAKAKHGKPNHLPG-----PPQALKDRGTGGTAVMSFLKSVRD 409
Cdd:pfam01231 321 SHKDDSeLTEAYDACLAALKSFRDKHIQIVTRYIIIAAKKAPPGGSSRQVNgdaseKPNGLELRGTGGTDLIPFLKQVRD 400

                  ....*..
gi 148539554  410 KTLESIL 416
Cdd:pfam01231 401 ETKEAAL 407
 
Name Accession Description Interval E-value
IDO pfam01231
Indoleamine 2,3-dioxygenase;
26-416 0e+00

Indoleamine 2,3-dioxygenase;


Pssm-ID: 250463  Cd Length: 407  Bit Score: 563.40  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148539554   26 PLSLESYHISEEYGFLL-PDSLKELPD-HYRPWMEIANKLPQLIDAHQLQAHVDKMPLLSCQFLKGHREQRLAHLVLSFL 103
Cdd:pfam01231   2 IPSLEDYGVSPDTGFLPdEDPLERLPDpYYAPWEEIASNLPSLILSKRLRDAVDKLPVLDTSKLQGEREWRRAYLVLGFI 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148539554  104 TMGYVWQeGEAQPAEVLPRNLALPFVEVSRNLGLPPILVHSDLVLTNWTKKDPDGFLEIGNLETIISFPGGESLHGFILV 183
Cdd:pfam01231  82 AHAYVWG-GEDKPADVLPPCIAVPLLEVSEHLGLPPILTYADLVLWNWKPIDPDDPLDLDNLSTINTFTGTKDESWFYLV 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148539554  184 TALVEKEAVPGIKALVQATNAILQPNQEALLQALQRLRLSIQDITKTLGQMHDYVDPDIFYAGIRIFLSGWKDNPA--MP 261
Cdd:pfam01231 161 SVAIEAAGAPAIPAMLNAIDAARADDSARVTKALQQLAESIDRLGKLLERMHEKCDPEVFYHVIRPYLAGWKNMADagLP 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148539554  262 AGLMYEGVSQEPLKYSGGSAAQSTVLHAFDEFLGIRHSKESG------DFLYRMRDYMPPSHKAFIEDIHSAPSLRDYIL 335
Cdd:pfam01231 241 NGLIYEGVSGEPRQYSGGSAAQSSLIQFLDILLGIEHSPTGErkpskaGFLQEMRNYMPGPHRRFLEHLESVPNIREYVL 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148539554  336 SSGQDH-LLTAYNQCVQALAELRSYHITMVTKYLITAAAKAKHGKPNHLPG-----PPQALKDRGTGGTAVMSFLKSVRD 409
Cdd:pfam01231 321 SHKDDSeLTEAYDACLAALKSFRDKHIQIVTRYIIIAAKKAPPGGSSRQVNgdaseKPNGLELRGTGGTDLIPFLKQVRD 400

                  ....*..
gi 148539554  410 KTLESIL 416
Cdd:pfam01231 401 ETKEAAL 407
 
Name Accession Description Interval E-value
IDO pfam01231
Indoleamine 2,3-dioxygenase;
26-416 0e+00

Indoleamine 2,3-dioxygenase;


Pssm-ID: 250463  Cd Length: 407  Bit Score: 563.40  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148539554   26 PLSLESYHISEEYGFLL-PDSLKELPD-HYRPWMEIANKLPQLIDAHQLQAHVDKMPLLSCQFLKGHREQRLAHLVLSFL 103
Cdd:pfam01231   2 IPSLEDYGVSPDTGFLPdEDPLERLPDpYYAPWEEIASNLPSLILSKRLRDAVDKLPVLDTSKLQGEREWRRAYLVLGFI 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148539554  104 TMGYVWQeGEAQPAEVLPRNLALPFVEVSRNLGLPPILVHSDLVLTNWTKKDPDGFLEIGNLETIISFPGGESLHGFILV 183
Cdd:pfam01231  82 AHAYVWG-GEDKPADVLPPCIAVPLLEVSEHLGLPPILTYADLVLWNWKPIDPDDPLDLDNLSTINTFTGTKDESWFYLV 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148539554  184 TALVEKEAVPGIKALVQATNAILQPNQEALLQALQRLRLSIQDITKTLGQMHDYVDPDIFYAGIRIFLSGWKDNPA--MP 261
Cdd:pfam01231 161 SVAIEAAGAPAIPAMLNAIDAARADDSARVTKALQQLAESIDRLGKLLERMHEKCDPEVFYHVIRPYLAGWKNMADagLP 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148539554  262 AGLMYEGVSQEPLKYSGGSAAQSTVLHAFDEFLGIRHSKESG------DFLYRMRDYMPPSHKAFIEDIHSAPSLRDYIL 335
Cdd:pfam01231 241 NGLIYEGVSGEPRQYSGGSAAQSSLIQFLDILLGIEHSPTGErkpskaGFLQEMRNYMPGPHRRFLEHLESVPNIREYVL 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148539554  336 SSGQDH-LLTAYNQCVQALAELRSYHITMVTKYLITAAAKAKHGKPNHLPG-----PPQALKDRGTGGTAVMSFLKSVRD 409
Cdd:pfam01231 321 SHKDDSeLTEAYDACLAALKSFRDKHIQIVTRYIIIAAKKAPPGGSSRQVNgdaseKPNGLELRGTGGTDLIPFLKQVRD 400

                  ....*..
gi 148539554  410 KTLESIL 416
Cdd:pfam01231 401 ETKEAAL 407
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH